[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tmar0:AAD35678.1

[Show Plain Result]


## Summary of Sequence Search
    1::246
   34::252     5e-37  42%  255 aa  ARTP_BACSU RecName: Full=Arginine-binding extracellular protein
   26::212     2e-36  41%  243 aa  ARTJ_ECOLI RecName: Full=ABC transporter arginine-binding protein
   32::260     5e-36  35%  266 aa  FLIY_ECOLI RecName: Full=Cystine-binding periplasmic protein;      
   32::260     5e-36  35%  266 aa  FLIY_ECOL6 RecName: Full=Cystine-binding periplasmic protein;      
   29::243     2e-34  37%  243 aa  ARTI_ECOLI RecName: Full=Putative ABC transporter arginine-binding
   41::261     2e-33  38%  268 aa  HISJ_NEIGO RecName: Full=Histidine-binding protein;       
   27::243     5e-33  39%  248 aa  GLNH_ECOLI RecName: Full=Glutamine-binding periplasmic protein;    
   27::243     5e-33  39%  248 aa  GLNH_ECOL6 RecName: Full=Glutamine-binding periplasmic protein;    
   27::243     5e-33  39%  248 aa  GLNH_ECO57 RecName: Full=Glutamine-binding periplasmic protein;    
   30::253     4e-32  37%  260 aa  HISJ_ECOLI RecName: Full=Histidine-binding periplasmic protein;    
   30::253     4e-32  37%  260 aa  HISJ_ECOL6 RecName: Full=Histidine-binding periplasmic protein;    
   30::253     4e-32  37%  260 aa  HISJ_ECO57 RecName: Full=Histidine-binding periplasmic protein;    
   30::253     1e-31  37%  260 aa  HISJ_SALTY RecName: Full=Histidine-binding periplasmic protein;    
   41::253     7e-31  37%  256 aa  HISJ_CAMJE RecName: Full=Histidine-binding protein;       
   30::253     4e-30  36%  260 aa  ARGT_ECOLI RecName: Full=Lysine-arginine-ornithine-binding
   52::251     4e-29  41%  262 aa  GLNH_BACST RecName: Full=Glutamine-binding protein;       
   30::253     6e-29  35%  260 aa  ARGT_SALTY RecName: Full=Lysine-arginine-ornithine-binding
   21::233     8e-29  34%  237 aa  LAPT_PASHA RecName: Full=Arginine-binding periplasmic
   37::253     8e-27  33%  257 aa  ARTJ_CHLTR RecName: Full=Probable ABC transporter arginine-binding
   42::269     4e-25  34%  273 aa  GLNH_BACSU RecName: Full=ABC transporter glutamine-binding protein
   28::239     2e-21  30%  257 aa  Y1080_HAEIN RecName: Full=Probable amino-acid ABC
   33::268     3e-21  31%  302 aa  GLTI_SALTY RecName: Full=Glutamate/aspartate periplasmic-binding
   35::256     5e-21  33%  264 aa  YXEM_BACSU RecName: Full=Probable amino-acid-binding protein
   29::257     5e-21  28%  259 aa  PEB1A_CAMJJ RecName: Full=Major cell-binding factor;AltName:
   29::257     8e-21  28%  259 aa  PEB1A_CAMJE RecName: Full=Major cell-binding factor;AltName:
   27::187     3e-20  38%  248 aa  PATH_VIBHA RecName: Full=Putative amino-acid ABC
   31::275     9e-20  28%  283 aa  NOCT_AGRT5 RecName: Full=Nopaline-binding periplasmic
   34::268     2e-19  29%  302 aa  GLTI_ECOLI RecName: Full=Glutamate/aspartate periplasmic-binding
   41::264     3e-19  28%  268 aa  TCYA_BACSU RecName: Full=L-cystine-binding protein tcyA;Flags:
   25::244     2e-18  33%  294 aa  OCCT_RHIME RecName: Full=Octopine-binding periplasmic
   31::209     1e-17  29%  268 aa  PHEC_PSEAE RecName: Full=Cyclohexadienyl dehydratase;Includes:
   22::239     1e-17  28%  239 aa  ARTI_HAEIN RecName: Full=ABC transporter arginine-binding
   28::249     4e-17  29%  253 aa  AABA_DICNO RecName: Full=Amino-acid-binding protein aabA;Flags:
   34::253     9e-17  33%  486 aa  MLTF_PSEF5 RecName: Full=Membrane-bound lytic murein
   62::250     9e-17  34%  454 aa  MLTF_DESOH RecName: Full=Membrane-bound lytic murein
   25::269     5e-16  29%  276 aa  OCCT_RHIRD RecName: Full=Octopine-binding periplasmic
   25::269     5e-16  29%  276 aa  OCCT_AGRT4 RecName: Full=Octopine-binding periplasmic
   39::268     2e-15  24%  287 aa  YCKB_BACSU RecName: Full=Probable ABC transporter
   43::169     1e-14  31%  300 aa  Y4TE_RHISN RecName: Full=Probable amino-acid ABC transporter
   35::193     4e-14  32%  269 aa  TCYJ_BACSU RecName: Full=L-cystine-binding protein tcyJ;Flags:
   34::253     4e-14  32%  486 aa  MLTF_PSEPF RecName: Full=Membrane-bound lytic murein
  317::525     7e-14  28% 1238 aa  BVGS_BORPE RecName: Full=Virulence sensor protein bvgS;       
   38::247     1e-13  28%  270 aa  TCYK_BACSU RecName: Full=L-cystine-binding protein tcyK;Flags:
   21::235     1e-13  26%  655 aa  Y3689_SHEFN RecName: Full=Putative sensor protein Sfri_3689;       
   42::160     2e-13  36%  501 aa  MLTF_SACD2 RecName: Full=Membrane-bound lytic murein
   28::246     2e-13  26%  341 aa  YHDW_ECO57 RecName: Full=Putative amino-acid ABC
   29::246     3e-13  26%  341 aa  YHDW_ECOLI RecName: Full=Putative amino-acid ABC
   37::268     8e-13  30%  514 aa  MLTF_PHOPR RecName: Full=Membrane-bound lytic murein
   29::242     8e-13  28%  341 aa  AAPJ_RHIL3 RecName: Full=General L-amino acid-binding periplasmic
   28::243     1e-12  30%  501 aa  MLTF_COLP3 RecName: Full=Membrane-bound lytic murein
   36::266     2e-12  30%  488 aa  MLTF_PSEMY RecName: Full=Membrane-bound lytic murein
   34::253     9e-12  31%  497 aa  MLTF_PSESM RecName: Full=Membrane-bound lytic murein
  317::525     9e-12  26% 1238 aa  BVGS_BORPA RecName: Full=Virulence sensor protein bvgS;       
  317::525     9e-12  26% 1238 aa  BVGS_BORBR RecName: Full=Virulence sensor protein bvgS;       
   30::250     1e-11  27%  455 aa  MLTF_IDILO RecName: Full=Membrane-bound lytic murein
   43::260     3e-11  25%  294 aa  GLUB_COREF RecName: Full=Glutamate-binding protein;Flags:
   34::253     6e-11  30%  496 aa  MLTF_PSE14 RecName: Full=Membrane-bound lytic murein
   40::164     6e-11  31%  496 aa  MLTF_AERHH RecName: Full=Membrane-bound lytic murein
   37::151     6e-11  34%  483 aa  MLTF_ACTSZ RecName: Full=Membrane-bound lytic murein
   34::253     1e-10  28%  485 aa  MLTF_PSEPW RecName: Full=Membrane-bound lytic murein
   25::234     1e-10  30%  338 aa  BZTA_RHOCA RecName:
   34::253     2e-10  30%  498 aa  MLTF_PSEU2 RecName: Full=Membrane-bound lytic murein
   34::253     2e-10  29%  485 aa  MLTF_PSEPG RecName: Full=Membrane-bound lytic murein
   36::264     3e-10  28%  495 aa  MLTF_VIBF1 RecName: Full=Membrane-bound lytic murein
   53::252     4e-10  28%  511 aa  MLTF_KLEP7 RecName: Full=Membrane-bound lytic murein
   39::251     5e-10  27%  466 aa  MLTF_SODGM RecName: Full=Membrane-bound lytic murein
   40::211     5e-10  32%  496 aa  MLTF_AERS4 RecName: Full=Membrane-bound lytic murein
  438::540     5e-10  36%  956 aa  GRIK4_RAT RecName: Full=Glutamate receptor, ionotropic kainate
   35::253     7e-10  29%  489 aa  MLTF_PSEAB RecName: Full=Membrane-bound lytic murein
   34::253     8e-10  27%  485 aa  MLTF_PSEPK RecName: Full=Membrane-bound lytic murein
   43::260     8e-10  24%  295 aa  GLUB_CORGL RecName: Full=Glutamate-binding protein;Flags:
   36::252     1e-09  28%  514 aa  MLTF_SALPB RecName: Full=Membrane-bound lytic murein
   34::253     1e-09  27%  485 aa  MLTF_PSEP1 RecName: Full=Membrane-bound lytic murein
  438::534     1e-09  38%  956 aa  GRIK4_MOUSE RecName: Full=Glutamate receptor, ionotropic kainate
   34::240     2e-09  28%  486 aa  MLTF_YERPY RecName: Full=Membrane-bound lytic murein
   34::240     2e-09  28%  486 aa  MLTF_YERPS RecName: Full=Membrane-bound lytic murein
   34::240     2e-09  28%  486 aa  MLTF_YERPP RecName: Full=Membrane-bound lytic murein
   34::240     2e-09  28%  486 aa  MLTF_YERPN RecName: Full=Membrane-bound lytic murein
   34::240     2e-09  28%  486 aa  MLTF_YERPG RecName: Full=Membrane-bound lytic murein
   34::240     2e-09  28%  486 aa  MLTF_YERPE RecName: Full=Membrane-bound lytic murein
   34::240     2e-09  28%  486 aa  MLTF_YERPB RecName: Full=Membrane-bound lytic murein
   34::240     2e-09  28%  486 aa  MLTF_YERPA RecName: Full=Membrane-bound lytic murein
   34::240     2e-09  28%  486 aa  MLTF_YERP3 RecName: Full=Membrane-bound lytic murein
   34::253     2e-09  28%  485 aa  MLTF_PSEE4 RecName: Full=Membrane-bound lytic murein
  438::534     2e-09  36%  956 aa  GRIK4_PANTR RecName: Full=Glutamate receptor, ionotropic kainate
  438::534     2e-09  36%  956 aa  GRIK4_HUMAN RecName: Full=Glutamate receptor, ionotropic kainate
   34::226     3e-09  28%  486 aa  MLTF_YERE8 RecName: Full=Membrane-bound lytic murein
   35::254     3e-09  29%  490 aa  MLTF_PSEAE RecName: Full=Membrane-bound lytic murein
   47::212     3e-09  29%  478 aa  MLTF_NITMU RecName: Full=Membrane-bound lytic murein
   40::150     3e-09  29%  472 aa  MLTF_METFK RecName: Full=Membrane-bound lytic murein
  435::540     3e-09  32%  902 aa  GRIA4_RAT RecName: Full=Glutamate receptor 4;         Short=GluR-4;
  435::540     3e-09  32%  902 aa  GRIA4_MOUSE RecName: Full=Glutamate receptor 4;       
  435::540     3e-09  32%  902 aa  GRIA4_MACFA RecName: Full=Glutamate receptor 4;       
  435::540     3e-09  32%  902 aa  GRIA4_HUMAN RecName: Full=Glutamate receptor 4;       
   35::147     4e-09  31%  530 aa  MLTF_VIBCH RecName: Full=Membrane-bound lytic murein
   35::147     4e-09  31%  530 aa  MLTF_VIBC3 RecName: Full=Membrane-bound lytic murein
  435::551     6e-09  38% 1009 aa  GRID2_DANRE RecName: Full=Glutamate receptor delta-2 subunit;      
  532::638     6e-09  31%  977 aa  GLR2_CAEEL RecName: Full=Glutamate receptor 2;Flags: Precursor;
  505::606     6e-09  35%  991 aa  GLK1_DROME RecName: Full=Glutamate receptor 1;AltName:
   55::254     9e-09  29%  476 aa  MLTF_SHEB9 RecName: Full=Membrane-bound lytic murein
   55::254     9e-09  29%  476 aa  MLTF_SHEB8 RecName: Full=Membrane-bound lytic murein
   55::254     9e-09  29%  476 aa  MLTF_SHEB5 RecName: Full=Membrane-bound lytic murein
   35::254     9e-09  29%  490 aa  MLTF_PSEA7 RecName: Full=Membrane-bound lytic murein
   52::146     9e-09  33%  479 aa  GLRK_XENLA RecName: Full=Glutamate receptor U1;AltName:
   34::226     1e-08  26%  486 aa  MLTF_SERP5 RecName: Full=Membrane-bound lytic murein
  434::539     1e-08  32%  883 aa  GRIA2_RAT RecName: Full=Glutamate receptor 2;       
  434::539     1e-08  32%  883 aa  GRIA2_PONAB RecName: Full=Glutamate receptor 2;       
  434::539     1e-08  32%  883 aa  GRIA2_MOUSE RecName: Full=Glutamate receptor 2;       
  434::539     1e-08  32%  883 aa  GRIA2_MACFA RecName: Full=Glutamate receptor 2;       
  434::539     1e-08  32%  883 aa  GRIA2_HUMAN RecName: Full=Glutamate receptor 2;       
   36::252     2e-08  30%  518 aa  MLTF_SHIDS RecName: Full=Membrane-bound lytic murein
   55::254     2e-08  28%  478 aa  MLTF_SHESR RecName: Full=Membrane-bound lytic murein
   33::262     2e-08  27%  467 aa  MLTF_ALCBS RecName: Full=Membrane-bound lytic murein
  448::550     2e-08  37% 1009 aa  GRID1_RAT RecName: Full=Glutamate receptor delta-1 subunit;        
  448::550     2e-08  37% 1009 aa  GRID1_MOUSE RecName: Full=Glutamate receptor delta-1 subunit;      
  448::550     2e-08  37% 1009 aa  GRID1_HUMAN RecName: Full=Glutamate receptor delta-1 subunit;      
   36::227     2e-08  28%  518 aa  MLTF_SHISS RecName: Full=Membrane-bound lytic murein
  432::533     2e-08  33%  979 aa  GRIK5_RAT RecName: Full=Glutamate receptor, ionotropic kainate
  432::533     2e-08  33%  979 aa  GRIK5_MOUSE RecName: Full=Glutamate receptor, ionotropic kainate
  432::533     2e-08  33%  980 aa  GRIK5_HUMAN RecName: Full=Glutamate receptor, ionotropic kainate
   55::217     3e-08  29%  478 aa  MLTF_SHESM RecName: Full=Membrane-bound lytic murein
   55::217     3e-08  29%  478 aa  MLTF_SHESA RecName: Full=Membrane-bound lytic murein
  459::558     3e-08  33%  919 aa  GRIK3_RAT RecName: Full=Glutamate receptor, ionotropic kainate
  459::558     3e-08  33%  919 aa  GRIK3_MACFA RecName: Full=Glutamate receptor, ionotropic kainate
  459::558     3e-08  33%  919 aa  GRIK3_HUMAN RecName: Full=Glutamate receptor, ionotropic kainate
   36::227     4e-08  28%  518 aa  MLTF_SHIF8 RecName: Full=Membrane-bound lytic murein
   57::231     4e-08  26%  470 aa  MLTF_PSEHT RecName: Full=Membrane-bound lytic murein
  489::575     4e-08  36%  962 aa  GLR1_CAEEL RecName: Full=Glutamate receptor 1;Flags: Precursor;
   36::227     5e-08  28%  518 aa  MLTF_SHIFL RecName: Full=Membrane-bound lytic murein
   55::144     5e-08  37%  478 aa  MLTF_SHEON RecName: Full=Membrane-bound lytic murein
   36::227     5e-08  28%  518 aa  MLTF_ECOLI RecName: Full=Membrane-bound lytic murein
   36::227     5e-08  28%  518 aa  MLTF_ECOLC RecName: Full=Membrane-bound lytic murein
   36::227     5e-08  28%  518 aa  MLTF_ECOHS RecName: Full=Membrane-bound lytic murein
   36::227     5e-08  28%  518 aa  MLTF_ECODH RecName: Full=Membrane-bound lytic murein
   36::227     5e-08  28%  518 aa  MLTF_ECO57 RecName: Full=Membrane-bound lytic murein
   36::227     5e-08  28%  518 aa  MLTF_ECO11 RecName: Full=Membrane-bound lytic murein
  313::518     5e-08  24% 1197 aa  EVGS_ECOLI RecName: Full=Sensor protein evgS;       
   36::227     6e-08  28%  518 aa  MLTF_ECOUT RecName: Full=Membrane-bound lytic murein
   36::227     6e-08  28%  518 aa  MLTF_ECOL5 RecName: Full=Membrane-bound lytic murein
   36::227     6e-08  28%  518 aa  MLTF_ECOK1 RecName: Full=Membrane-bound lytic murein
   36::227     6e-08  28%  518 aa  MLTF_ECO24 RecName: Full=Membrane-bound lytic murein
   36::252     6e-08  28%  515 aa  MLTF_CITK8 RecName: Full=Membrane-bound lytic murein
  399::532     6e-08  31%  907 aa  GRIA1_RAT RecName: Full=Glutamate receptor 1;       
  399::532     6e-08  31%  907 aa  GRIA1_MOUSE RecName: Full=Glutamate receptor 1;       
  399::532     6e-08  31%  906 aa  GRIA1_MACFA RecName: Full=Glutamate receptor 1;       
  399::532     6e-08  31%  906 aa  GRIA1_HUMAN RecName: Full=Glutamate receptor 1;       
   36::227     8e-08  28%  518 aa  MLTF_SHIBS RecName: Full=Membrane-bound lytic murein
   36::227     8e-08  28%  518 aa  MLTF_SHIB3 RecName: Full=Membrane-bound lytic murein
   36::227     8e-08  28%  518 aa  MLTF_ECOSM RecName: Full=Membrane-bound lytic murein
   36::227     8e-08  25%  518 aa  MLTF_ECOL6 RecName: Full=Membrane-bound lytic murein
  313::518     8e-08  23% 1197 aa  EVGS_ECO57 RecName: Full=Sensor protein evgS;       
  435::551     1e-07  34% 1007 aa  GRID2_RAT RecName: Full=Glutamate receptor delta-2 subunit;        
  435::551     1e-07  34% 1007 aa  GRID2_MOUSE RecName: Full=Glutamate receptor delta-2 subunit;      
  435::551     1e-07  34% 1007 aa  GRID2_HUMAN RecName: Full=Glutamate receptor delta-2 subunit;      
  483::574     2e-07  32% 1323 aa  NMDE4_RAT RecName: Full=Glutamate [NMDA] receptor subunit
  483::574     2e-07  32% 1323 aa  NMDE4_MOUSE RecName: Full=Glutamate [NMDA] receptor subunit
  486::577     2e-07  32% 1336 aa  NMDE4_HUMAN RecName: Full=Glutamate [NMDA] receptor subunit
   50::146     2e-07  31%  487 aa  GLRK_RANBE RecName: Full=Probable glutamate receptor;AltName:
  453::540     2e-07  32%  917 aa  GLRK_LYMST RecName: Full=Glutamate receptor;Flags: Precursor;
  437::542     3e-07  29%  888 aa  GRIA3_RAT RecName: Full=Glutamate receptor 3;         Short=GluR-3;
  437::542     3e-07  29%  888 aa  GRIA3_MOUSE RecName: Full=Glutamate receptor 3;       
  443::548     3e-07  29%  894 aa  GRIA3_MACFA RecName: Full=Glutamate receptor 3;       
  443::548     3e-07  29%  894 aa  GRIA3_HUMAN RecName: Full=Glutamate receptor 3;       
   34::202     5e-07  29%  486 aa  MLTF_PSEU5 RecName: Full=Membrane-bound lytic murein
  456::547     7e-07  35% 1236 aa  NMDE3_HUMAN RecName: Full=Glutamate [NMDA] receptor subunit
   55::144     7e-07  35%  477 aa  MLTF_SHESW RecName: Full=Membrane-bound lytic murein
   55::144     7e-07  35%  477 aa  MLTF_SHEPC RecName: Full=Membrane-bound lytic murein
   39::252     7e-07  26%  514 aa  MLTF_SALAR RecName: Full=Membrane-bound lytic murein
  456::556     9e-07  31%  908 aa  GRIK2_RAT RecName: Full=Glutamate receptor, ionotropic kainate
  456::556     9e-07  31%  908 aa  GRIK2_MOUSE RecName: Full=Glutamate receptor, ionotropic kainate
  457::556     9e-07  32%  836 aa  GRIK1_MOUSE RecName: Full=Glutamate receptor, ionotropic kainate
  472::571     9e-07  32%  918 aa  GRIK1_MACFA RecName: Full=Glutamate receptor, ionotropic kainate
  472::571     9e-07  32%  918 aa  GRIK1_HUMAN RecName: Full=Glutamate receptor, ionotropic kainate
  459::550     1e-06  32% 1482 aa  NMDE2_RAT RecName: Full=Glutamate [NMDA] receptor subunit
  459::550     1e-06  32% 1482 aa  NMDE2_MOUSE RecName: Full=Glutamate [NMDA] receptor subunit
  459::550     1e-06  32% 1484 aa  NMDE2_HUMAN RecName: Full=Glutamate [NMDA] receptor subunit
  459::550     1e-06  32% 1485 aa  NMDE2_CANFA RecName: Full=Glutamate [NMDA] receptor subunit
   36::254     2e-06  27%  493 aa  MLTF_ERWT9 RecName: Full=Membrane-bound lytic murein
   38::254     2e-06  26%  481 aa  MLTF_ERWCT RecName: Full=Membrane-bound lytic murein
  456::556     2e-06  31%  908 aa  GRIK2_MACFA RecName: Full=Glutamate receptor, ionotropic kainate
  456::556     2e-06  31%  908 aa  GRIK2_HUMAN RecName: Full=Glutamate receptor, ionotropic kainate
   69::153     2e-06  32%  487 aa  GLRK_ANAPL RecName: Full=Probable glutamate receptor;AltName:
  456::547     2e-06  32% 1239 aa  NMDE3_MOUSE RecName: Full=Glutamate [NMDA] receptor subunit
   36::252     3e-06  26%  514 aa  MLTF_SALTY RecName: Full=Membrane-bound lytic murein
   36::252     3e-06  26%  475 aa  MLTF_SALTI RecName: Full=Membrane-bound lytic murein
   36::252     3e-06  26%  514 aa  MLTF_SALPA RecName: Full=Membrane-bound lytic murein
   36::252     3e-06  26%  514 aa  MLTF_SALCH RecName: Full=Membrane-bound lytic murein
  456::547     3e-06  32% 1237 aa  NMDE3_RAT RecName: Full=Glutamate [NMDA] receptor subunit
   64::153     3e-06  28%  487 aa  GLRK_CHICK RecName: Full=Probable glutamate receptor;AltName:
  472::571     4e-06  31%  949 aa  GRIK1_RAT RecName: Full=Glutamate receptor, ionotropic kainate
  458::561     7e-06  29% 1464 aa  NMDE1_RAT RecName: Full=Glutamate [NMDA] receptor subunit
  458::561     7e-06  29% 1464 aa  NMDE1_PANTR RecName: Full=Glutamate [NMDA] receptor subunit
  458::561     7e-06  29% 1464 aa  NMDE1_MOUSE RecName: Full=Glutamate [NMDA] receptor subunit
  458::561     7e-06  29% 1464 aa  NMDE1_HUMAN RecName: Full=Glutamate [NMDA] receptor subunit
   44::165     1e-05  28%  479 aa  MLTF_SHEPA RecName: Full=Membrane-bound lytic murein
   36::227     1e-05  25%  519 aa  MLTF_ENTS8 RecName: Full=Membrane-bound lytic murein
   36::178     1e-05  35%  467 aa  MLTF_SULDN RecName: Full=Membrane-bound lytic murein
   44::180     2e-05  25%  475 aa  MLTF_SHEHH RecName: Full=Membrane-bound lytic murein
   38::226     2e-05  28%  456 aa  MLTF_MARMM RecName: Full=Membrane-bound lytic murein
   47::131     3e-05  24%  476 aa  MLTF_SHELP RecName: Full=Membrane-bound lytic murein
   50::148     4e-05  28%  481 aa  MLTF_SHEAM RecName: Full=Membrane-bound lytic murein
   35::147     5e-05  30%  529 aa  MLTF_VIBVY RecName: Full=Membrane-bound lytic murein
   35::147     5e-05  30%  529 aa  MLTF_VIBVU RecName: Full=Membrane-bound lytic murein
   72::278     5e-05  24%  349 aa  FLGI_ARCB4 RecName: Full=Flagellar P-ring protein;AltName:
   36::185     6e-05  25%  525 aa  MLTF_VIBPA RecName: Full=Membrane-bound lytic murein
   36::255     8e-05  29%  517 aa  MLTF_ENT38 RecName: Full=Membrane-bound lytic murein
  457::545     1e-04  35%  938 aa  NMDZ1_MOUSE RecName: Full=Glutamate [NMDA] receptor subunit
   57::291     1e-04  29%  300 aa  MOXJ_METEA RecName: Full=Protein moxJ;Flags: Precursor;
   45::169     1e-04  26%  509 aa  MLTF_HAHCH RecName: Full=Membrane-bound lytic murein
   60::270     1e-04  21%  495 aa  MLTF_CELJU RecName: Full=Membrane-bound lytic murein
  498::545     1e-04  33%  938 aa  NMDZ1_RAT RecName: Full=Glutamate [NMDA] receptor subunit
  498::545     1e-04  33%  938 aa  NMDZ1_HUMAN RecName: Full=Glutamate [NMDA] receptor subunit
  519::566     1e-04  33%  943 aa  NMDZ1_CANFA RecName: Full=Glutamate [NMDA] receptor subunit
   57::142     1e-04  31%  476 aa  MLTF_SHEFN RecName: Full=Membrane-bound lytic murein
  440::548     3e-04  31%  982 aa  NMDA1_DROWI RecName: Full=Glutamate [NMDA] receptor subunit
   48::128     3e-04  26%  480 aa  MLTF_SHESH RecName: Full=Membrane-bound lytic murein
  526::570     3e-04  33%  938 aa  GLR31_ORYSJ RecName: Full=Glutamate receptor 3.1;AltName:
  514::560     4e-04  36%  997 aa  NMDA1_DROYA RecName: Full=Glutamate [NMDA] receptor subunit
  511::557     4e-04  36%  984 aa  NMDA1_DROVI RecName: Full=Glutamate [NMDA] receptor subunit
  514::560     4e-04  36%  997 aa  NMDA1_DROSI RecName: Full=Glutamate [NMDA] receptor subunit
  514::560     4e-04  36%  997 aa  NMDA1_DROSE RecName: Full=Glutamate [NMDA] receptor subunit
  511::557     4e-04  36%  980 aa  NMDA1_DROMO RecName: Full=Glutamate [NMDA] receptor subunit
  514::560     4e-04  36%  997 aa  NMDA1_DROME RecName: Full=Glutamate [NMDA] receptor subunit 1;     
  509::555     4e-04  36%  982 aa  NMDA1_DROGR RecName: Full=Glutamate [NMDA] receptor subunit
  514::560     4e-04  36%  997 aa  NMDA1_DROER RecName: Full=Glutamate [NMDA] receptor subunit
  511::557     4e-04  36%  994 aa  NMDA1_DROAN RecName: Full=Glutamate [NMDA] receptor subunit
  464::558     5e-04  30% 1003 aa  NMD3B_MOUSE RecName: Full=Glutamate [NMDA] receptor subunit
  478::558     7e-04  29% 1002 aa  NMD3B_RAT RecName: Full=Glutamate [NMDA] receptor subunit
  526::572     0.001  34% 1004 aa  NMDA1_DROPS RecName: Full=Glutamate [NMDA] receptor subunit
  526::572     0.001  34% 1004 aa  NMDA1_DROPE RecName: Full=Glutamate [NMDA] receptor subunit
   40::128     0.001  28%  276 aa  MOXJ_PARDE RecName: Full=Protein moxJ;Flags: Precursor;
   36::113     0.001  32%  534 aa  MLTF_VIBHB RecName: Full=Membrane-bound lytic murein
   39::142     0.001  33%  482 aa  MLTF_HAEIE RecName: Full=Membrane-bound lytic murein
    1::246

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxGAIDEIKSRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKEIARRLGVELK
ARTP_BACSU      -----------------------------LIMGTSADYKPFEY-KEGDNIVGFDVELAKALAKKAGYEIE
ARTJ_ECOLI      --------------------------------GVSATYPPFESIGANNEIVGFDIDLAKALCKQMQAECT
FLIY_ECOLI      ------------------GLLNKVKERGTLLVGLEGTYPPFSFQGDDGKLTGFEVEFAQQLAKHLGVEAS
FLIY_ECOL6      ------------------GLLNKVKERGTLLVGLEGTYPPFSFQGDDGKLTGFEVEFAQQLAKHLGVEAS
ARTI_ECOLI      -----------------------------------ASYPPFESIDANNQIVGFDVDLAQALCKEIDATCT
HISJ_NEIGO      -------------------------------VASNAEFAPFESLDSKGNVEGFDVDLMNAMAKAGNFKIE
GLNH_ECOLI      -----------------------------LVVATDTAFVPFEF-KQGDKYVGFDVDLWAAIAKELKLDYE
GLNH_ECOL6      -----------------------------LVVATDTAFVPFEF-KQGDKYVGFDVDLWAAIAKELKLDYE
GLNH_ECO57      -----------------------------LVVATDTAFVPFEF-KQGDKYVGFDVDLWAAIAKELKLDYE
HISJ_ECOLI      -------------------------------IGTDPTYAPFESKNSQGELVGFDIDLAKELCKRINTQCT
HISJ_ECOL6      -------------------------------IGTDPTYAPFESKNSQGELVGFDIDLAKELCKRINTQCT
HISJ_ECO57      -------------------------------IGTDPTYAPFESKNSQGELVGFDIDLAKELCKRINTQCT
HISJ_SALTY      -------------------------------IGTDPTYAPFESKNAQGELVGFDIDLAKELCKRINTQCT
HISJ_CAMJE      -------------------------------VGTAPNYKPFNF-KQDSKLTGFDTDLIEEIAKKNGIEIV
ARGT_ECOLI      -------------------------------IGTDTTYAPFSSKDAKGDFVGFDIDLGNEMCKRMQVKCT
GLNH_BACST      --------------------LEKIKKRGKLIVGVKYDLNLFGLKNETGKVEGFDIDIAKGLAKKLGDENK
ARGT_SALTY      -------------------------------IGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQVKCT
LAPT_PASHA      ------------------------------IIVMEPSYPPFEMTEEKGEIIGFDVDIANAICKEMNANCT
ARTJ_CHLTR      ------------------------------IVGTNATYPPFEFVDKRGEVVGFDIDLAREISNKLGKTLD
GLNH_BACSU      -----------------------IKDNDKIVFGVKTDTRLFGLKNSSGEIEGFXXXXXXXXXXXLGDEKK
Y1080_HAEIN     ---------------------DRVEKTKTLLVGTEGTYAPFTFHDKSGKLTGFDVEVIRKVAEKLGLKVE
GLTI_SALTY      --------------------LDKIAKNGVIVVGHRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVDLQVK
YXEM_BACSU      -----------------------------LHVGATGQSYPFAY-KENGKLTGFDVEVMEAVAKKIDMKLD
PEB1A_CAMJJ     ------------------GKLESIKSKGQLIVGVKNDVPHYALLDQTGEIKGFEVDVAKLLAKSIDKKIK
PEB1A_CAMJE     ------------------GKLESIKSKGQLIVGVKNDVPHYALLDQTGEIKGFEVDVAKLLAKSIDKKIK
PATH_VIBHA      -------------------------------VGMSGRYFPFTFVKQD-KLQGFEVDMWDEIGKRNDYKIE
NOCT_AGRT5      -----------------------------ITIATEGSYAPYNFKDAGGKLIGFDIDLGNDLCKRMNIECK
GLTI_ECOLI      ---------------------DKIAKNGVIVVGHRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVDLQVK
TCYA_BACSU      -----------------------IKKKGVLTVGTEGTYEPFTYHDKDTDLTGYDVEVITEVAKRLGLKVD
OCCT_RHIME      -----------------------------ITIATEGAYAPWNFSGPNGKLDGFEIDLAKVLCERMKVKCQ
PHEC_PSEAE      ---------------------DRILESGVLRVATTGDYKPFSYRTEEGGYAGFDVDMAQRLAESLGAKLV
ARTI_HAEIN      -----------------------------LTFAMQPSYPPFETTNAKGEIIGFDVDVTNAICQEIQATCK
AABA_DICNO      ----------------------------YRIIRNYPELMPVSYMDEKGSPTGFETELIRKIAEQAQLDLK
MLTF_PSEF5      --------------------LERVKEDGVLRV-VTRNSPATYFQDRNGE-TGFEYELVKRFADDLGVELK
MLTF_DESOH      --------------------------------------------------MGFEYDLAKAFAGHLGVDLE
OCCT_RHIRD      -----------------------------ITIATEGGYAPWNFSGPGGKLDGFEIDLANALCEKMKAKCQ
OCCT_AGRT4      -----------------------------ITIATEGGYAPWNFSGPGGKLDGFEIDLANALCEKMKAKCQ
YCKB_BACSU      ---------------------EQIKDKGKIVVATSGTLYPTSYHDTDSGLTGYEVEVVREAAKRLGLKVE
Y4TE_RHISN      --------------------LEEVKARGYITIAIANEMPG-SYTDPNGEVKGSEADVARRVLEKLGIKIQ
TCYJ_BACSU      -----------------------------VIVGTGTDFPNIAFLNEKGELTGYDIEVMKAIDKELPFEFK
MLTF_PSEPF      --------------------LERVKEDGVLRV-VTRNSPATYFQDRSGE-TGFEYELVKRFADDLGVELK
BVGS_BORPE      -------------------------------------FAPFTLFRTDEQFGGISAAVLQLLQLRTGLDFE
TCYK_BACSU      -----------------------------ITVGTGTQFPNICFIDEKGDLTGYDVELIKELDKRLHYKFT
Y3689_SHEFN     -----------------------------IVFGVHSKTAPLEWRN-NGVDQGFNIELMDRIGQLTNKRII
MLTF_SACD2      --------------------LEEVKSSGKLIV-ISRNGPTTYYEGPAGH-TGFEYVMAKAFAKHLGVDLE
YHDW_ECO57      --------------------LDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVDTKVK
YHDW_ECOLI      ---------------------DAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDICRGVAAAVDTKVK
MLTF_PHOPR      --------------------LEKIRESGVIRVGTLNN--QLSYYIGNDGPTGLDYELAQRFAQKLGVKLE
AAPJ_RHIL3      ----------------------DVKAKGFVQCGVNTGLTGFAAPDASGNWAGFDVDFCKAVASAVPTKVK
MLTF_COLP3      -------------------SLSRILARGYINVGTI--FGPTNYYTTANGFAGFEYELAKQYADSLNVELR
MLTF_PSEMY      --------------------LEQVKAEGELRV-VTRNSPATYFQDRNG-ATGFEYELAKRFATDLGLELK
MLTF_PSESM      --------------------LERVKEDGVLRV-ITRNSPATYFQDRNGE-TGFEYELVKRFADDLGVELK
BVGS_BORPA      -------------------------------------FAPFTLFRTDEQFGGISAAVLQLLQLRTGLDFQ
BVGS_BORBR      -------------------------------------FAPFTLFRTDEQFGGISAAVLQLLQLRTGLDFQ
MLTF_IDILO      -------------------AMSVVQERQVLRVGTLIN--PTSYYFDHDREQGFEYDLAKRFADRLGVELE
GLUB_COREF      ---------------------------GNVTIGTKYDQPGLGLRNPDNSMSGLDVDVAQYVVNSIADDNG
MLTF_PSE14      --------------------LERVKEDGVLRM-ITRNSPATYFQDRNGE-TGFEYELVKRFADDLGVELK
MLTF_AERHH      --------------------LEQIRQRGEIRVGTI--YGPTSYYQRDDTAQGFDYELAQSYADWLGVKLT
MLTF_ACTSZ      ---------------------EAIQERGTLVVGTINNSVSY-FIDPNGNPAGLEYDLSKSFADYLGVELE
MLTF_PSEPW      --------------------LERVKEDGVLRV-ITRNSPATYFQDRNGE-TGFEYELVKRFADDLGVKLE
BZTA_RHOCA      --------------------LDDVKARGQLICGSNPGLTGFAAPDANGVYQGFDXXXXXXXXXXLGMKVK
MLTF_PSEU2      --------------------LERVKEDGVLRV-ITRNSPATYFQDRNGE-TGFEYELVKRFADDLGVELK
MLTF_PSEPG      --------------------LERVKEDGVLRV-ITRNSPATYFQDRNGE-TGFEYELVQHFAEDLGVKLQ
MLTF_VIBF1      --------------------LEQIRERGILRVSTLNNQLSY-YIGSNGP-TGLDYDLAKAFAEKLEVKLE
MLTF_KLEP7      ---------------------------------------PMTFATMNNKAFGLDYELAKQFADYLGVTLK
MLTF_SODGM      -----------------------IKARGELRI--STLDAPLSYYSVNNQPSGFDYDLAQRFADYLGVTLK
MLTF_AERS4      --------------------LEQIRQRGEIRVGTI--YGSTSYYQRDDLAQGFDYELAKSYADWLGVKLT
GRIK4_RAT       -------------------------------------------MEGNDRYEGFCVDMLKELAEILRFNYK
MLTF_PSEAB      -------------------ALERVQKEGVLRV-ITRNSPATYFQDRNGE-TGFEYELAKRFAERLGVELK
MLTF_PSEPK      --------------------LERVKEDGVLRV-ITRNSPATYFQDRNGE-TGFEYELVQHFADDLGVKLQ
GLUB_CORGL      ---------------------------GSVNVGTKYDQPGLGLRNPDNSMSGLDVDVAEYVVNSIADDKG
MLTF_SALPB      --------------------IAAIQARGVLRV--STIDSPLTYSVINGKKYGLDYELAQQFANYLGVKLK
MLTF_PSEP1      --------------------LERVKEDGVLRV-ITRNSPATYFQDRNGE-TGFEYELVQHFADDLGVKLQ
GRIK4_MOUSE     -------------------------------------------MEGNDRYEGFCVDMLKELAEILRFNYK
MLTF_YERPY      ------------------GQLDQIKARGELRVSTISS--PLIYSTEKDTPSGFDYELAKRFADYLGVKLV
MLTF_YERPS      ------------------GQLDQIKARGELRVSTISS--PLIYSTEKDTPSGFDYELAKRFADYLGVKLV
MLTF_YERPP      ------------------GQLDQIKARGELRVSTISS--PLIYSTEKDTPSGFDYELAKRFADYLGVKLV
MLTF_YERPN      ------------------GQLDQIKARGELRVSTISS--PLIYSTEKDTPSGFDYELAKRFADYLGVKLV
MLTF_YERPG      ------------------GQLDQIKARGELRVSTISS--PLIYSTEKDTPSGFDYELAKRFADYLGVKLV
MLTF_YERPE      ------------------GQLDQIKARGELRVSTISS--PLIYSTEKDTPSGFDYELAKRFADYLGVKLV
MLTF_YERPB      ------------------GQLDQIKARGELRVSTISS--PLIYSTEKDTPSGFDYELAKRFADYLGVKLV
MLTF_YERPA      ------------------GQLDQIKARGELRVSTISS--PLIYSTEKDTPSGFDYELAKRFADYLGVKLV
MLTF_YERP3      ------------------GQLDQIKARGELRVSTISS--PLIYSTEKDTPSGFDYELAKRFADYLGVKLV
MLTF_PSEE4      --------------------LERVKEDGVLRV-ITRNSPATYFQDRNGE-TGFEYELVKRFADDLGVKLQ
GRIK4_PANTR     -------------------------------------------MEGNDRYEGFCVDMLKELAEILRFNYK
GRIK4_HUMAN     -------------------------------------------MEGNDRYEGFCVDMLKELAEILRFNYK
MLTF_YERE8      ------------------GQLDRIKARGELRVSTISS--PLIYSTGKDGPSGFDYELAKRFADYLGVKLV
MLTF_PSEAE      -------------------ALERVQKEGVLRV-ITRNSPATYFQDRNGE-TGFEYELAKRFAERLGVELK
MLTF_NITMU      ------------------------------LVVITVNSPDTYYENAEGSYAGLDYDLATEFAKELGMKVR
MLTF_METFK      --------------------------------------PSTYYYSGNNQYAGLEHDLVRNFVRELGPEYS
GRIA4_RAT       -----------------------------------------EMFEGNDKYEGYCVDLASEIAKHIGIKYK
GRIA4_MOUSE     -----------------------------------------EMFEGNDKYEGYCVDLASEIAKHIGIKYK
GRIA4_MACFA     -----------------------------------------EMFEGNDKYEGYCVDLASEIAKHIGIKYK
GRIA4_HUMAN     -----------------------------------------EMFEGNDKYEGYCVDLASEIAKHIGIKYK
MLTF_VIBCH      --------------------LEKIRERGVLRVG-TLNNPLSYYIGPDGP-TGLDYELAREFAKELGVKLE
MLTF_VIBC3      --------------------LEKIRERGVLRVG-TLNNPLSYYIGPDGP-TGLDYELAREFAKELGVKLE
GRID2_DANRE     ----------------------ENNMRGVVLRVVTVLEEPFVMVSENKKYQGFSIDVLDALANYLGFKYE
GLR2_CAEEL      ------------------------------------------------NITGFEYDVFISDGNKYGS--R
GLK1_DROME      ----------------------------------------------NDRFEGYCKDLADMLAAQLGIKYE
MLTF_SHEB9      ---------------------------------------------------GFDYDMAVLFAEYLDVPLK
MLTF_SHEB8      ---------------------------------------------------GFDYDMAVLFAEYLDVPLK
MLTF_SHEB5      ---------------------------------------------------GFDYDMAVLFAEYLDVPLK
MLTF_PSEA7      -------------------ALERVQKEGVLRV-VTRNSPATYFQDRNGE-TGFEYELAKRFAERLGVELK
GLRK_XENLA      ---------------------------------------PFSMKSESG-MEGFCIDLLSELSQSLGFNYT
MLTF_SERP5      ------------------GQLEEIKSRGELRIS-TLNSPLTYFTTKQGPS-GLDYELAKRFANYLGVKLV
GRIA2_RAT       -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
GRIA2_PONAB     -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
GRIA2_MOUSE     -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
GRIA2_MACFA     -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
GRIA2_HUMAN     -----------------------------------------EMLEGNERYEGYCVDLAAEIAKHCGFKYK
MLTF_SHIDS      --------------------IAAIQARGELRV--STIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLK
MLTF_SHESR      ---------------------------------------------------GFDYDMAVLFAEYLDVPLK
MLTF_ALCBS      -------------------AIERIMARGELVV-LTRPSNTTYYEDQHG-FTGMEYELAKGFADSQGVELR
GRID1_RAT       ---------------------------------------PFVMVAENKRYKGFSIDVLDALAKALGFKYE
GRID1_MOUSE     ---------------------------------------PFVMVAENKRYKGFSIDVLDALAKALGFKYE
GRID1_HUMAN     ---------------------------------------PFVMVAENKRYKGFSIDVLDALAKALGFKYE
MLTF_SHISS      --------------------IAAIQARGELRV--STIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLK
GRIK5_RAT       --------------------------------------PNFQALSGNERFEGFCVDMLRELAERFRYRLR
GRIK5_MOUSE     --------------------------------------PNFQALSGNERFEGFCVDMLRELAERFRYRLR
GRIK5_HUMAN     --------------------------------------PNFQALSGNERFEGFCVDMLRELAERFRYRLR
MLTF_SHESM      ---------------------------------------------------GFDYDMAVLFAEYLDVPLK
MLTF_SHESA      ---------------------------------------------------GFDYDMAVLFAEYLDVPLK
GRIK3_RAT       ----------------------------------------------NDRFEGYCIDLLKELAHILGFEIR
GRIK3_MACFA     ----------------------------------------------NDRFEGYCIDLLKELAHILGFEIR
GRIK3_HUMAN     ----------------------------------------------NDRFEGYCIDLLKELAHILGFEIR
MLTF_SHIF8      --------------------IAAIQARGELRV--STIHTPLTYNKINGKPFGLDYELAKQFADYLGVKLK
MLTF_PSEHT      ---------------------------------------------------GFEYELSQAFADYLGVELE
GLR1_CAEEL      ----------------------------------------------NNKFEGFCIDLLKLLADKINYEIK
MLTF_SHIFL      --------------------IAAIQARGELRV--STIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLK
MLTF_SHEON      ---------------------------------------------------GFDYDMAVLFAEYLDVPLK
MLTF_ECOLI      --------------------IAAIQARGELRV--STIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLK
MLTF_ECOLC      --------------------IAAIQARGELRV--STIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLK
MLTF_ECOHS      --------------------IAAIQARGELRV--STIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLK
MLTF_ECODH      --------------------IAAIQARGELRV--STIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLK
MLTF_ECO57      --------------------IAAIQARGELRV--STIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLK
MLTF_ECO11      --------------------IAAIQARGELRV--STIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLK
EVGS_ECOLI      --------------------------------------PPYSMTDENGSVRGVMGDILNIITLQTGLNFS
MLTF_ECOUT      --------------------IAAIQARGELRV--STIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLK
MLTF_ECOL5      --------------------IAAIQARGELRV--STIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLK
MLTF_ECOK1      --------------------IAAIQARGELRV--STIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLK
MLTF_ECO24      --------------------IAAIQARGELRV--STIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLK
MLTF_CITK8      --------------------IAAIQSRGELRV--STIESPLTYARINGKKYGLDYELAQQFASYLGVKLK
GRIA1_RAT       ------------------GDNSSVQNRTYIVTTILED--PYVMLKKNANYEGYCVELAAEIAKHVGYSLE
GRIA1_MOUSE     ------------------GDNSSVQNRTYIVTTILED--PYVMLKKNANYEGYCVELAAEIAKHVGYSLE
GRIA1_MACFA     ------------------GDNSSVQNRTYIVTTILED--PYVMLKKNANYEGYCVELAAEIAKHVGYSLE
GRIA1_HUMAN     ------------------GDNSSVQNRTYIVTTILED--PYVMLKKNANYEGYCVELAAEIAKHVGYSLE
MLTF_SHIBS      --------------------IAAIQARGELRV--STIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLK
MLTF_SHIB3      --------------------IAAIQARGELRV--STIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLK
MLTF_ECOSM      --------------------IAAIQARGELRV--STINTPLTYNEINGKPFGLDYELAKQFADYLGVKLK
MLTF_ECOL6      --------------------IAAIQARGELRV--STIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLK
EVGS_ECO57      --------------------------------------PPYSMTDENGSVRGVMGDILNIITLQTGLNFS
GRID2_RAT       ----------------------ENNMRGVVLRVVTVLEEPFVMVSENKKYQGFSIDVLDALSNYLGFNYE
GRID2_MOUSE     ----------------------ENNMRGVVLRVVTVLEEPFVMVSENKKYQGFSIDVLDALSNYLGFNYE
GRID2_HUMAN     ----------------------ENNMRGVVLRVVTVLEEPFVMVSENKKYQGFSIDVLDALSNYLGFNYE
NMDE4_RAT       ---------------------------------------------------GFCIDILKRLAHTIGFSYK
NMDE4_MOUSE     ---------------------------------------------------GFCIDILKRLAHTIGFSYK
NMDE4_HUMAN     ---------------------------------------------------GFCIDILKRLAHTIGFSYK
GLRK_RANBE      ---------------------------------------PFAMKTESDALEGYAIDLLSELTQSLGFNLH
GLRK_LYMST      ----------------------------------------------NEPVEGFCIDLTKAVAEKVGFDFV
GRIA3_RAT       -----------------------------------------EQLEGNERYEGYCVDLAYEIAKHVRIKYK
GRIA3_MOUSE     -----------------------------------------EQLEGNERYEGYCVDLAYEIAKHVRIKYK
GRIA3_MACFA     -----------------------------------------EQLEGNERYEGYCVDLAYEIAKHVRIKYK
GRIA3_HUMAN     -----------------------------------------EQLEGNERYEGYCVDLAYEIAKHVRIKYK
MLTF_PSEU5      --------------------LERIKEEGVLRV-ITRNSPSTYFQDRNGE-AGFEYELVKRFASTLGVELQ
NMDE3_HUMAN     ---------------------------------------------------GFCIDILKKLARVVGKHGK
MLTF_SHESW      ---------------------------------------------------GFDYDMALRFAEYLNVPLK
MLTF_SHEPC      ---------------------------------------------------GFDYDMALRFAEYLNVPLK
MLTF_SALAR      -----------------------IQARGVLRV--STIDSPLTYAVVNGKKYGLDYELAQQFANYLGVKLK
GRIK2_RAT       ----------------------------------------------NDRFEGYCIDLLRELSTILGFTYE
GRIK2_MOUSE     ----------------------------------------------NDRFEGYCIDLLRELSTILGFTYE
GRIK1_MOUSE     ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
GRIK1_MACFA     ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
GRIK1_HUMAN     ----------------------------------------------NDRFEGYCLDLLKELSNILGFDVK
NMDE2_RAT       ---------------------------------------------------GFCIDILKKISKSVGKHGK
NMDE2_MOUSE     ---------------------------------------------------GFCIDILKKISKSVGKHGK
NMDE2_HUMAN     ---------------------------------------------------GFCIDILKKISKSVGKHGK
NMDE2_CANFA     ---------------------------------------------------GFCIDILKKISKSVGKHGK
MLTF_ERWT9      --------------------IAQIKSRGELRI--STINSPLTYYTVNQSPAGMDYELAKRFADYLGVRLV
MLTF_ERWCT      ----------------------QILSRGELRI--STVNSPLTYAMSNGSPTGLDYELAKRFADYLGVKLV
GRIK2_MACFA     ----------------------------------------------NDRFEGYCIDLLRELSTILGFEIR
GRIK2_HUMAN     ----------------------------------------------NDRFEGYCIDLLRELSTILGFEIR
GLRK_ANAPL      ---------------------------------------------------GYCIDLLKALASMLHFSYK
NMDE3_MOUSE     ---------------------------------------------------GFCIDILKKLAKVVGKHGK
MLTF_SALTY      --------------------IAAIQARGVLRV--STIDSPLTYSVINGKKYGLDYELAQQFANYLGVKLK
MLTF_SALTI      --------------------IAAIQARGVLRV--STIDSPLTYSVINGKKYGLDYELAQQFANYLGVKLK
MLTF_SALPA      --------------------IAAIQARGVLRV--STIDSPLTYSVINGKKYGLDYELAQQFANYLGVKLK
MLTF_SALCH      --------------------IAAIQARGVLRV--STIDSPLTYSVINGKKYGLDYELAQQFANYLGVKLK
NMDE3_RAT       ---------------------------------------------------GFCIDILKKLAKVVGKHGK
GLRK_CHICK      ----------------------------------------------SAELEGYCIDLLKALASMLHFSYK
GRIK1_RAT       ----------------------------------------------NDRFEAYCLDLLKELSNILGFDVK
NMDE1_RAT       ---------------------------------------------------GFCIDILKKLSRTVGKHGK
NMDE1_PANTR     ---------------------------------------------------GFCIDILKKLSRTVGKHGK
NMDE1_MOUSE     ---------------------------------------------------GFCIDILKKLSRTVGKHGK
NMDE1_HUMAN     ---------------------------------------------------GFCIDILKKLSRTVGKHGK
MLTF_SHEPA      --------------------------------------PQIYFTSGQGDS-GYDYEMAERFANYLDLELK
MLTF_ENTS8      --------------------IAAIQARGVLRVSTIAT--PLTMYRAGDTMSGLDYELSQAFADYLGVKLK
MLTF_SULDN      --------------------LKKIKKSGALNVVL-LNAPSTYYIGSDGP-KGFEYDLLESYANHLGVKLN
MLTF_SHEHH      --------------------------------------PQIYFTSGQGDS-GYDYEMAERFAKYLNLKLK
MLTF_MARMM      -----------------------IRERGELVV-LTLAGPTSLIENEDGPPSGYEVDLANAFAASLGVTAR
MLTF_SHELP      ------------------------------------------YVTTGQGLAGFDYEMAERFAKHQGLTLN
MLTF_SHEAM      ------------------------------------------YMSSGQGLSGFDYELAQKFADYLGKPLE
MLTF_VIBVY      --------------------LDQIKQRGVLRVGTLNNQLSY-YIGPDGQ-TGLDYELARQFADELGVKLE
MLTF_VIBVU      --------------------LDQIKQRGVLRVGTLNNQLSY-YIGPDGQ-TGLDYELARQFADELGVKLE
FLGI_ARCB4      -----------------------INSKNIAAVMVTADLPPFDKIKVNISTIGDSVDHGELLITQLGVDGN
MLTF_VIBPA      ---------------------EKIQERGVLRVGTLNNQLSY-YIGPDGP-AGLDYELARKFAEELGVKLE
MLTF_ENT38      --------------------IAAIQSRGELRV--STLDSPLTYNNVNGKIIGLDYELAQQFADYLGVKLK
NMDZ1_MOUSE     ---------------------------------------------------GFCVDLLIKLARTMNFTYE
MOXJ_METEA      ----------------------------------AAEQPPLSMKDGSG----LENRIATTVAEAMGRKAQ
MLTF_HAHCH      --------------------LEKIEQEGALHV-ITRNAPTTYYEDRDGP-AGFEYELAKKFSEYLGVELR
MLTF_CELJU      ------------------------------------------FYEGSDGLTGFEYSLLKGFADSLGVNLA
NMDZ1_RAT       ----------------------------------------------------------------------
NMDZ1_HUMAN     ----------------------------------------------------------------------
NMDZ1_CANFA     ----------------------------------------------------------------------
MLTF_SHEFN      ---------------------------------------------------GFDFEMAQRFADYLAVPLE
NMDA1_DROWI     --------------------------------------PLFNTTDATANCSGYCIDLLIELAKRINFTYD
MLTF_SHESH      ------------------------------------------FVTTGQGEAGFDFEMASRFAEYLKLELK
GLR31_ORYSJ     ----------------------------------------------------------------------
NMDA1_DROYA     ----------------------------------------------------------------------
NMDA1_DROVI     ----------------------------------------------------------------------
NMDA1_DROSI     ----------------------------------------------------------------------
NMDA1_DROSE     ----------------------------------------------------------------------
NMDA1_DROMO     ----------------------------------------------------------------------
NMDA1_DROME     ----------------------------------------------------------------------
NMDA1_DROGR     ----------------------------------------------------------------------
NMDA1_DROER     ----------------------------------------------------------------------
NMDA1_DROAN     ----------------------------------------------------------------------
NMD3B_MOUSE     ---------------------------------------------ENGSVYGYCIDLLERLAEDLAFDFE
NMD3B_RAT       ---------------------------------------------------GYCIDLLERLAEDLAFDFE
NMDA1_DROPS     ----------------------------------------------------------------------
NMDA1_DROPE     ----------------------------------------------------------------------
MOXJ_PARDE      ------------------------------------------FSDAQG--AGFENKIAQVLADEMGATLD
MLTF_VIBHB      ---------------------EQIQERGVLRVGTLNNQLSY-YIGPDGP-AGLDYELARKFAEQLGVKLE
MLTF_HAEIE      -----------------------IQSRGALYVGTINN--QISYFTNNDGERGFEYELAKAFADSLGVELE


                         .         .         *         .         .         .         .:140
query           IVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGQVIVVRKDSDFRPKTYEDLVGKTVA
ARTP_BACSU      VQDMDFNSLITALKSKQVDLVLSGMTPTPERKKQVDFSDVYYTANHMIVSKKDSGI--QSLKDLKGKTVG
ARTJ_ECOLI      FTNHAFDSLIPSLKFRKYDAVISGMDITPERSKQVSFTTPYYENSAVVIAKKDT---YKTFADLKGKRIG
FLIY_ECOLI      LKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDFSTPYTISGIQALVKKGNEGTIKTADDXXXXXXX
FLIY_ECOL6      LKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDFSTPYTISGIQALVKKGNEGTIKTADDXXXXXXX
ARTI_ECOLI      FSNQAFDSLIPSLKFRRVEAVMAGMDITPEREKQVLFTTPYYDNSALFVGQQG---KYTSVDQLKGKKVG
HISJ_NEIGO      FKHQPWDSLFPALNNGDADIVMSGVTITDDRKQSMDFSDPYFEITQVVLVPKGK--KVSSSDDLKKNKVG
GLNH_ECOLI      LKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNN-DVKSVKDLDGKVVA
GLNH_ECOL6      LKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNN-DVKSVKDLDGKVVA
GLNH_ECO57      LKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNN-DVKSVKDLDGKVVA
HISJ_ECOLI      FVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQP-TVESLKGKRVG
HISJ_ECOL6      FVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQP-TVESLKGKRVG
HISJ_ECO57      FVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQP-TVESLKGKRVG
HISJ_SALTY      FVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQP-TVASLKGKRVG
HISJ_CAMJE      WVETNFDGLIPALKSGKIDMIASAMSATDERRQSVDFTKPYYMSKNLYLKLKNND-SLQTKNDLEGKKIG
ARGT_ECOLI      WVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQP-TLDSLKGKHVG
GLNH_BACST      IEEVTSKTRIPMLNNGEIDAIIGTMTITEERKKEVDFSDVYFMAGQSLLVKKDS--KINSVKDLKGMTVL
ARGT_SALTY      WVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQP-TLESLKGKHVG
LAPT_PASHA      FHSQPFDSLIQSLKQKQFDAAISGMGITEPRKKQVLFSEPYFPSSAAFIAKKDTDFAKV-------KTIG
ARTJ_CHLTR      VREFSFDALILNLKQHRIDAVITGMSITPSRLKEILMI-PYYEIKHLVLVFKGENKHPLPLTQY--RSVA
GLNH_BACSU      FKEVTSKTRIPMLQNGDIDAIVATMTITEERKKEVDFSDVYFEAGQSLLVKKGSKIKSVENLGKGSKVLA
Y1080_HAEIN     FKETQWDAMYAGLNAKRFDVIANQTNPSPERLKKYSFTTPYNYSGGVIVT-KSSDNSIKSFEDLKGRKSA
GLTI_SALTY      LIPITSQNRIPLLQNGTFDFECGSTTNNLERQKQAAFSDTIFVVGTRLLTKKGGDI--KDFPDLKGKAVV
YXEM_BACSU      WKLLEFSGLMGELQTGKLDTISNQVAVTDERKETYNFTKPYAYAGTQIVVKKDNT-DIKSVDDLKGKTVA
PEB1A_CAMJJ     LVAVNAKTRGPLLDNGSVDAVIATFTITPERKRIYNFSEPYYQDAIGLLVLKEKNY--KSLADMKGANIG
PEB1A_CAMJE     LVAVNAKTRGPLLDNGSVDAVIATFTITPERKRIYNFSEPYYQDAIGLLVLKEKKY--KSLADMKGANIG
PATH_VIBHA      YVTANFSGLFGLLETGRIDTISNQITMTDARKAKYLFADPYVVDGAQITVRKGND-SIQGVEDLAGKTVA
NOCT_AGRT5      FVEQAWDGIIPSLTAGRYDAIMAAMGIQPAREKVIAFSRPYLLTPMTFLTTADSNITPEQKAELEGVKFG
GLTI_ECOLI      LIPITSQNRIPLLQNGTFDFECGSTTNNVERQKQAAFSDTIFVVGTRLLTKKGGDI--KDFANLKDKAVV
TCYA_BACSU      FKETQWDSMFAGLNSKRFDVVANQVGKTDREDK-YDFSDKYTTSRAVVVTKKDNN-DIKSEADVKGKTSA
OCCT_RHIME      IVAQNWDGIIPSLVAKKYDVIMAAMSVTPKRQEVISFSTPYGAHMNGFAVMKDSKL-----ADMPGSGEV
PHEC_PSEAE      VVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLRDGKTPITLCSEEARFQTLEQIDQPGVT
ARTI_HAEIN      FKSETFDALIPNLKAKRFXXXXXXXXXXXXXXKQVLFXXXXXXXXXXXVALKGK----ATLES--AKNIG
AABA_DICNO      EEFVNFGDTLTALENGKADLAMATISVTPARQQIFDFTTPYFRVNPFAFITKDDSI--KTIQDLANKKVS
MLTF_PSEF5      IETANLDDLFDQLGQPKGPVLAAGLVSSEQRKQQVRFSHPYLEVTPQVIYRNGRS-RPTTAQDLVGKHIM
MLTF_DESOH      VKTPGWDALFASLQRGDGDFIAASMTHTRKREQYADFSEPYLSVRQHLILHK-SDHSIVTPAGLAGRTVH
OCCT_RHIRD      IVAQNWDGIMPSLTGKKYDAIMAAMSVTPKRQEVIGFSIPYAAGINGFAVMGDSKLAEETYSFLNGTTVG
OCCT_AGRT4      IVAQNWDGIMPSLTGKKYDAIMAAMSVTPKRQEVIGFSIPYAAGINGFAVMGDSKLAEETYSFLNGTTVG
YCKB_BACSU      FKEMGIDGMLTAVNSGQVDAAANDIDVTKDREEKFAFSTPYKYSYGTAIVRKD-DLSGIXXXXXXXXXXX
Y4TE_RHISN      WVVTTFGSLIPGLQANRFDMTAAGMAIRPERCEKVIYSEPNSSYGEGMLVIKGNPRNFHSYEDVAQQKIA
TCYJ_BACSU      TMD--FSNLLTSLGNKKIDVIAHNMAKNKEREKRFLYHKVPYNYSPMYITVKEDNHKIHTLKDLHGKTVI
MLTF_PSEPF      IETANLDDLFNQVGKPNGPVLAAGLVSSEQRKKQVRFSRSYLEVTPQIIYR-NGQSRPTDAGDLVGKKIM
BVGS_BORPE      IIGVTVEELIAKLRSGEADMA-GALFVNSARESFLSFSRPYVRNGMVIVTRQDPD-APVDADHLDGRTVA
TCYK_BACSU      FKTMEFSNLLVSLGQHKVDIVAHQMEKSKEREKKFLFNKVAYNHFPLKITVLQNNDTIRGIEDLKGKRVI
Y3689_SHEFN     VRRKSFQQLVKDVHDPDSDIDVIAVVSPVNMDRKLAQSDPIY-ATHAKAYTLQGKALINNWADLVGKRVA
MLTF_SACD2      VREIEDLGMLDKVGTKAGHLAASGLTVTEKRARKVLFAEPYLQVTQQLIYR-SGESKPETIEDLYGKRVM
YHDW_ECO57      YTPLTAKERFTALQSGEVDLLSRNTTWTSSRDMGMAFTGVTYYDGIGFLTHDKAGL--KSAKELDGATVC
YHDW_ECOLI      YTPLTAKERFTALQSGEVDLLSRNTTWTSSRDMGMAFTGVTYYDGIGFLTHDKAGL--KSAKELDGATVC
MLTF_PHOPR      MQPMTLSGLFPTLERGGIDVVAAGLTISKDRIENYHAAPAYYYASQ-IVVYKNGQWRPRKPADL-----A
AAPJ_RHIL3      YTPTNAKERFTALQSGEIDVLSRNTTWTINRDTALGFNVTYYD-GQGFMVRK--GLNVKSALELSGAAIC
MLTF_COLP3      IVTYSLDELFIKLNTGEVDLLASGLSITDKRLQRFRFAPSYETISQKLVF-KQGNVRPRKVADLTGTLMV
MLTF_PSEMY      IETANLDSLFASLGHVDGPVLAAGLVETPQRQRQARFSVPYLEVTPQIIYRQ-GETRPTKAEDLLGKRIL
MLTF_PSESM      IETANLDDLFDQMNKPGGPVLAAGLIETSKRKQQARFSHSYLEVTPQVVYR-NGQSRPTDPGDLVGKRIV
BVGS_BORPA      IIGVTVEELIAKLRSGEADMA-GALFVNAARESVLSFSRPYVRNGMVIVTRQXXXXXXXXXH-LDGRTIA
BVGS_BORBR      IIGVTVEELIAKLRSGEADMA-GALFVNAARESVLSFSRPYVRNGMVIVTRQXXXXXXXXXH-LDGRTIA
MLTF_IDILO      MVPFDVNDLFTMLRRGEVDIVAAGLDRTSTRAQLFRFSPPYDIISQKVVFKQGSRQRPRDLQQITGEIVV
GLUB_COREF      WDHPTVEWRTPSIQNGEVDMIAATYSINPGRSESVNFGGPYLLTHQALLVREDDD-RIQTLEDLDDGLIL
MLTF_PSE14      IETANLDDLFDQMNKPGGPVLAAGLIETPKRKQQARFSHSYLEVTPQVVYR-NGQSRPTDPGDLVGKRIV
MLTF_AERHH      IVPVYSTAELVELLRKKLDLAAAAIVVTPERRQLFRFGPGFYQVSPKLVYRNGSP-KPKDIGDLKG-NIV
MLTF_ACTSZ      IKSLNSDALFDALQNNKIDIAAANLLHQQRYQKQFQFGPAYTSASWQLVYRKGKD-KPRSLTQLSAK---
MLTF_PSEPW      IETANLDELFDDLGKPSGPVLAAAGLVNSERRKTQAFSHPYLEVTPQVIYRNGRS-RPTDPKGLVGKKIM
BZTA_RHOCA      YVPLTGETRFTALASGEVDVLVRNSTWTFSRDTELALAVNYYD-GQGFMVNK--SLGVSSAKELDGATIC
MLTF_PSEU2      IETANLDDLFDQMNKPGGPVLAAGLIETPLRKQQARFSHSYLEVTPQVVYR-NGQSRPTDPGDLVGKRIV
MLTF_PSEPG      IETANLDELYDALGKPSGPVLAAGLVSSERRKAQVKYSHPYLEVTPQVIYRNGRP-RPTNAKGLVGKKIM
MLTF_VIBF1      ITPATYSGLFPALERNEVDIIAANMTITPERLQKFR-PGPXXXXXXXXXXXKKGSWRPRNIKNLTQLDEN
MLTF_KLEP7      IVRQNISQLFDDLDDGQADMLAAGLVYNQERVKNYQAGPTYYSVSQQLVYRV-GNTRPRTLAALTAETIA
MLTF_SODGM      VVRSNLNQLFDDLENDNADILAASLIYNAERLNRFTVGPSYYSVSQQLVYRLGQP-RPKNLGDLRGRLAS
MLTF_AERS4      IVPVYSIAELVELLEKKLDLAAAAIVVTPERRALFRFGPGFYQVSPKLVYRYGSP-KPKDIGDLKG-SIV
GRIK4_RAT       IANGTWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRRPGYFSSL------
MLTF_PSEAB      IETANLDDLYAQLSREXXXXXXXXXXXXREDDASVRYSHTYLDVTPQIIYRNGQQ-RPTRPEDLVGKRIM
MLTF_PSEPK      IETANLDELYDALGKPSGPVLAAGLVSSERRKTQVRYSHPYLEVTPQVIYRNGRP-RPTGAKGLVGKKIM
GLUB_CORGL      WDHPTIEWRSPSIQNGEVDMIAATYSINAGRSESVNFGGPYLLTHQALLVRQDDD-RIETLEDLDNGLIL
MLTF_SALPB      VVRQNISQLFDDLDSGNADLLAAGLVYDSARVKNYQPGPMYYSVSQQLVYRV-GQYRPRSLATVNENQLT
MLTF_PSEP1      IETANLDELYDALGKPSGPVLAAGLVSSERRKTQVKYSHPYLEVTPQVIYR-NGRARPTGAKGLVGKKIM
GRIK4_MOUSE     IANGTWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRRP------------
MLTF_YERPY      IIHHNIXXXXXXXXXXXXXXXXXXXIYNRERLNRARTGPAYYSVSQQLVYRLGSP-RPKSFSDLKGQVVS
MLTF_YERPS      IIHHNIXXXXXXXXXXXXXXXXXXXIYNRERLNRARTGPAYYSVSQQLVYRLGSP-RPKSFSDLKGQVVS
MLTF_YERPP      IIHHNIXXXXXXXXXXXXXXXXXXXIYNRERLNRARTGPAYYSVSQQLVYRLGSP-RPKSFSDLKGQVVS
MLTF_YERPN      IIHHNIXXXXXXXXXXXXXXXXXXXIYNRERLNRARTGPAYYSVSQQLVYRLGSP-RPKSFSDLKGQVVS
MLTF_YERPG      IIHHNIXXXXXXXXXXXXXXXXXXXIYNRERLNRARTGPAYYSVSQQLVYRLGSP-RPKSFSDLKGQVVS
MLTF_YERPE      IIHHNIXXXXXXXXXXXXXXXXXXXIYNRERLNRARTGPAYYSVSQQLVYRLGSP-RPKSFSDLKGQVVS
MLTF_YERPB      IIHHNIXXXXXXXXXXXXXXXXXXXIYNRERLNRARTGPAYYSVSQQLVYRLGSP-RPKSFSDLKGQVVS
MLTF_YERPA      IIHHNIXXXXXXXXXXXXXXXXXXXIYNRERLNRARTGPAYYSVSQQLVYRLGSP-RPKSFSDLKGQVVS
MLTF_YERP3      IIHHNIXXXXXXXXXXXXXXXXXXXIYNRERLNRARTGPAYYSVSQQLVYRLGSP-RPKSFSDLKGQVVS
MLTF_PSEE4      IETANLDELFDQLGKPSGPVLAAAGLVSSERRGAQAFSHPYLEVTPQVIYRNGRS-RPTNAKGLVGKKIM
GRIK4_PANTR     IANGTWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKP------------
GRIK4_HUMAN     IANGTWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKP------------
MLTF_YERE8      MTHHNINXXXXXXXXXXXXMIAAGLIYNSERLKRARTGPAYYSVSQQLVYRLGSP-RPKSFSDLKGQLIS
MLTF_PSEAE      IETANLDDLYAQLSREXXXXXXXXXXXXREDDASVRYSHTYLDVTPQIIYRNGQQ-RPTRPEDLVGKRIM
MLTF_NITMU      FKTVPRLDKAWSLLEKHKGHFAAGMNISAKHSRHVAFG-PIYQLVQPQLAYNTDYNKPKNLHQLGGRTIR
MLTF_METFK      VKFLVVNNIIPTLLKHKAHFAAADLSITRTREHLVRFTRPYQKVQQQIVFNNELTKAPKNIKELLNRQIA
GRIA4_RAT       IAIVPWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL------
GRIA4_MOUSE     IAIVPWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL------
GRIA4_MACFA     IAIVPWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL------
GRIA4_HUMAN     IAIVPWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL------
MLTF_VIBCH      MKPYRLSSLFPALKNGEVDIIAAGLSQSEERLKDFR-AGPAXXXXXXXXXXKKGDWRPRSFKQLV-----
MLTF_VIBC3      MKPYRLSSLFPALKNGEVDIIAAGLSQSEERLKDFR-AGPAXXXXXXXXXXKKGDWRPRSFKQLV-----
GRID2_DANRE     IADGTWNGLIGELVFKRADVGLSALTITPERESVVDFTTRYMDYSVGVLLRK------------------
GLR2_CAEEL      QADGSWDGMIGYLLNETADVAVAPLTITQERERAVDFSKPFMTTGISIMIKKKQEFNIFSFMEPLGMTIW
GLK1_DROME      IAPGGWDGMVGELIRKEADIAISAMTITAERERVIDFSKPFMTLGISIMIKKPVKQTPGVFSFL------
MLTF_SHEB9      MVPYTNTELYEALKKNEIDLIAAGMTETPARREQFRLGPPLYRVNQVLVYREGMP-APKDISDLKGKITV
MLTF_SHEB8      MVPYTNTELYEALKKNEIDLIAAGMTETPARREQFRLGPPLYRVNQVLVYREGMP-APKDISDLKGKITV
MLTF_SHEB5      MVPYTNTELYEALKKNEIDLIAAGMTETPARREQFRLGPPLYRVNQVLVYREGMP-APKDISDLKGKITV
MLTF_PSEA7      I--ETADNLLYAQLSRXXXXXXXXXXXXXXRQASVRYSHTYLDVTPQVIYRNGQQ-RPTRPEDLVGKRIM
GLRK_XENLA      IKEVNWNGMVGEVLRKEVDLAVAPLTITANRERELAFTKPFMQTGISILLRKE-----------------
MLTF_SERP5      VIHKNINXXXXXXXXXXXXXXXXGLIYNQDRLSRARTGPAYYSVSQQLVYRLGT-ARPKTFADIKGKLAS
GRIA2_RAT       LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL------
GRIA2_PONAB     LTTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL------
GRIA2_MOUSE     LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL------
GRIA2_MACFA     LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL------
GRIA2_HUMAN     LTIVIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL------
MLTF_SHIDS      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVY-KVGQYRPRTLGNLTAEQLT
MLTF_SHESR      MVPYTNRALYDALKKNEIDIIAAGMTETPARREQFRLGPPLYRVNQVLVYREGMP-TPKDITDLKGKITV
MLTF_ALCBS      ILESDDLSYIRYAIRKTADIVAAGLIATPERSKSLRFSTAYQNV-DVLLVRRLTSHRITDLSQLNQQTIA
GRID1_RAT       IYNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVGILIKKPEE---------------
GRID1_MOUSE     IYNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVGILIKKPEE---------------
GRID1_HUMAN     IYNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVGILIKKPEE---------------
MLTF_SHISS      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVY-KVSQYRPRTLGNLTAEQLT
GRIK5_RAT       LVEDSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKP------------
GRIK5_MOUSE     LVEDSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKP------------
GRIK5_HUMAN     LVEDSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKP------------
MLTF_SHESM      MVPYTNRALYEALKKNEIDIIAAGMTETPARREQFRLGPPLYRVNQVLVYREGMP-TPKDITDLKGKITV
MLTF_SHESA      MVPYTNRALYDALKKNEIDIIAAGMTETPARREQFRLGPPLYRVNQVLVYREGMP-TPKDITDLKGKITV
GRIK3_RAT       LVEDQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFL------
GRIK3_MACFA     LVEDQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFL------
GRIK3_HUMAN     LVEDQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFL------
MLTF_SHIF8      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPSPTYYSVSQQLVY-KVGQYRPRTLGNLTAEQLT
MLTF_PSEHT      IVPFNLSDMFARLQSGDLDLIASGLTYNKTRAQQYRFGPTYRTISQKLVYKQGIE-RPRDYDDLTGNLMV
GLR1_CAEEL      LADGSWDGMIGELLSGRAHAVVASLTINQERERVVDFSKPFMTTGISIMIKK------------------
MLTF_SHIFL      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVY-KVGQYRPRTLGNLTAEQLT
MLTF_SHEON      MVPYTLAELYDALKKNEIDIIAAGMTETPARREHFRLGPPLYRVNQVLVYREGMP-APKDISDLKGKITV
MLTF_ECOLI      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVY-KVGQYRPRTLGNLTAEQLT
MLTF_ECOLC      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVY-KVGQYRPRTLGNLTAEQLT
MLTF_ECOHS      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVY-KVGQYRPRTLGNLTAEQLT
MLTF_ECODH      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVY-KVGQYRPRTLGNLTAEQLT
MLTF_ECO57      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVY-KVGQYRPRTLGNLTAEQLT
MLTF_ECO11      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVY-KVGQYRPRTLGNLTAEQLT
EVGS_ECOLI      PITVSHNIHAGTQLSPGGWDIIPGAIYSEDRENNVLFAEAFITTPYVFVMQKAPD-----SEQTLKKGMK
MLTF_ECOUT      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVY-KVGQYRPRTLGNLTAEQLT
MLTF_ECOL5      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVY-KVGQYRPRTLGNLTAEQLT
MLTF_ECOK1      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVY-KVGQYRPRTLGNLTAEQLT
MLTF_ECO24      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVY-KVGQYRPRTLGNLTAEQLT
MLTF_CITK8      IVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVYRV-GQYRPRTLATVNESQLS
GRIA1_RAT       IVSKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL------
GRIA1_MOUSE     IVSKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL------
GRIA1_MACFA     IVSKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL------
GRIA1_HUMAN     IVSKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL------
MLTF_SHIBS      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVY-KVGQYRPRTLCNLTAEQLT
MLTF_SHIB3      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVY-KVGQYRPRTLCNLTAEQLT
MLTF_ECOSM      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVY-KVGQYRPRTLGNLTAEQLT
MLTF_ECOL6      VVRQNISQLFXXXXXXXXXXXXXXXVYNSERVKNYQPGPTYYSVSQQLVY-KVGQYRPRTLGNLTAEQLT
EVGS_ECO57      PITVSHNIHAGTQLNPGGWDILPGAIYSEDRENNVLFAEAFITTPYVFVMQKAPD-----SEQTLKKGMK
GRID2_RAT       IYDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRR------------------
GRID2_MOUSE     IYDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRR------------------
GRID2_HUMAN     IYDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRR------------------
NMDE4_RAT       KIDGVWNGMIGEVFYQRADMAIGSLTINEERSEIVDFSVPFVETGSVMVARSNGTVSPSAF---------
NMDE4_MOUSE     KIDGVWNGMIGEVFYQRADMAIGSLTINEERSEIVDFSVPFVETGSVMVARSNGTVSPSAF---------
NMDE4_HUMAN     KIDGVWNGMIGEVFYQRADMAIGSLTINEERSEIVDFSVPFVETGSVMVARSNGTVSPSAF---------
GLRK_RANBE      IVEGNWSGMVGEIIRKEADLAIAPLTITSVRENAISFTKPFMQTGIGILLKKDT----------------
GLRK_LYMST      IQFVTWDGIVGELIRHEADMAIAPFTITADRSRVIDFTKPFMSLGISIMIKR------------------
GRIA3_RAT       LSIVIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL------
GRIA3_MOUSE     LSIVIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL------
GRIA3_MACFA     LSIVIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL------
GRIA3_HUMAN     LSIVIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL------
MLTF_PSEU5      IETANIDDIFSRLNRXXXXXXXXXXXVASERQELARFTRSYLDV-TTQVVYHSGQRRPTSPKDLIGKRIL
NMDE3_HUMAN     RVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPFVETGSVMVARSNGTVSPSAF---------
MLTF_SHESW      MVPYTNRSELYDALKKNIDIIAAGMTETPARREQFRLGPPLYRVNQVLVYR-EGVAAPKDISKLKGRITI
MLTF_SHEPC      MVPYTNRSELYDALKKNIDIIAAGMTETPARREQFRLGPPLYRVNQVLVYR-EGVAAPKDISKLKGRITI
MLTF_SALAR      IVRQNISQLFXXXXXXXXXXXXXXXVYDSARVKKYQPGPMYYSVSQQLVYRV-GQYRPRSLATVTENQLT
GRIK2_RAT       IVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFL------
GRIK2_MOUSE     IVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFL------
GRIK1_MOUSE     LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFL------
GRIK1_MACFA     LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFL------
GRIK1_HUMAN     LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFL------
NMDE2_RAT       KINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGSVMVSRSNGTVSPSAF---------
NMDE2_MOUSE     KINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGSVMVSRSNGTVSPSAF---------
NMDE2_HUMAN     KINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGSVMVSRSNGTVSPSAF---------
NMDE2_CANFA     KINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGSVMVSRSNGTVSPSAF---------
MLTF_ERWT9      VVRPNXXXXXXXXXXXXXXXXXXXXIYNRERLKRFRAGPSYYSVSQQLVYRIGTS-RPKNLGDLKGRTVA
MLTF_ERWCT      VSSRKNXXXXXXXXXXXXXXXXXXXXINHERLERFRAGPTYYSISQQMVYRLGSP-RPKTLDKLQGRLVS
GRIK2_MACFA     LVEDQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFL------
GRIK2_HUMAN     LVEDQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFL------
GLRK_ANAPL      VKVVNWTGMIGEILRQEADIAVAPLTVTSAREEVVSFTTPFLQTGIGILLRKDT----------------
NMDE3_MOUSE     RVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIIDFSVPFVETGSVMVARSNGTVSPSAF---------
MLTF_SALTY      VVRQNISQLFXXXXXXXXXXXXXXXVYDSARVKNYQPGPMYYSVSQQLVYRV-GQYRPRSLATVNENQLT
MLTF_SALTI      VVRQNISQLFXXXXXXXXXXXXXXXVYDSARVKNYQPGPMYYSVSQQLVYRV-GQYRPRSLATVNENQLT
MLTF_SALPA      VVRQNISQLFXXXXXXXXXXXXXXXVYDSARVKNYQPGPMYYSVSQQLVYRV-GQYRPRSLATVNENQLT
MLTF_SALCH      VVRQNISQLFXXXXXXXXXXXXXXXVYDSARVKNYQPGPMYYSVSQQLVYRV-GQYRPRSLATVNENQLT
NMDE3_RAT       RVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIIDFSVPFVETGSVMVSRSNGTVSPSAF---------
GLRK_CHICK      VKVVNWTGMIGEILRQEADIAVAPLTVTSAREEVVSFTTPFLQTGIGILLRKET----------------
GRIK1_RAT       LVPDEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFL------
NMDE1_RAT       KVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGSVMVSRSNGTVSPSAFLEPFSASVW
NMDE1_PANTR     KVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGSVMVSRSNGTVSPSAFLEPFSASVW
NMDE1_MOUSE     KVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGSVMVSRSNGTVSPSAFLEPFSASVW
NMDE1_HUMAN     KVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGSVMVSRSNGTVSPSAFLEPFSASVW
MLTF_SHEPA      MKPFAISELYSAMHSGEIDIIAAGLADTPARREQFRLGPPLYRVNQVLVYRQGTPI-PRSVDTLKGE---
MLTF_ENTS8      IVRQNISQLFXXXXXXXXXXXXXGLVYNEARSQHYQAGPIYYSVSQQMVYRVGS-LRPRSLASIKEGQLT
MLTF_SULDN      IT--TANTIKEALLSKNPDIHITSLTKTPEREKEFNFGPSYFEAQEQVVCNKDGRF-PSDADSLSGLRVV
MLTF_SHEHH      MAFANISELYAAMRSGEIDIIAAGLGDTPARREQFRVGPPLYRVDQVLVYRQGTPV-PKNINSLNGEITV
MLTF_MARMM      FVAASLPDLFXXXXXXXXXXXXXXXTLTPERSERLAFSPVYKSVTEQLVCRR-GGVNPTRLERLPDADIV
MLTF_SHELP      MQPYTISDLYQAMRNGEIDLIAAGLADTQSRREQFRLGPPLYYVNQVLVYKQGAKY--------------
MLTF_SHEAM      MQPYSNRSELYDALAKEIDLIAAGITESPNRRNRFRMGPPLYRVDQVVVYRQ-GNRAPESIEQLSGNLTV
MLTF_VIBVY      VVAFRQAELFPMLKRGDIDLIATGLNQTPRAIKQFR-PGPXXXXXXXXXXXKNGALRPRNLKQLV-----
MLTF_VIBVU      VVAFRQAELFPMLKRGDIDLIATGLNQTPRAIKQFR-PGPXXXXXXXXXXXKNGALRPRNLKQLV-----
FLGI_ARCB4      VYALAQGTIVANENNKTTGFIYDGATVENE----INFDLQSEDSIQLSLLKKNADLIETKINDTFGKKLA
MLTF_VIBPA      IKPAFRQALFPALKKGDIDIIATGLNQTSQAVKRFR-PGPAXXXXXXXXXXKKGQLRPRDIEQLIEYQAS
MLTF_ENT38      IVRQNISQLFXXXXXXXXXXXXXGLVYNSERSKNYQ-PGPTYXXXXXXXXXXXXXXXPRTMATLNDQTVA
NMDZ1_MOUSE     VADGKFNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKE-----------------
MOXJ_METEA      FVWLGKPALVRDGLEKKTCDVVIGLDADDPR---VLTSKPYYRSGYVFLTRADKDLDIKSWSDPRLKEVS
MLTF_HAHCH      LVANDLDEAYTVLEQNYTNLAAVGLSAASAQSPSLRFSSEYLEI-QPLVLYRNGSAKPKQLDDLIGGKLI
MLTF_CELJU      IENQATRELLHAVEQRQYHMGSAELTALESQDYHLSFAKPYMQITQQLVYNHRLG-TPTSIKDLKGKEVL
NMDZ1_RAT       -----WNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKE-----------------
NMDZ1_HUMAN     -----WNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKE-----------------
NMDZ1_CANFA     -----WNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKE-----------------
MLTF_SHEFN      MIPYTNKQLFAALKENKIDIIAAGIAKTPNRSQQFKLGPTLYKVNQVLVY-KEGTPEPKDISTLSGE---
NMDA1_DROWI     LLRKEWTGLIGQLVNERADMIVAPLTINPERAEYIEFSKPFKYQGITILEKKPS----------------
MLTF_SHESH      MKPYSISELYQALESGEVDLLAAGLADTPTRREKFRLGPPLYRVNQVLVYKQ------------------
GLR31_ORYSJ     ----SYSELINKIITDDFDAVVGDVTIITNRTKVVDFTQPYVSSGLVVL---------------------
NMDA1_DROYA     -------GLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGITILEKKPS----------------
NMDA1_DROVI     -------GLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGITILEKKPS----------------
NMDA1_DROSI     -------GLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGITILEKKPS----------------
NMDA1_DROSE     -------GLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGITILEKKPS----------------
NMDA1_DROMO     -------GLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGITILEKKPS----------------
NMDA1_DROME     -------GLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGITILEKKPS----------------
NMDA1_DROGR     -------GLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGITILEKKPS----------------
NMDA1_DROER     -------GLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGITILEKKPS----------------
NMDA1_DROAN     -------GLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGITILEKKPS----------------
NMD3B_MOUSE     LYDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVR-------------------
NMD3B_RAT       LYDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVR-------------------
NMDA1_DROPS     -------GLMGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGITILEKKPS----------------
NMDA1_DROPE     -------GLMGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGITILEKKPS----------------
MOXJ_PARDE      LVMLEKDALVRDGIEKDLCDVLVGVDAGDER---LLTTRPYYRSGYAFVTRQDRNFEGDKWQDV------
MLTF_VIBHB      IRPAFRQALFPALKKGDIDIIATGLNQTSQ----------------------------------------
MLTF_HAEIE      M--KTFDNLFDELDKHNIDLAAAHILYHPKNAERFQIGPAYHSASWQLAYRKNEN-RPK-----------


                         +         .         .         .         .         *         .:210
query           VQIGTTGDIEVSKYDGIKVVRFDKFTDAFLELKRGRADAVVLDSATARAFVAKNPDLVISSGVLSSEQYG
ARTP_BACSU      VQLGSIQEKELSPEYGFKTEDRNRISDLVQEIKSDRFDAAIIEDIVAEGYFKSNDDLVIPDAKAEEAGSA
ARTJ_ECOLI      MENGTTHQKYIDQHPEVKTVSYDSYQNAFIDLKNGRIDGVFGDTAVVNEWLKTNPQLGVATEKVTDPQYG
FLIY_ECOLI      XXXXTNYEEWLQNVQGVDVRTYDDDPTKYQDLRVGRIDAILVDRLAALDLVKKNDTLAVTGEAFSRQESG
FLIY_ECOL6      XXXXTNYEEWLQNVQGVDVRTYDDDPTKYQDLRVGRIDAILVDRLAALDLVKKNDTLAVTGEAFSRQESG
ARTI_ECOLI      VQNGTTHQFIMDKHPEITTVPYDSYQNAKLDLQNGRIDGVFGDTAVVTEWLKDNPKLAAVGDKVTDKDYG
HISJ_NEIGO      VVTGHTGDFSVSKLDNPKIARFENVPLIIKELENGGLDSVVSDSAVIANYVKNNPAKGMDFVTLTTEHYG
GLNH_ECOLI      VKSG-TGSVDYAKAN-IKLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIAGNGQFKAVGDSLEAQQYG
GLNH_ECOL6      VKSG-TGSVDYAKAN-IKLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIAGNGQFKAVGDSLEAQQYG
GLNH_ECO57      VKSG-TGSVDYAKAN-IKLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIAGNGQFKAVGDSLEAQQYG
HISJ_ECOLI      VLQGTTQETFGNEHKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPDYKFGGPSVKDEKLG
HISJ_ECOL6      VLQGTTQETFGNEHKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPDYKFGGPSVKDEKLG
HISJ_ECO57      VLQGTTQETFGNEHKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPDYKFGGPSVKDEKLG
HISJ_SALTY      VLQGTTQETFGNEHKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPDYKFGGPAVKDEKLG
HISJ_CAMJE      VQLGTLQENTAKAIKNAQVQSNKDLNIAVLALKNNKIDAIVADQDTAKGFLAENPELVFYQETDGGEGFS
ARGT_ECOLI      VLQGSTQEAETWRSKGVDVVAYANQDLVYSDLAAGRLDAALQDEVAASEGFLKQPDFAFAGSSVKDKKYG
GLNH_BACST      TAKGSTSAQNIRKVPEVNVLEFENYAEAFTALKAGQGDALTTDNALLWGMAKQDPNYRVLDETFSKEPYG
ARGT_SALTY      VLQGSTQEAYANRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPEYAFAGPSVKDKKYG
LAPT_PASHA      VQNGTTYQHYLAKKKEYNVKSYASYQNAILDVQNGRIDAIFGDVPVLAEMARKHEGLDFVGEKINNPNYG
ARTJ_CHLTR      VQTGTYQEAYLQSLSEVHIRSFDSTLEVLMEVMHGKSPVAVLEPSIAQVVLKDFPALSTATIDLPEDQYG
GLNH_BACSU      VKGSTSSQNIREKAPEASVLEFENYAEAFTALKSGQGDALTTDNAILYGMADENKNYQLTGKPFTDEPYG
Y1080_HAEIN     -QSATSNWGKDAKAAGAQILVVDGLAQSLELIKQGRAEATINDKLAVLDYFKQHPNLKIAYDRGDKTPTA
GLTI_SALTY      VTSGTTSEILLHKLNGMRIISAKDHGDSFRTLESGRAVAFMMDDALERAKAKKPDNWEIVGKPQSQEAYG
YXEM_BACSU      AVLGSNHAKNLESKDKINIKTYETQEGTLKDVAYGRVDAYVNSRTVLIAQIKKTGPLKLAGDPIVYEQVA
PEB1A_CAMJJ     VXXXXXXXXXXXXXXDVKFSEFPDYPSIKAALDAKRVDAFSVDKSILLGYVDDKSEILPDS--FEPQSYG
PEB1A_CAMJE     VXXXXXXXXXXXXXXDVKFSEFPDYPSIKAALDAKRVDAFSVDKSILLGYVDDKSEILPDS--FEPQSYG
PATH_VIBHA      VNLGSNFEQLLRDYDKINIKTYD--TGIEHDVALGRADAFIMDRLSALELIKK-----------------
NOCT_AGRT5      VQAGTSHEAFMKQMPSVQISTYDTIDNVVMDLKAGRIDASLASVSFLKPLTDKNKDLKMMTXXXXXXXXX
GLTI_ECOLI      VTSGTTSEVLLNKLNNMRIISAKDHGDSFRTLESGRAVAFMMDDALERAKAKKPDNWEIVGKPQSQEAYG
TCYA_BACSU      QSL-TSNYNKLATNAGAKVEGVEGMAQALQMIQQGRVDMTYNDKLAVLNYLKKNVKIAFETGEPQSTYF-
OCCT_RHIME      YSLNTQADAAKKRIDDVNAIKEYKTVEEFIDLMSGRVDA-VFASATVLTAAFEQPDMKVVGPLFSGDELG
PHEC_PSEAE      AIVNPGGTNEKFARANLKKARILVHPDIFQQIVDGKADLMMTDAIEARLQSRLHPEL-------------
ARTI_HAEIN      VQNGTTQQYTVAETKQYSPKSYASLQNAILDLKSGRIDIIFGDTAVLADMISKEPEIQFIGEKVTNKKYG
AABA_DICNO      VWTGSNHEQKIKEIQKEGTGSVIPAKSIFLAVKQGEADVAVGDDAYMLNFADRNLKAVIDRST-EPESYA
MLTF_PSEF5      VLKGSTHAEQLAKYPGIEYEESDEVVDLLRMVDEGQIDLTLVDSLAMNQVYFPNVRVAFDLGDARSQSWA
MLTF_DESOH      VREDTTYQLEALQADGIDVLHRNTPTEELIEVAKRQIDITVADSAIALLNRRYYPDIRIAFPIEKEQPLA
OCCT_RHIRD      VQGSTTASTFLDKYGSVDIKEYKSVEEHNLDLTSGRLDXXXXXXXXXXXXIEK-PEMKLVGPLFSGGEFG
OCCT_AGRT4      VQGSTTASTFLDKYGSVDIKEYKSVEEHNLDLTSGRLDXXXXXXXXXXXXIEK-PEMKLVGPLFSGGEFG
YCKB_BACSU      XXXXXXVYMEVARKYGAKEVIYDNATNELKDVANGRTDVILNDYYLQTLALAAFPDLNITDIKYMPNKQA
Y4TE_RHISN      IMAG------------------------------------------------------------------
TCYJ_BACSU      VGATSNAADYITKYNGSPIYAGQGSNDTANQIETGRADATI-----------------------------
MLTF_PSEPF      VLKGSTHAEQLAKYPGIQYEESDEVVDLLRMVDEGQIDLTLVDSVAMNQVYFTNIRVAFDLGDARSQSWA
BVGS_BORPE      VRNSAAIPLLQRRYPQAKVVTADNPSEAMLMVANGQADAVVQTQISASYYVNRAGKLRIASALLPPAEIA
TCYK_BACSU      TSATSNGALVLKKWNEDNGRPFEGANETANQLKSGRADATI---STPFAVDFQNKTSTIKGNVLSNAKVY
Y3689_SHEFN     IKNGAFVDVFLSDHQNFDRVDVDLYETGFQLLIKNQVDVVIAESFVARRLLPLYPSVRSSSDALIYGAFN
MLTF_SACD2      V---------------------------------------------------------------------
YHDW_ECO57      IQAGTDTELNVADYNNMKYVTFDRSDESAKALESGRCDTLASDQSQLYALRIKNPEWIVLPEVISKEPLG
YHDW_ECOLI      IQAGTDTELNVADYNNMKYVTFDRSDESAKALESGRCDTLASDQSQLYALRIKNPEWIVLPEVISKEPLG
MLTF_PHOPR      LNKGTLSVVKGSSHEKLKEIHPDLTWESIEEVAKGELDFTIADSVDVALSQRIHPDVAIAMELTEDEPIA
AAPJ_RHIL3      VQSGTTTELNLADYFQYNPVVFENLPEVNAAYDAGRCDVYTTDQSYSLRLTLKNPDHIILPEIISKEPLG
MLTF_COLP3      ----TSGSSYVENLEKLKSTEFDS-EELLRKVLSGEIDYTIIDSNNLAINRRYYPEISIGFSINEPEPLA
MLTF_PSEMY      VLAGSSEQLEALKLETFEVSDAVEVVDLLRMVDEGQIDLTLVDSLAMNQVYFPNVRVAFDLGDTNTMRWA
MLTF_PSESM      VLKGSTPAIEYEESDAVEVVDLLRMVD------EGQIDLTLVDSNELAMNQVYFPNVRVAFDLGEAREQR
BVGS_BORPA      VRNSAAIPLLQQRYPQAKVVTADNPTEAMLLVADGQADAVVQTQISASYYVNRAGKLRIASALLPPAEIA
BVGS_BORBR      VRNSAAIPLLQQRYPQAKVVTADNPTEAMLLVADGQADAVVQTQISASYYVNRAGKLRIASALLPPAEIA
MLTF_IDILO      VEGSSHHEFLKSLGDSIPTLKWRATRDDAVELLQGEVDYTITDSTALDIQRRFHPDLSVAFTVKHDQDIA
GLUB_COREF      CSV--TGSTPAQKLPGVQLQEYDTYSSCVEALSQGNVDAMTTDATILFGYAQQREEMEQDGEPFTNEYYG
MLTF_PSE14      VLKGSNPGLEYEESDAVEVVDLLRMVD------EGQIDLTLVDSNELAMNQVYFPNVRVAFDLEAREQRW
MLTF_AERHH      VPAGSTGE--------------------------------------------------------------
MLTF_ACTSZ      ----------------------------------------------------------------------
MLTF_PSEPW      VLKGSSHADQLARYPGLEYEESDEVVDLLRMVDEGQIDLTLVDSLAMNQVYFPNVRVAFDLGETRNQRWA
BZTA_RHOCA      VQTGTTTEMNLAKANNMTYTPVNIADDAEGQQKAGACDSYTTDAASSRATLPNAADIVILPEIISKEPLG
MLTF_PSEU2      VLKGSNPGIQYEESDAVEVVDLLRMVD------EGQIDLTLVDSLAMNQVYFPNVRVAFDLGEARAQRWA
MLTF_PSEPG      VLKGSSPGLEYEESDAVEVVDLLRMVD------EGQIDLTLVDSNELAMNQVYFPNVRVAFDVGDTRDQR
MLTF_VIBF1      LTI-----VKDSSFEGTLIKLKEKYTDVSELLKKGEIHYTLADSVELSLTQRIHPDLAVAFEVTEDQPVA
MLTF_KLEP7      VAINDLQTLKAEKYPDLARVDEKRGTTALMQVIDGKLDYTIADSVAVSLFQRVHPELAVALDITDEQPVW
MLTF_SODGM      AQITQLRQLKKKQYPQLAEVSSDLSSRSLLEVADGKLDYTLADSASVGLLQRVHPQLAVAFDITEEKPVT
MLTF_AERS4      VPAGSTGERELAKYPGLKTNRDADVEELLKQVADGKIDTVVQDTVLAR----------------------
GRIK4_RAT       ----------------------------------------------------------------------
MLTF_PSEAB      VLKGSSPELKYEESDAVEVVDLLRMVDV------GDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLA
MLTF_PSEPK      VLKGSSHADQLAQYPALQYEESDEVVDLLRMVDEGQIDLTLVDSLAMNQVYFPNVRVAFDLGETRDQRWA
GLUB_CORGL      CSVSGSTPAQKVKLPGVQLQEYDTYSSCVEALSQGNVDALTTDATILFGYSQQYEEMEKDGEPFTDEYYG
MLTF_SALPB      I---APGHVVVNDLQRLKETKFDKSTTLLEEVISGKLDYTIADSVAISLFQRVHPELAVALDVTDEQPVT
MLTF_PSEP1      VLKGSSHADQLAQYPALQYEESDEVVDLLRMVDEGQIDLTLVDSLAMNQVYFPNVRVAFDLGDTRDQRWA
GRIK4_MOUSE     ----------------------------------------------------------------------
MLTF_YERPY      AHMTTLKRLKQTKYPELNSSSVDKSGKELLEVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVT
MLTF_YERPS      AHMTTLKRLKQTKYPELNSSSVDKSGKELLEVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVT
MLTF_YERPP      AHMTTLKRLKQTKYPELNSSSVDKSGKELLEVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVT
MLTF_YERPN      AHMTTLKRLKQTKYPELNSSSVDKSGKELLEVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVT
MLTF_YERPG      AHMTTLKRLKQTKYPELNSSSVDKSGKELLEVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVT
MLTF_YERPE      AHMTTLKRLKQTKYPELNSSSVDKSGKELLEVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVT
MLTF_YERPB      AHMTTLKRLKQTKYPELNSSSVDKSGKELLEVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVT
MLTF_YERPA      AHMTTLKRLKQTKYPELNSSSVDKSGKELLEVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVT
MLTF_YERP3      AHMTTLKRLKQTKYPELNSSSVDKSGKELLEVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVT
MLTF_PSEE4      VLKGSSPGLEYEESDAVEVVDLLRMVD------EGQIDLTLVDSLAMNQVYFPNVRVAFDLGDTRDQRWA
GRIK4_PANTR     ----------------------------------------------------------------------
GRIK4_HUMAN     ----------------------------------------------------------------------
MLTF_YERE8      AHMTTLKQLKQTKYPGSSVDRSGK--ELLEQVADGKLDYTLGDSVTIALLQRIHPQLAVAFDVTDEE---
MLTF_PSEAE      VLKGSSPELKYEESDAVEVVDLLRMVDV------GDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLA
MLTF_NITMU      IAKGVTHAEQLNKVPELKWKEMDLTPDELLRLAEGKVDYVVADSTQIN--LAKN----------------
MLTF_METFK      VPSGTS----------------------------------------------------------------
GRIA4_RAT       ----------------------------------------------------------------------
GRIA4_MOUSE     ----------------------------------------------------------------------
GRIA4_MACFA     ----------------------------------------------------------------------
GRIA4_HUMAN     ----------------------------------------------------------------------
MLTF_VIBCH      ----------------------------------------------------------------------
MLTF_VIBC3      ----------------------------------------------------------------------
GRID2_DANRE     ----------------------------------------------------------------------
GLR2_CAEEL      I-------FTLSSYFGVSLTIF------------------------------------------------
GLK1_DROME      ----------------------------------------------------------------------
MLTF_SHEB9      IADSSFVETLTQLQKHYPTLVWDQITDKDSEIANKEIDYTIADSSSVQINRRYLPDL--RSGPVLEEKLD
MLTF_SHEB8      IADSSFVETLTQLQKHYPTLVWDQITDKDSEIANKEIDYTIADSSSVQINRRYLPDL--RSGPVLEEKLD
MLTF_SHEB5      IADSSFVETLTQLQKHYPTLVWDQITDKDSEIANKEIDYTIADSSSVQINRRYLPDL--RSGPVLEEKLD
MLTF_PSEA7      VLKGSSHAAQLAQYPELKYDESDEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLA
GLRK_XENLA      ----------------------------------------------------------------------
MLTF_SERP5      AHVSTLKQLKQSKFPDLSWEASSDLTSKELQVADGKLDYTLGDSVTIALLQRIHPQLAVAFDVTDEE---
GRIA2_RAT       ----------------------------------------------------------------------
GRIA2_PONAB     ----------------------------------------------------------------------
GRIA2_MOUSE     ----------------------------------------------------------------------
GRIA2_MACFA     ----------------------------------------------------------------------
GRIA2_HUMAN     ----------------------------------------------------------------------
MLTF_SHIDS      V---APGHVVVNDLQTLKETKFDKKGSAELDVIEGKLDYTIADSVAISLFQRVHPELAVALDI-TDEQPV
MLTF_SHESR      IADSSFVETLTQLQKRHPTLVWDQVTDKDSEIANKEIDYTIADSSSVQINRRYLPDL--RSGLVLEEKLD
MLTF_ALCBS      VSAGSSAELLLKAQLESPELEFQEVENATPEVEDGQVDYTLINSNSYTLQRALWPDLVADYTVARDMPLS
GRID1_RAT       ----------------------------------------------------------------------
GRID1_MOUSE     ----------------------------------------------------------------------
GRID1_HUMAN     ----------------------------------------------------------------------
MLTF_SHISS      V---APGHVVVNDLQTLKDTKFDKKGSAELDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQ---
GRIK5_RAT       ----------------------------------------------------------------------
GRIK5_MOUSE     ----------------------------------------------------------------------
GRIK5_HUMAN     ----------------------------------------------------------------------
MLTF_SHESM      IADSSFVETLTQLQKRHPTLVWDQVTDKDSEIANKEIDYTIADSSSVQINRRYLPDL--RSGLVLEEKLD
MLTF_SHESA      IADSSFVETLTQLQKRHPTLVWDQVTDKDSEIANKEIDYTIADSSSVQINRRYLPDL--RSGLVLEEKLD
GRIK3_RAT       ----------------------------------------------------------------------
GRIK3_MACFA     ----------------------------------------------------------------------
GRIK3_HUMAN     ----------------------------------------------------------------------
MLTF_SHIF8      V---APGHVVVNDLQTLKETKFDKKGSAELDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQ---
MLTF_PSEHT      IAKSTLQKVKKSNWSXXXXXXXXXLLQAVID---GEIDYTLADTHTLSLFRRYHPNLSIGFSITHNDPIA
GLR1_CAEEL      ----------------------------------------------------------------------
MLTF_SHIFL      V---APGHVVVNDLQTLKETKFDKKGSAELDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQ---
MLTF_SHEON      I---------------------------------------------------------------------
MLTF_ECOLI      V---APGHVVVNDLQTLKETKFDKKGSAELDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQ---
MLTF_ECOLC      V---APGHVVVNDLQTLKETKFDKKGSAELDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQ---
MLTF_ECOHS      V---APGHVVVNDLQTLKETKFDKKGSAELDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQ---
MLTF_ECODH      V---APGHVVVNDLQTLKETKFDKKGSAELDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQ---
MLTF_ECO57      V---APGHVVVNDLQTLKETKFDKKGSAELDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQ---
MLTF_ECO11      V---APGHVVVNDLQTLKETKFDKKGSAELDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQ---
EVGS_ECOLI      VAIPYYYELHKEMYPEVEWIQVDNASAAFHKVKEGELDALVATQLNSRYMIYPNELYHFLIPGVPNASLS
MLTF_ECOUT      V---APGHVVVNDLQTLKDTKFDKKGSAELDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQ---
MLTF_ECOL5      V---APGHVVVNDLQTLKDTKFDKKGSAELDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQ---
MLTF_ECOK1      V---APGHVVVNDLQTLKDTKFDKKGSAELDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQ---
MLTF_ECO24      V---APGHVVVNDLQTLKDTKFDKKGSAELDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQ---
MLTF_CITK8      I---APGHVVVNDLQALKETKFKKGTAALLEVISGNLDYTIADSVAISLFQRVHPELAVALDVTDEQPVT
GRIA1_RAT       ----------------------------------------------------------------------
GRIA1_MOUSE     ----------------------------------------------------------------------
GRIA1_MACFA     ----------------------------------------------------------------------
GRIA1_HUMAN     ----------------------------------------------------------------------
MLTF_SHIBS      V---APGHVVVNDLQTLKETKFDKKGSAELDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQ---
MLTF_SHIB3      V---APGHVVVNDLQTLKETKFDKKGSAELDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQ---
MLTF_ECOSM      V---APGHVVVNDLQTLKETKFDKKGSAELDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQ---
MLTF_ECOL6      V---APGHVVVNDLQTLKDTKFPELSELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQ---
EVGS_ECO57      VAIPYYYELHKEMYPEVEWIKVDNASAAFHKVKEGELDALVATQLNSRYMIYPNELYHFLIPGVPNASLS
GRID2_RAT       ----------------------------------------------------------------------
GRID2_MOUSE     ----------------------------------------------------------------------
GRID2_HUMAN     ----------------------------------------------------------------------
NMDE4_RAT       ----------------------------------------------------------------------
NMDE4_MOUSE     ----------------------------------------------------------------------
NMDE4_HUMAN     ----------------------------------------------------------------------
GLRK_RANBE      ----------------------------------------------------------------------
GLRK_LYMST      ----------------------------------------------------------------------
GRIA3_RAT       ----------------------------------------------------------------------
GRIA3_MOUSE     ----------------------------------------------------------------------
GRIA3_MACFA     ----------------------------------------------------------------------
GRIA3_HUMAN     ----------------------------------------------------------------------
MLTF_PSEU5      VLKGSS---QAEKLASLQVLRYDEVVDLLRMVDEGQIDLTLVES--------------------------
NMDE3_HUMAN     ----------------------------------------------------------------------
MLTF_SHESW      I---------------------------------------------------------------------
MLTF_SHEPC      I---------------------------------------------------------------------
MLTF_SALAR      I---APGHVVVNDLQRLKETKFDKSTTLLEDVINGKLDYTIADSVAISLFQRVHPELAVALDVTDEQPVT
GRIK2_RAT       ----------------------------------------------------------------------
GRIK2_MOUSE     ----------------------------------------------------------------------
GRIK1_MOUSE     ----------------------------------------------------------------------
GRIK1_MACFA     ----------------------------------------------------------------------
GRIK1_HUMAN     ----------------------------------------------------------------------
NMDE2_RAT       ----------------------------------------------------------------------
NMDE2_MOUSE     ----------------------------------------------------------------------
NMDE2_HUMAN     ----------------------------------------------------------------------
NMDE2_CANFA     ----------------------------------------------------------------------
MLTF_ERWT9      AYLSSLREIKDRQYPDLDAVSTDRTPDGLLQVADGKIDYTIADSVSIGLMQRIHPQLTVAFDITEEEAVT
MLTF_ERWCT      AHAATLRDLKAEKYPQLSESASDQSTQELLQVADGKLDYTLGDSVTIGLMQRIHPQLAVAFDLSDEEPVI
GRIK2_MACFA     ----------------------------------------------------------------------
GRIK2_HUMAN     ----------------------------------------------------------------------
GLRK_ANAPL      ----------------------------------------------------------------------
NMDE3_MOUSE     ----------------------------------------------------------------------
MLTF_SALTY      I---APGHVVVNDLQRLKETKFDKSTTLLEEVISGKLDYTIADSVAISLFQRVHPELAVALDVTDEQPVT
MLTF_SALTI      I---APGHVVVNDLQRLKETKFDKSTTLLEEVISGKLDYTIADSVAISLFQRVHPELAVALDVTDEQPVT
MLTF_SALPA      I---APGHVVVNDLQRLKETKFDKSTTLLEEVISGKLDYTIADSVAIGLFQRVHPELAVALDVTDEQPVT
MLTF_SALCH      I---APGHVVVNDLQRLKETKFDKSTTLLEEVISGKLDYTIADSVAISLFQRVHPELAVALDVTDEQPVT
NMDE3_RAT       ----------------------------------------------------------------------
GLRK_CHICK      ----------------------------------------------------------------------
GRIK1_RAT       ----------------------------------------------------------------------
NMDE1_RAT       VMM-------------------------------------------------------------------
NMDE1_PANTR     VMM-------------------------------------------------------------------
NMDE1_MOUSE     VMM-------------------------------------------------------------------
NMDE1_HUMAN     VMM-------------------------------------------------------------------
MLTF_SHEPA      ----------------ITVTTDSSFVDTLTELQKSNPDLV------------------------------
MLTF_ENTS8      I---APGHVAQSELEQLKASKYPDLTELMLQVAQGTLDYTIADSVAISLFQRVHPQLAVALD-LSDEQ--
MLTF_SULDN      VGDSTSETIESLKKEGFDI---------------------------------------------------
MLTF_SHEHH      ITVDTLTDLQKSNPDLVWNQEKDKDAEELLTM--------------------------------------
MLTF_MARMM      VLEGSSYE-ETLRAIGVTHTALRWRTRPLLEVDDGQADCTIADSHLADFARRRHPELIVARN-LTGEQ--
MLTF_SHELP      ----------------------------------------------------------------------
MLTF_SHEAM      V---------------------------------------------------------------------
MLTF_VIBVY      ----------------------------------------------------------------------
MLTF_VIBVU      ----------------------------------------------------------------------
FLGI_ARCB4      TALDTR-TIDVKKPDGMSIVKFISLVQN-IELESSFKKKLIID--MNRESILAGGDIVIDPVTIARDTFT
MLTF_VIBPA      KDSQSEEDVNAGA-QTLKIVEQSQYVPTLTALKK------------------------------------
MLTF_ENT38      VVIDDLRALKEKKYPDLSWKVDEKLTTALLEVKDKKLAYTIADSVAISFFQRVHPEIAVALDV-TDEQPV
NMDZ1_MOUSE     ----------------------------------------------------------------------
MOXJ_METEA      VGFGTPGEADIGRYEEYSLVNFNQYTQMVSEVATGKAEVYVRDSSTKLRMTPVPDDTQASDGMPQSFDQA
MLTF_HAHCH      IPAQT-----------------------------------------------------------------
MLTF_CELJU      ILADSAHSKRVAKFPNLRPIENGQMIDLLEMVHKGEADYAVIDSNAYELHRYSYPRAKLAFDISNPQPLA
NMDZ1_RAT       ----------------------------------------------------------------------
NMDZ1_HUMAN     ----------------------------------------------------------------------
NMDZ1_CANFA     ----------------------------------------------------------------------
MLTF_SHEFN      ----------------------------------------------------------------------
NMDA1_DROWI     ----------------------------------------------------------------------
MLTF_SHESH      ----------------------------------------------------------------------
GLR31_ORYSJ     ----------------------------------------------------------------------
NMDA1_DROYA     ----------------------------------------------------------------------
NMDA1_DROVI     ----------------------------------------------------------------------
NMDA1_DROSI     ----------------------------------------------------------------------
NMDA1_DROSE     ----------------------------------------------------------------------
NMDA1_DROMO     ----------------------------------------------------------------------
NMDA1_DROME     ----------------------------------------------------------------------
NMDA1_DROGR     ----------------------------------------------------------------------
NMDA1_DROER     ----------------------------------------------------------------------
NMDA1_DROAN     ----------------------------------------------------------------------
NMD3B_MOUSE     ----------------------------------------------------------------------
NMD3B_RAT       ----------------------------------------------------------------------
NMDA1_DROPS     ----------------------------------------------------------------------
NMDA1_DROPE     ----------------------------------------------------------------------
MOXJ_PARDE      ----------------------------------------------------------------------
MLTF_VIBHB      ----------------------------------------------------------------------
MLTF_HAEIE      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IAVRKEDTDLLEFINSVLRELKKSPYDVLIEKWFSE
ARTP_BACSU      IAFRK-DSELTDKFNKALKEMENGELEKLKKKWFT-
ARTJ_ECOLI      IAVRPD------------------------------
FLIY_ECOLI      VALRKGNEDLLKAVNDAIAEMQKGTLQALSEKWF--
FLIY_ECOL6      VALRKGNEDLLKAVNDAIAEMQKGTLQALSEKWF--
ARTI_ECOLI      IAVRQGNTELQQKLNTALEKVKKGTYETIYNKWFQK
HISJ_NEIGO      IAVRKGDEATVKMLNDALEKVRESEYDKIYAKYFAK
GLNH_ECOLI      IAFPKGSDELRDKVNGALKTLRENTYNEIYKKWF--
GLNH_ECOL6      IAFPKGSDELRDKVNGALKTLRENTYNEIYKKWF--
GLNH_ECO57      IAFPKGSDELRDKVNGALKTLRENTYNEIYKKWF--
HISJ_ECOLI      MGLRKEDNELREALNKAFAEMRDGTYEKLAKKYF--
HISJ_ECOL6      MGLRKEDNELREALNKAFAEMRDGTYEKLAKKYF--
HISJ_ECO57      MGLRKEDNELREALNKAFAEMRDGTYEKLAKKYF--
HISJ_SALTY      MGLRKEDNELREALNKAFAEMRDGTYEKLAKKYF--
HISJ_CAMJE      FAFDKKQKDIIEIFNKGIDEAKTDGYDTLIKKY---
ARGT_ECOLI      VGLRKDDAELTAAFNKALGELRQGTYDKMAKKYF--
GLNH_BACST      IGSAKE------------------------------
ARGT_SALTY      VGLRKDDTELKAAFDKALTELRQGTYDKMAKKYF--
LAPT_PASHA      IATHLKNQVLVDQFNAALKTIKENEYQKIYDKW---
ARTJ_CHLTR      IGVASDRPALALKIEAAVQEIRKEGVLAELEKW---
GLNH_BACSU      IAVKKGQSALAKEINASLKKMKSGRYDEIYKKWIKE
Y1080_HAEIN     FAFLQGEDALITKFNQVLEALRQ-------------
GLTI_SALTY      CMLRKNDPEFKKLMDDTIAQAQTSGE---AEKWFDK
YXEM_BACSU      FPFAKDDAKLRKKVNKALDELRKGTLKKLSEKYFNE
PEB1A_CAMJJ     IVTKKDDPAFAKYVDDFVKE-HKNEIDALAKKW---
PEB1A_CAMJE     IVTKKDDPAFAKYVDDFVKE-HKNEIDALAKKW---
PATH_VIBHA      ------------------------------------
NOCT_AGRT5      XXIRKEDADLKAFDKAIDAAIADGTVQKLSQQWF--
GLTI_ECOLI      CMLRKDDPQFKKLMDDTIAQVQTSGE---AEKWFDK
TCYA_BACSU      -TFRKGSGEVVDQVNKALKEMKEGTLSKISKKWFGE
OCCT_RHIME      VGLRKDDAAL--------------------------
PHEC_PSEAE      ------------------------------------
ARTI_HAEIN      IAMHKSNKDLAAQLNKGLAAIKNGEYQKIYDKWITK
AABA_DICNO      IAVRKGDQALKKKIDDALLQLKRGTIDALTKKWY--
MLTF_PSEF5      VAA-GDDNSLLNEINSFLDKVEKN------------
MLTF_DESOH      WAVRKGDRGLRTEINRFFDEIKEN------------
OCCT_RHIRD      VGLRKEDTALADFDAAIKAASEDGTIKTLSLKWF--
OCCT_AGRT4      VGLRKEDTALADFDAAIKAASEDGTIKTLSLKWF--
YCKB_BACSU      LVMKKSNAALQKKMNEALKEMSKDGSLTKLSKQF--
Y4TE_RHISN      ------------------------------------
TCYJ_BACSU      ------------------------------------
MLTF_PSEPF      VAA-GEDNSLLNEINSYLDKVQKN------------
BVGS_BORPE      LATTRGQTELMSILNKALYSISNDELASIISRW---
TCYK_BACSU      FMFNKNEQTLSDDIDKALQEI---------------
Y3689_SHEFN     FVANETKTELMYQINEALRQLKLSEYDKLVNKWF--
MLTF_SACD2      ------------------------------------
YHDW_ECO57      PVVRRGDDEWFSIVRWTL------------------
YHDW_ECOLI      PVVRRGDDEWFSIVRWTL------------------
MLTF_PHOPR      WFVNKSDDSLYALLIEFFGEIKQSELAQLEEKYF--
AAPJ_RHIL3      PAVRQGDDQWFDIVS---------------------
MLTF_COLP3      WMVSENSHDLVEFFGTV-------------------
MLTF_PSEMY      VAPGEDDSLLLEIANGTLQRLKERYY----------
MLTF_PSESM      WAVAPEDNSLLNEINAYLDKVEKN------------
BVGS_BORPA      LATARGQTELISILNKALYSISNDELASIVSRW---
BVGS_BORBR      LATARGQTELISILNKALYSISNDELASIVSRW---
MLTF_IDILO      WALQGKDDSLFAAVIEYFGEIRSS------------
GLUB_COREF      IGITKDDTEATDAINAALERM---------------
MLTF_PSE14      VVAPGEDNSLLNEINAYLDKVEKN------------
MLTF_AERHH      ------------------------------------
MLTF_ACTSZ      ------------------------------------
MLTF_PSEPW      VA-PGEDNSLLNEVNEFLDKSQKN------------
BZTA_RHOCA      PVVRHGDNN---------------------------
MLTF_PSEU2      VA-PGEDNSLLNEINAYLDKVEKN------------
MLTF_PSEPG      WAVAAEDNSLLNEINEFLDKAQKN------------
MLTF_VIBF1      WFLQQEDDSLQALLIEFFGELKESGKLALLEE----
MLTF_KLEP7      FSARDDDNSLLDFFNNI-------------------
MLTF_SODGM      WYLRRSDSELLDFFSQL-------------------
MLTF_AERS4      ------------------------------------
GRIK4_RAT       ------------------------------------
MLTF_PSEAB      WALPGGDDSLMNEVNAFLDQAKK-------------
MLTF_PSEPK      VAA-GEDNSLLNEINEYLDKAQKN------------
GLUB_CORGL      IGLKKDDQEGTDAINAALERM---------------
MLTF_SALPB      WFSRLDDDNLLDFFNSI-------------------
MLTF_PSEP1      VAA-GEDNSLLNEINEFLDKAQKN------------
GRIK4_MOUSE     ------------------------------------
MLTF_YERPY      WYFKQSDDDSL-------------------------
MLTF_YERPS      WYFKQSDDDSL-------------------------
MLTF_YERPP      WYFKQSDDDSL-------------------------
MLTF_YERPN      WYFKQSDDDSL-------------------------
MLTF_YERPG      WYFKQSDDDSL-------------------------
MLTF_YERPE      WYFKQSDDDSL-------------------------
MLTF_YERPB      WYFKQSDDDSL-------------------------
MLTF_YERPA      WYFKQSDDDSL-------------------------
MLTF_YERP3      WYFKQSDDDSL-------------------------
MLTF_PSEE4      VAA-GDDNSLLNEINEFLDKSQKN------------
GRIK4_PANTR     ------------------------------------
GRIK4_HUMAN     ------------------------------------
MLTF_YERE8      ------------------------------------
MLTF_PSEAE      WALPGGDDDLMNEVNAFLDQAKK-------------
MLTF_NITMU      ------------------------------------
MLTF_METFK      ------------------------------------
GRIA4_RAT       ------------------------------------
GRIA4_MOUSE     ------------------------------------
GRIA4_MACFA     ------------------------------------
GRIA4_HUMAN     ------------------------------------
MLTF_VIBCH      ------------------------------------
MLTF_VIBC3      ------------------------------------
GRID2_DANRE     ------------------------------------
GLR2_CAEEL      ------------------------------------
GLK1_DROME      ------------------------------------
MLTF_SHEB9      VVWLLPPTRSDELMSQLLQEKLAGTLDHLNEKYF--
MLTF_SHEB8      VVWLLPPTRSDELMSQLLQEKLAGTLDHLNEKYF--
MLTF_SHEB5      VVWLLPPTRSDELMSQLLQEKLAGTLDHLNEKYF--
MLTF_PSEA7      WALPGGDDDLMNEVNAFLDQAKK-------------
GLRK_XENLA      ------------------------------------
MLTF_SERP5      ------------------------------------
GRIA2_RAT       ------------------------------------
GRIA2_PONAB     ------------------------------------
GRIA2_MOUSE     ------------------------------------
GRIA2_MACFA     ------------------------------------
GRIA2_HUMAN     ------------------------------------
MLTF_SHIDS      TWFRPLDGDLLDFFNEM-------------------
MLTF_SHESR      VVWLLPPTHSDSLMSQLLQEKLAGTLDHLNEKYF--
MLTF_ALCBS      WAFNKDDKSLYQEAQRYLTQAKADGTTAKLEDRF--
GRID1_RAT       ------------------------------------
GRID1_MOUSE     ------------------------------------
GRID1_HUMAN     ------------------------------------
MLTF_SHISS      ------------------------------------
GRIK5_RAT       ------------------------------------
GRIK5_MOUSE     ------------------------------------
GRIK5_HUMAN     ------------------------------------
MLTF_SHESM      V-----------------------------------
MLTF_SHESA      V-----------------------------------
GRIK3_RAT       ------------------------------------
GRIK3_MACFA     ------------------------------------
GRIK3_HUMAN     ------------------------------------
MLTF_SHIF8      ------------------------------------
MLTF_PSEHT      WMLRKSNDDSL-------------------------
GLR1_CAEEL      ------------------------------------
MLTF_SHIFL      ------------------------------------
MLTF_SHEON      ------------------------------------
MLTF_ECOLI      ------------------------------------
MLTF_ECOLC      ------------------------------------
MLTF_ECOHS      ------------------------------------
MLTF_ECODH      ------------------------------------
MLTF_ECO57      ------------------------------------
MLTF_ECO11      ------------------------------------
EVGS_ECOLI      FAFPRGEPELKDIINKALNAIPPSEVLRLTEKW---
MLTF_ECOUT      ------------------------------------
MLTF_ECOL5      ------------------------------------
MLTF_ECOK1      ------------------------------------
MLTF_ECO24      ------------------------------------
MLTF_CITK8      WFSQLDDDNLLDFFNTI-------------------
GRIA1_RAT       ------------------------------------
GRIA1_MOUSE     ------------------------------------
GRIA1_MACFA     ------------------------------------
GRIA1_HUMAN     ------------------------------------
MLTF_SHIBS      ------------------------------------
MLTF_SHIB3      ------------------------------------
MLTF_ECOSM      ------------------------------------
MLTF_ECOL6      ------------------------------------
EVGS_ECO57      FAFPRGEPELKDIINKALNAIPPSEVLRLTEKW---
GRID2_RAT       ------------------------------------
GRID2_MOUSE     ------------------------------------
GRID2_HUMAN     ------------------------------------
NMDE4_RAT       ------------------------------------
NMDE4_MOUSE     ------------------------------------
NMDE4_HUMAN     ------------------------------------
GLRK_RANBE      ------------------------------------
GLRK_LYMST      ------------------------------------
GRIA3_RAT       ------------------------------------
GRIA3_MOUSE     ------------------------------------
GRIA3_MACFA     ------------------------------------
GRIA3_HUMAN     ------------------------------------
MLTF_PSEU5      ------------------------------------
NMDE3_HUMAN     ------------------------------------
MLTF_SHESW      ------------------------------------
MLTF_SHEPC      ------------------------------------
MLTF_SALAR      WFSRLDDDNLLDFFNSI-------------------
GRIK2_RAT       ------------------------------------
GRIK2_MOUSE     ------------------------------------
GRIK1_MOUSE     ------------------------------------
GRIK1_MACFA     ------------------------------------
GRIK1_HUMAN     ------------------------------------
NMDE2_RAT       ------------------------------------
NMDE2_MOUSE     ------------------------------------
NMDE2_HUMAN     ------------------------------------
NMDE2_CANFA     ------------------------------------
MLTF_ERWT9      WYTQQEANDMLDFFSKMSEE----------------
MLTF_ERWCT      WYMRRSHDDLLDFFSQLVED----------------
GRIK2_MACFA     ------------------------------------
GRIK2_HUMAN     ------------------------------------
GLRK_ANAPL      ------------------------------------
NMDE3_MOUSE     ------------------------------------
MLTF_SALTY      WFSRLDDDNLLDFFNSI-------------------
MLTF_SALTI      WFSRLDDDNLLDFFNSI-------------------
MLTF_SALPA      WFSRLDDNNLLDFFNSI-------------------
MLTF_SALCH      WFSRLDDDNLLDFFNSI-------------------
NMDE3_RAT       ------------------------------------
GLRK_CHICK      ------------------------------------
GRIK1_RAT       ------------------------------------
NMDE1_RAT       ------------------------------------
NMDE1_PANTR     ------------------------------------
NMDE1_MOUSE     ------------------------------------
NMDE1_HUMAN     ------------------------------------
MLTF_SHEPA      ------------------------------------
MLTF_ENTS8      ------------------------------------
MLTF_SULDN      ------------------------------------
MLTF_SHEHH      ------------------------------------
MLTF_MARMM      ------------------------------------
MLTF_SHELP      ------------------------------------
MLTF_SHEAM      ------------------------------------
MLTF_VIBVY      ------------------------------------
MLTF_VIBVU      ------------------------------------
FLGI_ARCB4      IRINKTGLGEVDWNNPTI------------------
MLTF_VIBPA      ------------------------------------
MLTF_ENT38      TWFSPLDDDILDFFNSMNEE----------------
NMDZ1_MOUSE     ------------------------------------
MOXJ_METEA      MGVRKDDTALKAEIDAALEKAKPKIEAILKEE----
MLTF_HAHCH      ------------------------------------
MLTF_CELJU      WAFHSKDTSLFDAAQRYMAQIKRDGSLAQVTKHFFE
NMDZ1_RAT       ------------------------------------
NMDZ1_HUMAN     ------------------------------------
NMDZ1_CANFA     ------------------------------------
MLTF_SHEFN      ------------------------------------
NMDA1_DROWI     ------------------------------------
MLTF_SHESH      ------------------------------------
GLR31_ORYSJ     ------------------------------------
NMDA1_DROYA     ------------------------------------
NMDA1_DROVI     ------------------------------------
NMDA1_DROSI     ------------------------------------
NMDA1_DROSE     ------------------------------------
NMDA1_DROMO     ------------------------------------
NMDA1_DROME     ------------------------------------
NMDA1_DROGR     ------------------------------------
NMDA1_DROER     ------------------------------------
NMDA1_DROAN     ------------------------------------
NMD3B_MOUSE     ------------------------------------
NMD3B_RAT       ------------------------------------
NMDA1_DROPS     ------------------------------------
NMDA1_DROPE     ------------------------------------
MOXJ_PARDE      ------------------------------------
MLTF_VIBHB      ------------------------------------
MLTF_HAEIE      ------------------------------------