[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tmar0:AAD35750.1

[Show Plain Result]


## Summary of Sequence Search
    1::377
    3::367     9e-94  47%  372 aa  DEGT_BACST RecName: Full=Pleiotropic regulatory protein;
   11::363     4e-57  38%  370 aa  DNRJ_STRPE RecName: Full=Daunorubicin biosynthesis sensory
   19::381     1e-54  35%  389 aa  SPSC_BACSU RecName: Full=Spore coat polysaccharide biosynthesis
   17::378     2e-50  32%  386 aa  Y1066_METJA RecName: Full=Uncharacterized protein MJ1066;
    3::361     5e-49  35%  365 aa  ERBS_SACEN RecName: Full=Erythromycin biosynthesis sensory
   13::374     3e-40  32%  382 aa  ARNB_PSEU2 RecName:
   13::374     3e-40  33%  382 aa  ARNB_PSEPF RecName:
   15::370     4e-40  32%  379 aa  ARNB_ENT38 RecName:
   12::377     2e-39  30%  382 aa  ARNB_YERE8 RecName:
   17::373     5e-39  31%  379 aa  ARNB_SODGM RecName:
   12::373     2e-38  31%  381 aa  ARNB_PROMH RecName:
   17::373     3e-38  31%  379 aa  ARNB_KLEP3 RecName:
   17::373     4e-38  31%  379 aa  ARNB_KLEP7 RecName:
   12::377     3e-37  30%  384 aa  ARNB_YERPY RecName:
   12::377     3e-37  30%  384 aa  ARNB_YERPS RecName:
   12::377     3e-37  30%  384 aa  ARNB_YERPP RecName:
   12::377     3e-37  30%  384 aa  ARNB_YERPN RecName:
   12::377     3e-37  30%  384 aa  ARNB_YERPG RecName:
   12::377     3e-37  30%  384 aa  ARNB_YERPE RecName:
   12::377     3e-37  30%  384 aa  ARNB_YERPB RecName:
   12::377     3e-37  30%  384 aa  ARNB_YERPA RecName:
   12::377     3e-37  30%  384 aa  ARNB_YERP3 RecName:
   12::370     4e-37  32%  384 aa  ARNB_SERP5 RecName:
   15::370     4e-37  30%  379 aa  ARNB_ERWT9 RecName:
   16::378     7e-37  30%  379 aa  ARNB_PSEF5 RecName:
   12::359     1e-36  31%  381 aa  ARNB_PHOLL RecName:
   83::429     4e-36  28%  441 aa  NTDA_BACSU RecName: Full=NTD biosynthesis operon protein ntdA;
   15::377     8e-36  31%  382 aa  ARNB_PECCP RecName:
   15::377     9e-35  32%  382 aa  ARNB_ERWCT RecName:
   20::374     4e-34  30%  382 aa  ARNB_PSEAE RecName:
   20::374     4e-34  30%  382 aa  ARNB_PSEAB RecName:
   20::374     4e-34  30%  382 aa  ARNB_PSEA8 RecName:
   20::374     2e-33  30%  382 aa  ARNB_PSEA7 RecName:
   17::370     5e-33  30%  378 aa  ARNB_AERHH RecName:
   15::373     8e-33  29%  379 aa  ARNB_SALSV RecName:
   17::370     8e-33  30%  378 aa  ARNB_AERS4 RecName:
   26::373     3e-32  29%  379 aa  ARNB_SHISS RecName:
   26::373     3e-32  29%  379 aa  ARNB_SHIBS RecName:
   26::373     3e-32  29%  379 aa  ARNB_ECOSM RecName:
   26::373     3e-32  29%  379 aa  ARNB_ECOSE RecName:
   26::373     3e-32  29%  379 aa  ARNB_ECO55 RecName:
   26::373     3e-32  29%  379 aa  ARNB_ECO24 RecName:
   26::373     4e-32  29%  379 aa  ARNB_ECOLC RecName:
   26::373     5e-32  29%  379 aa  ARNB_SHIFL RecName:
   26::373     5e-32  29%  379 aa  ARNB_SHIF8 RecName:
   26::373     5e-32  29%  379 aa  ARNB_ECOLI RecName:
   26::373     5e-32  29%  379 aa  ARNB_ECOHS RecName:
   26::373     5e-32  29%  379 aa  ARNB_ECODH RecName:
   26::373     5e-32  29%  379 aa  ARNB_ECOBW RecName:
   26::373     5e-32  29%  379 aa  ARNB_ECO8A RecName:
   15::373     7e-32  29%  379 aa  ARNB_SALTY RecName:
   15::373     7e-32  29%  379 aa  ARNB_SALPK RecName:
   15::373     7e-32  29%  379 aa  ARNB_SALPC RecName:
   15::373     7e-32  29%  379 aa  ARNB_SALPA RecName:
   15::373     7e-32  29%  379 aa  ARNB_SALNS RecName:
   15::373     7e-32  29%  379 aa  ARNB_SALHS RecName:
   15::373     7e-32  29%  379 aa  ARNB_SALDC RecName:
   15::373     9e-32  29%  379 aa  ARNB_SALPB RecName:
   15::373     9e-32  29%  379 aa  ARNB_SALG2 RecName:
   15::373     9e-32  29%  379 aa  ARNB_SALEP RecName:
   15::373     9e-32  29%  379 aa  ARNB_SALA4 RecName:
   12::372     9e-32  29%  381 aa  ARNB_EDWI9 RecName:
   26::373     9e-32  29%  379 aa  ARNB_ECOLU RecName:
   26::373     1e-31  29%  379 aa  ARNB_ECOUT RecName:
   26::373     1e-31  29%  379 aa  ARNB_ECOL6 RecName:
   26::373     1e-31  29%  379 aa  ARNB_ECOL5 RecName:
   26::373     1e-31  29%  379 aa  ARNB_ECOK1 RecName:
   26::373     1e-31  29%  379 aa  ARNB_ECO7I RecName:
   26::373     1e-31  29%  379 aa  ARNB_ECO45 RecName:
   18::382     2e-31  29%  388 aa  ARNB_SHESH RecName:
   26::373     2e-31  29%  379 aa  ARNB_ECO5E RecName:
   26::373     2e-31  29%  379 aa  ARNB_ECO57 RecName:
   26::373     2e-31  29%  379 aa  ARNB_ECO27 RecName:
   26::373     2e-31  30%  379 aa  ARNB_ESCF3 RecName:
   15::373     4e-31  29%  379 aa  ARNB_SALCH RecName:
   15::373     8e-31  29%  379 aa  ARNB_SALTI RecName:
   26::373     8e-31  29%  379 aa  ARNB_ECO81 RecName:
   23::255     1e-30  37%  416 aa  GLADA_STRSD RecName: Full=Putative
   45::266     1e-29  38%  418 aa  GLDSA_BACCI RecName: Full=L-glutamine:2-deoxy-scyllo-inosose
   29::313     1e-26  33%  424 aa  GLDSA_STRSD RecName: Full=L-glutamine:2-deoxy-scyllo-inosose
   31::293     6e-26  34%  424 aa  GLDSA_STRLV RecName: Full=L-glutamine:2-deoxy-scyllo-inosose
   52::273     6e-26  30%  418 aa  GLADA_MICEC RecName: Full=Putative
   32::266     6e-26  32%  388 aa  EPSN_BACSU RecName: Full=Putative pyridoxal phosphate-dependent
   30::371     4e-25  26%  376 aa  RFFA_ECOLI RecName: Full=Lipopolysaccharide biosynthesis protein
   29::294     8e-25  32%  424 aa  GLDSA_STRRY RecName: Full=L-glutamine:2-deoxy-scyllo-inosose
   64::313     1e-24  33%  424 aa  GLDSA_STRRI RecName: Full=L-glutamine:2-deoxy-scyllo-inosose
  139::397     5e-24  36%  507 aa  MOSB_RHIME RecName: Full=Protein mosB;
   63::255     7e-24  34%  419 aa  GLADA_STRKN RecName: Full=Putative
   55::282     9e-24  34%  424 aa  GLDSA_STRFR RecName: Full=L-glutamine:2-deoxy-scyllo-inosose
   32::296     2e-23  31%  427 aa  GLDSA_STRKN RecName: Full=L-glutamine:2-deoxy-scyllo-inosose
  107::313     2e-18  32%  437 aa  RFBH_SALTY RecName: Full=Lipopolysaccharide biosynthesis protein
   55::284     6e-18  30%  424 aa  GLSA_STRGR RecName: Full=L-glutamine:scyllo-inosose
   66::229     3e-17  31%  420 aa  GLDSA_MICEC RecName: Full=L-glutamine:2-deoxy-scyllo-inosose
  120::301     5e-11  28%  412 aa  Y3402_MYCTU RecName: Full=Protein Rv3402c/MT3510;
  120::301     2e-10  28%  412 aa  Y3436_MYCBO RecName: Full=Protein Mb3436c;
   66::279     5e-07  31%  377 aa  SPSS_METTH RecName: Full=Sep-tRNA:Cys-tRNA synthase;       
   39::185     3e-06  24%  351 aa  HIS8_THEPX RecName: Full=Histidinol-phosphate aminotransferase;    
   39::185     3e-06  24%  351 aa  HIS8_THEP3 RecName: Full=Histidinol-phosphate aminotransferase;    
   92::196     7e-06  35%  401 aa  CSD_PYRAB RecName: Full=Probable cysteine desulfurase;       
   34::138     2e-04  31%  351 aa  HIS8_THETN RecName: Full=Histidinol-phosphate aminotransferase;    
   64::156     3e-04  33%  353 aa  HIS8_SYNJB RecName: Full=Histidinol-phosphate aminotransferase;    
  132::246     5e-04  27%  431 aa  GLYA_CALMQ RecName: Full=Serine hydroxymethyltransferase;       
   83::213     5e-04  34%  395 aa  BIKB_BACHK RecName: Full=Putative 8-amino-7-oxononanoate
  138::203     6e-04  29%  417 aa  GLYA_SYNAS RecName: Full=Serine hydroxymethyltransferase;       
   48::200     6e-04  26%  400 aa  CSD_CHLMU RecName: Full=Probable cysteine desulfurase;       
   83::213     6e-04  34%  395 aa  BIKB_BACC0 RecName: Full=Putative 8-amino-7-oxononanoate
   83::213     6e-04  34%  395 aa  BIKB2_BACAN RecName: Full=Putative 8-amino-7-oxononanoate
   57::142     8e-04  33%  367 aa  HIS8_METAC RecName: Full=Histidinol-phosphate aminotransferase;    
    1::377

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIPLFDLTRQYERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAM
DEGT_BACST      -VPMLDLSEQYEQLKPEIMRVLDEVMRSSRFILGDYVKKLEADIAAYSRAKHGIGCGNGSDAIHIALQAA
DNRJ_STRPE      ---------EYREERADILDAVETVFESGQLILGTSVRSFEEEFAAYHGLPYCTGVDNGTNALVLGLRAL
SPSC_BACSU      ----------------EEIQEVTETLESGWLSKGPKVQQFEKEFAAFVGAKHAVAVNSCTAALFLALKAK
Y1066_METJA     ----------------EEINEVIDTLKSDWITMGPKTLKFEELFRNYIGSKFAISLNSCTAGLHLSLVAL
ERBS_SACEN      -VPFLDLQAAYLELRSDIDQACRRVLGSGWYLHGPXXXXXXXXXXXXXXXXHCVTVGSGCDALELSLVAL
ARNB_PSEU2      -------------IGDEEIAAVTRVLRSGWITTGPECQKLEEEFAARVGARHAVALSSATGAMHVALLAL
ARNB_PSEPF      -------------IGDEEIAAVEQVLRSGWITTGPKNQALEEQFAQYVGSRHAVALSSATGAMHVTLLAL
ARNB_ENT38      ----------------EELAAVSEVLQSGWITTGPKNQALEQAFCALTGNQHSIAVSSATAGMHVALMAL
ARNB_YERE8      -------------IGSDEINAVVNVLGSGWITTGPQNQQLETDFCAAFGCKHAVAVCSATAGMHITLMAL
ARNB_SODGM      ------------------LAAVGDVLRSGWITTGPKCAQLEQAFCQLTGNRHAIAVSSATGGMHVTLMAL
ARNB_PROMH      -------------IGDEEIKAVESVLRSGWITTGPQNHQLEQDFCEKFGSKHAIAVCSATAGMHVVLMAM
ARNB_KLEP3      ------------------LAALREVLASGWITTGPKNQALEAAFCQLTGNRHAIAVSSATGGMHVTLMAL
ARNB_KLEP7      ------------------LAALREVLASGWITTGPKNQALEAAFCQLTGNRHAIAVSSATGGMHVTLMAL
ARNB_YERPY      -------------IGSEEINAVANVLGSGWITTGPQNHQLETDFCQIFGCKHAIAVCSATAGMHITLLAL
ARNB_YERPS      -------------IGSEEINAVANVLGSGWITTGPQNHQLETDFCQIFGCKHAIAVCSATAGMHITLLAL
ARNB_YERPP      -------------IGSEEINAVANVLGSGWITTGPQNHQLETDFCQIFGCKHAIAVCSATAGMHITLLAL
ARNB_YERPN      -------------IGSEEINAVANVLGSGWITTGPQNHQLETDFCQIFGCKHAIAVCSATAGMHITLLAL
ARNB_YERPG      -------------IGSEEINAVANVLGSGWITTGPQNHQLETDFCQIFGCKHAIAVCSATAGMHITLLAL
ARNB_YERPE      -------------IGSEEINAVANVLGSGWITTGPQNHQLETDFCQIFGCKHAIAVCSATAGMHITLLAL
ARNB_YERPB      -------------IGSEEINAVANVLGSGWITTGPQNHQLETDFCQIFGCKHAIAVCSATAGMHITLLAL
ARNB_YERPA      -------------IGSEEINAVANVLGSGWITTGPQNHQLETDFCQIFGCKHAIAVCSATAGMHITLLAL
ARNB_YERP3      -------------IGSEEINAVANVLGSGWITTGPQNHQLETDFCQIFGCKHAIAVCSATAGMHITLLAL
ARNB_SERP5      -------------IGDEEISAVEKVLRSGWITTGPQNQQLESEFCATFGCKHAIAVCSATAGMHITLMAL
ARNB_ERWT9      ----------------EELAAVEEVLRSGWITTGPKNQQLEQAFCRLTGNRHAIAVCSATAGMHVALMAL
ARNB_PSEF5      ----------------EEIAAVEQVLRSGWITTGPKNQELEQQFAERVGARHAVALSSATGAMHITLLAL
ARNB_PHOLL      -------------IGDEEIQAVEKVLRSGWITTGPQNHQLEQDFCRMFGCKHAVALASATAGMHLTLMAL
NTDA_BACSU      ----------------DILNTLTEVLPTGKFTSGPYLEQFEKVLSTYLHKRYVIATSSGTDAIMIGLLAL
ARNB_PECCP      ----------------EEIAAVAEVLRSGWITTGPKCQQLEQAFCQQVGCRQAIAVSSATGGMHVTLMAL
ARNB_ERWCT      ----------------EEIAAVAEVLRSGWITTGPKCQQLEXXXXXXXXXXXXIAVSSATGGMHVTLMAL
ARNB_PSEAE      --------------------AVEQVLRSGWITTGPKNQELEQRFAERLGCRHAVALSSATGALHVTLLAL
ARNB_PSEAB      --------------------AVEQVLRSGWITTGPKNQELEQRFAERLGCRHAVALSSATGALHVTLLAL
ARNB_PSEA8      --------------------AVEQVLRSGWITTGPKNQELEQRFAERLGCRHAVALSSATGALHVTLLAL
ARNB_PSEA7      --------------------AVEQVLRSGWITTGPQNQELEQRFAERLGCRHAVALSSATGALHVTLLAL
ARNB_AERHH      ------------------ISAVCDVLKSGWITTGPKNHELEQQFCDTFGCQHAVALCSATAGMHVTLLAL
ARNB_SALSV      ----------------EELAAVKTVLDSGWITTGPKNQELEAEFCRLTGNQYAVAVSSATAGMHIALMAL
ARNB_AERS4      ------------------ISAVCEVLKSGWITTGPKSHELEQQFCDTYGCQHAVALNSATAGMHVTLMAL
ARNB_SHISS      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_SHIBS      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECOSM      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECOSE      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECO55      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECO24      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECOLC      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_SHIFL      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_SHIF8      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECOLI      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECOHS      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECODH      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECOBW      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECO8A      ---------------------------SGWLTTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_SALTY      ----------------EELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGMHIALMAL
ARNB_SALPK      ----------------EELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGMHIALMAL
ARNB_SALPC      ----------------EELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGMHIALMAL
ARNB_SALPA      ----------------EELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGMHIALMAL
ARNB_SALNS      ----------------EELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGMHIALMAL
ARNB_SALHS      ----------------EELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGMHIALMAL
ARNB_SALDC      ----------------EELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGMHIALMAL
ARNB_SALPB      ----------------EELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGMHIALMAL
ARNB_SALG2      ----------------EELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGMHIALMAL
ARNB_SALEP      ----------------EELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGMHIALMAL
ARNB_SALA4      ----------------EELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGMHIALMAL
ARNB_EDWI9      -------------IGDEEIAAVSEVLRSGWITTGPQNQALEQEFCQATGARHAIAVCSATAGMHVTLMAL
ARNB_ECOLU      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECOUT      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECOL6      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECOL5      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECOK1      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECO7I      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECO45      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_SHESH      ------------------ISAVADVLRSGWITTGPKSAELEESILRHTGAQHAVSLSSATAGMHLVLLVL
ARNB_ECO5E      ---------------------------SGWITTGPKNHALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECO57      ---------------------------SGWITTGPKNHALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ECO27      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
ARNB_ESCF3      ---------------------------SGWITTGPKNLALEDAFIQLTGNQYAIAVSSATAGMHITLMAL
ARNB_SALCH      ----------------EELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGMHIALMAL
ARNB_SALTI      ----------------EELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGMHIALMAL
ARNB_ECO81      ---------------------------SGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMAL
GLADA_STRSD     ------------RFRERDLERIREVLESGSLFPNRTHRAFAEQFCGRLGARHGVLVANGTVSLSVALRAL
GLDSA_BACCI     -------------------------------------RKFAKAFADFNGVPYCVPTTSGSTALMLALEAL
GLDSA_STRSD     ------------------LDALERVLRSGRWAISGPYRGIESDFAAYNGVAHCVPAASGTASLMLALESC
GLDSA_STRLV     --------------------AVQQVLSSGRWSISSQERRFARAFAEYNGVAHCVPAASGTASLMLALEAC
GLADA_MICEC     -------------------------------------QQFAERFTAKLGAKYGLLATNGTVTLSMALRAL
EPSN_BACSU      --------------------------------LGPLVNSFEEQLXXXXXXXXXXXXXXXXXXIHLALRLL
RFFA_ECOLI      ---------------------------------GGFTRRCQQWLEQRFGSAKVLLTPSCTASLEMAALLL
GLDSA_STRRY     ------------------VRALDGVLTSGRWSISSQERRFAQAFAAYNGVEHCVPAASGTASLMLAMEAC
GLDSA_STRRI     ----------------------------------------------YNGVPHCVPAASGTASLMLALEAC
MOSB_RHIME      -------------------------------------RRMEEWI----GGGYVVSASSGTAALTVALIAL
GLADA_STRKN     ------------------------------------------------GAPYGLMVSNGTISLSIALRAL
GLDSA_STRFR     -------------------------------------RRFARAFADYHGVPYCVPAASGTAGLMLALEAC
GLDSA_STRKN     ------------------LDALSRVLRSGRWAISGPYRGVESAXXDYHRIAHCVPASSGTASLMLALEAC
RFBH_SALTY      ----------------------------------------------------------------------
GLSA_STRGR      -------------------------------------RQFASAFADYCGSAMCVPISTGTASLAIALEAC
GLDSA_MICEC     -------------------------------------------------IGHCVPTSSGTASLMVALEAC
Y3402_MYCTU     ----------------------------------------------------------------------
Y3436_MYCBO     ----------------------------------------------------------------------
SPSS_METTH      -----------------------------------------DDLADFTGVRTVHGAREGKFAVMHAL---
HIS8_THEPX      ----------------EVIKNIQEIVKSSNVYPDPTAEKLKEELARYCGVPTNIFVGNGSDEIIHLIMLA
HIS8_THEP3      ----------------EVIKNIQEIVKSSNVYPDPTAEKLKEELARYCGVPTNIFVGNGSDEIIHLIMLA
CSD_PYRAB       ------------------------------------------------------------------LVAL
HIS8_THETN      ----FELPEEVMKNIGDIVKSIHV-----NIYPDPTAEKLREELARYCSVTKNIFVGNGSDEIIHLIMLA
HIS8_SYNJB      -------------------------------------RGLKQAIAAYAGAEEQISLGNGSDSLLIATCLG
GLYA_CALMQ      ----------------------------------------------------------------------
BIKB_BACHK      ----------------------------GNYSLYEEVER---SICNWKGTEKALVVNSGFTANVGAISSL
GLYA_SYNAS      ----------------------------------------------------------------------
CSD_CHLMU       ---------------------VNRAIYSASHDISSAYWRVRSKVAAWIGARYDQGTTSSLNLLAIAANDS
BIKB_BACC0      ----------------------------GNYSLYEEVER---SICNWKGTEKALVVNSGFTANVGAISSL
BIKB2_BACAN     ----------------------------GNYSLYEEVER---SICNWKGTEKALVVNSGFTANVGAISSL
HIS8_METAC      ------------------VRALVETAPGANIYPSADARELREVLSKYTGVSNIVASGPGMDGLLDGLCRI


                         .         .         *         .         .         .         .:140
query           GVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDL
DEGT_BACST      GVGPGDEVIXXXXXXXXXXGSIARAGAKPVFVDIDPVTFNIDPAQVEAAVT-EKTKAIIPVHLYGQMADM
DNRJ_STRPE      GIGPGDEVVTVSNTAAPTVVAIDAVGATPVFVDVHEENYLMDTGRLRSVI-GPRTRCLLPVHLYGQSVDM
SPSC_BACSU      GIGPGDEVITSPLTFSSTANTIIHTGATPVFADIDENTLNIDPVKLEAAV-TPRTKAVVPVHFGGQSCDM
Y1066_METJA     NIKDKDEVITTPYTFAATGNVIVHQRAKPVFVDIDKETYNINVEEIENAI-TERTKAIIPVHYAGHPCEM
ERBS_SACEN      GVGQGDEVIVPSHTFIATWLXXXXXXXXXXXXXXXXS-HTLDPALVEQAITP-RTAAILPVHLYGHPXXX
ARNB_PSEU2      GVGPGDEVITPSQTWVSTANMICLLGATPVFVDVDRDTLMTSAALIEHAI-TPRTKAIVPVHYAGAAFDL
ARNB_PSEPF      GIGPGDEVITPSQTWVSTANMISLLGATPVFVDVDRDTLMTDAARIEAAI-TPRTKAIIPVHYAGAAFDL
ARNB_ENT38      GIQAGDEVITPSLTWVSTLNMIVLLGAEPVMIDVDHDTLMVTPQAIEAAI-TPRTKAIIPVHYAGAPVDI
ARNB_YERE8      GIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDIDRDTLMVNAADIEAAI-TSKTKAIIPVHYAGAPCDL
ARNB_SODGM      GLGPGDEVITPSLTWVSTLNMICLLGAEPIMIDVDRDTLMVTPALIEAAI-TPRTRAIVPVHYAGAPADI
ARNB_PROMH      GIGPGDEVITPSQTWVSTINIITLLGAEPVMVDIDRDTLMVSAESVKKAI-TPRTKAIIPVHYAGAPCDL
ARNB_KLEP3      GIGPGDEVITPSQTWVSTLNMICLLGATPVMIDVDNDNLMITPDAVEAAI-TSRTKAIIPVHYAGAPADI
ARNB_KLEP7      GIGPGDEVITPSQTWVSTLNMICLLGATPVMIDVDNDNLMITPDAVEAAI-TSRTKAIIPVHYAGAPADI
ARNB_YERPY      GIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVDRDTLMVNAAAIEAAI-TPNTKAIIPVHYAGAPCDL
ARNB_YERPS      GIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVDRDTLMVNAAAIEAAI-TPNTKAIIPVHYAGAPCDL
ARNB_YERPP      GIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVDRDTLMVNAAAIEAAI-TPNTKAIIPVHYAGAPCDL
ARNB_YERPN      GIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVDRDTLMVNAAAIEAAI-TPNTKAIIPVHYAGAPCDL
ARNB_YERPG      GIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVDRDTLMVNAAAIEAAI-TPNTKAIIPVHYAGAPCDL
ARNB_YERPE      GIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVDRDTLMVNAAAIEAAI-TPNTKAIIPVHYAGAPCDL
ARNB_YERPB      GIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVDRDTLMVNAAAIEAAI-TPNTKAIIPVHYAGAPCDL
ARNB_YERPA      GIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVDRDTLMVNAAAIEAAI-TPNTKAIIPVHYAGAPCDL
ARNB_YERP3      GIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVDRDTLMVNAAAIEAAI-TPNTKAIIPVHYAGAPCDL
ARNB_SERP5      NIGPGDEVITPSQTWVSTLNMIELLGATPVMIDVDRDTLMVSASDVEAAI-TTKTKVIVPVHYAGAPLQM
ARNB_ERWT9      GIGPGDEVITPSLTWVSTLNMIALLGATPVMIDVDRDTLMVTPELIEAAI-TERTRAIVPVHYAGAPADI
ARNB_PSEF5      GIGPGDEVITPSQTWVSTANMICLLGATPVFVDVDPDTLMSDAATIEAAI-TPRTKAIIPVHYAGAAFDL
ARNB_PHOLL      GIGPGDEVITPSQTWVSTINMICLLGAEPIMIDVDRHTLMVDAQTVKKAI-TSRTKAIIPVHYAGAPCDL
NTDA_BACSU      GLNPGDEVIMPANSFSATENAVLASGGVPIYVDINPQTFCIDPDKIEEAI-TPYTKFILPVHLYGKHSDM
ARNB_PECCP      GIGPGDEVITPSQTWVSTVNMITLLGAEPVMVDVDRHTLMVRPQDIEAAI-TPKTKAIIPVHYAGAPADL
ARNB_ERWCT      GIGPGDEVITPSQTWVSTVNIITLLGAEPVMVDVDRHTLMVRSQDIEAAITP-KTKAIIPVHYAGAPADL
ARNB_PSEAE      GIGPGDEVITPSLTWVSTANVITLLGATPVFVDVDRDTLMCSAQAVEAAI-GPRTRAIVPVHYAGSTLDL
ARNB_PSEAB      GIGPGDEVITPSLTWVSTANVITLLGATPVFVDVDRDTLMCSAQAVEAAI-GPRTRAIVPVHYAGSTLDL
ARNB_PSEA8      GIGPGDEVITPSLTWVSTANVITLLGATPVFVDVDRDTLMCSAQAVEAAI-GPRTRAIVPVHYAGSTLDL
ARNB_PSEA7      GIGPGDEVITPSLTWVSTANVITLLGATPVFVDVDRDTLMCSAQAVEAAI-GPRTRAIVPVHYAGSTLDL
ARNB_AERHH      GIGPGDEVITPSQTWVSTINIITLLGAEPVFVDVDPDTL-MTSAELIAPLITANTKAIIPVHYAGAPVDL
ARNB_SALSV      GIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVDRDTLMVTPEHIEAAITPQ-TKAIIPVHYAGAPADL
ARNB_AERS4      GIGPGDEVITPSQTWVSTINLITLLGAEPVFVDVDRDTL-MTSAELIAPLITVNTKAIIPVHYAGAPVDL
ARNB_SHISS      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_SHIBS      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_ECOSM      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_ECOSE      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_ECO55      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_ECO24      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_ECOLC      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_SHIFL      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_SHIF8      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_ECOLI      KIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_ECOHS      KIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_ECODH      KIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_ECOBW      KIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_ECO8A      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_SALTY      GIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVDRDTLMVTPEHIEAAITPQ-TKAIIPVHYAGAPADL
ARNB_SALPK      GIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVDRDTLMVTPEHIEAAITPQ-TKAIIPVHYAGAPADL
ARNB_SALPC      GIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVDRDTLMVTPEHIEAAITPQ-TKAIIPVHYAGAPADL
ARNB_SALPA      GIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVDRDTLMVTPEHIEAAITPQ-TKAIIPVHYAGAPADL
ARNB_SALNS      GIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVDRDTLMVTPEHIEAAITPQ-TKAIIPVHYAGAPADL
ARNB_SALHS      GIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVDRDTLMVTPEHIEAAITPQ-TKAIIPVHYAGAPADL
ARNB_SALDC      GIGEGDEVITPSMTWVSTLNMIVLLGATPVMVDVDRDTLMVTPEHIEAAITPQ-TKAIIPVHYAGAPADL
ARNB_SALPB      GIGEGDEVITPSMTWVSTLNMIVLLGATPVMVDVDRDTLMVTPEHIEAAITPQ-TKAIIPVHYAGAPADL
ARNB_SALG2      GIGEGDEVITPSMTWVSTLNMIVLLGATPVMVDVDRDTLMVTPEHIEAAITPQ-TKAIIPVHYAGAPADL
ARNB_SALEP      GIGEGDEVITPSMTWVSTLNMIVLLGATPVMVDVDRDTLMVTPEHIEAAITPQ-TKAIIPVHYAGAPADL
ARNB_SALA4      GIGEGDEVITPSMTWVSTLNMIVLLGATPVMVDVDRDTLMVTPEHIEAAITPQ-TKAIIPVHYAGAPADL
ARNB_EDWI9      GIGPGDEVITPSMTWVSTLNIITLLGATPVMIDVGRDTLMVTPEAIADAI-TPRTKAIIPVHFAGAPVDL
ARNB_ECOLU      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_ECOUT      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIEAAI-TPRTKAIIPVHYAGAPADI
ARNB_ECOL6      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIEAAI-TPRTKAIIPVHYAGAPADI
ARNB_ECOL5      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIEAAI-TPRTKAIIPVHYAGAPADI
ARNB_ECOK1      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIEAAI-TPRTKAIIPVHYAGAPADI
ARNB_ECO7I      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_ECO45      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIEAAI-TPRTKAIIPVHYAGAPADI
ARNB_SHESH      GIGPGDEVITPSMTWVSTVNMITLLGAKPVFVDVDADNLMTDVALIEPLI-TERTKLIIPVHYAGASLDL
ARNB_ECO5E      EIGKGDEVITPSLTWVSTLNMISLQGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_ECO57      EIGKGDEVITPSLTWVSTLNMISLQGATPVMVDVDRDTLMVTPEAIESAI-TPRTKAIIPVHYAGAPADI
ARNB_ECO27      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEVIEAAI-TPRTKAIIPVHYAGAPADI
ARNB_ESCF3      EIGPGDEVITPSMTWVSTLNMISLLGATPVMVDVDRDTLMVTPEIVEAAI-TPRTKAIIPVHYAGAPADT
ARNB_SALCH      GIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVDRDTLMVTPEHIEAAITPQ-TKAIIPVHYAGAPADL
ARNB_SALTI      GIGEGDEVITPSMTWVSTLNMIVLLGATPVMVDVDRDTLMVTPEHIEAAITPQ-TKAIIPVHYAGAPADL
ARNB_ECO81      EIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIEAAI-TPRTKAIIPVHYAGAPADI
GLADA_STRSD     GVHAGDEVITTGYTWMGTAASIVHINAVPVLVDIDPNTWCIDPAAVEAAI-TPRTRAIVPVHLANQIADL
GLDSA_BACCI     GIGEGDEVIVPSLTWIATATAVLNVNALPVFVDVEADTYCIDPQLIKSAI-TDKTKAIIPVHLFGSMANM
GLDSA_STRSD     GVGVGDEVIAPGLSWVASASTIVGVNAVPVLVDIDPRTLCLDPAAVEAAI-TPATKAVVVVHLYSXXXXX
GLDSA_STRLV     GVGAGDEVIVPGLSWVASGSTVLGVNAVPVFCDVDPRTLCLDPEAVEAAV-TERTKAIVVVHLYSAVADM
GLADA_MICEC     GIHAGDEVITTAFTWVGTVAGIVHVNAVPVLADISDDNWCIDPVKVEEAI-TDRTRAIMVVHLGNQVADM
EPSN_BACSU      EVKEGDSVFCQSFTFVATANPILYEKAVPVFIDSEPDTWNMSPTALERALEEAKPKAVIAVNLYGQSAKM
RFFA_ECOLI      DIQPGDEVIMPSYTFVSTANAFVLRGAKIVFVDVRPDTMNIDETLIEAAI-TDKTRVIVPVHYAGVACEM
GLDSA_STRRY     GIGAGDEVIVPGLSWVASGSTVLGVNAVPVFCDVDPDTLCLDPAAVESAL-TERTKAIVVVHLYSXXXXX
GLDSA_STRRI     GIGAGDEVIVPGLSWVASGSTILGVNAVPIFCDVDPDTLCLSPEAVEAAIT-EHTRAIVVVHLYSALADM
MOSB_RHIME      GIQPGDVVLLPSYTWAATALAPLLIGAIPRFVDIDPNSYNISPTALAAAITPD-VKAIIVVHMHGISCDM
GLADA_STRKN     GVRAGDEVITTGYTWMGTAAAIVHINAVPVLVDIDPTTWCIDPAAVEAAI-TPRTKVIVPVHLGNQXXXX
GLDSA_STRFR     GVGAGDEVIVPGLSWVASGSTVLGVNAVPVFCDVDPDTLCVSPEAVE-ALITERTRAVVVVHLYSAVADM
GLDSA_STRKN     GVGAGDEVILPGVTWVASASTVVGVNAVPVFADIDPDTLCLDPDAVEAAI-TPATKAIVVVHLYAAVADL
RFBH_SALTY      -LKPGDEVITVAAGFPTTVNPAIQNGLIPVFVDVDIPTYNIDASLIEAAVT-EKSKAIMIAHTLGNAFNL
GLSA_STRGR      GVGAGDEVIVPGLSWVASASAVLGINAVPVLVDVDPATYCLDPXXXXXXXXXXXXXXXV-VHAYSXXXXX
GLDSA_MICEC     GVGAGDEVIIPGLTWVANASTXXXXXXXXXXXXXXXQTLCLDPAAVERAITP-RTAAIVVVHLYSAVADL
Y3402_MYCTU     ------------FTFVGVAQAALWTGYRPWFIDIDANTWQPCVHSARAVIERDRIAGILLANVFGGNPQI
Y3436_MYCBO     ------------FTFVGVAQAALWTGYRPWFIDIDANTWQPCVHSACAVIERDRIAGILLANVFGGNPQI
SPSS_METTH      -CERGDTVVVDGNAHYTTHLAAERNGLEIVEVPSTEVTPEAYREVLEETIDRVEVKLAVLTHVYGNLTDA
HIS8_THEPX      FINKGD-VVAYPHPSFAMYSVYSKIAGAVEIPVRLREDYNYDVDSFIKVIEKYQPKLVFPNNPTGSVIER
HIS8_THEP3      FINKGD-VVAYPHPSFAMYSVYSKIAGAVEIPVRLREDYNYDVDSFIKVIEKYQPKLVFPNNPTGSVIER
CSD_PYRAB       GLEKGDKIVTTPYEHHSNLLPWQRLGLKLEFIEGDDEG-NLDLADAEKKIKGAKLVAVQHVNALGVIHEV
HIS8_THETN      FVDKGDTVL-YPHPSFAMYSIYSKIGANEIAVNLNEDTYNVE----------------------------
HIS8_SYNJB      G--RGGILVAEP-TFSMYAILAQSLGIPVVRVPRDPETFALDLERCQQALREHPIRVV------------
GLYA_CALMQ      --------------------APGAFGIKVIHLPCDEENFSINVDSAVKVIREEKPQLVISLYLFPHPV--
BIKB_BACHK      -VCRHDIVFSDKLNHASIVDGIILSGAE------HKRYRHNDLNHLEALLKTEKRKLIVTDTVFGDTAHL
GLYA_SYNAS      ----------------------------VVPYGVDRETETIDYNQVEDLALQHKPRMIVVASAYPRTIDF
CSD_CHLMU       WLAGGTVVVSEAENILSWEIACRRSGATVKKVRVNDEGI-IDLSHLEKLLKQQLVSLAHVSNVSGAVLPV
BIKB_BACC0      AC-RHDIVFSDKLNHASIVDGIILSGAE------HKRYRHNDLNHLEALLKTEKRKLIVTDTVFGDTAHL
BIKB2_BACAN     AC-RHDIVFSDKLNHASIVDGIILSGAE------HKRYRHNDLNHLEALLKTEKRKLIVTDTVFGDTAHL
HIS8_METAC      IIEKGDEVI-VPTPTFAYYELPARCGGKPVFV--------------------------------------


                         +         .         .         .         .         *         .:210
query           EALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIA
DEGT_BACST      EAIAAIAKRHGLVVIEDAAQAIGAKYNGKC-----VGELGTAATYSFFPTKNLGAYGDGGMIITNDDELA
DNRJ_STRPE      TPVLELAAEHDLKVLEDCAQAHGAR-----RHGRLVGTQGHAAAFSFYPTKVLGAYGDGGAVVTPDAEVX
SPSC_BACSU      DAILAVAQNHGLFVLEDAAHAVYTTYK-----QRMIGSIGDATAFSFYATKNLAT-GEGGMLTTDDEELA
Y1066_METJA     DEILKIARDYDLYVIEDAAHALGAEYKG-----KKIGTIGDTTSFSFYATKNI-TTGEGGMVTTDNEEIA
ERBS_SACEN      XXXXXXXXXHGLALVEDVAQXXXXXXXXXXXXXXSN-----AAAFSFYPGKNLGALGDGGAVVTTDPALA
ARNB_PSEU2      DPLYALADRHGITVIEDAAHAAGTAY-----QGRPVGQQG-TAIFSFHAIKNM-TCAEGAMLVTDNARLA
ARNB_PSEPF      DPLYALADKHGIAVIEDAAHAAGTRYKG-----RHVGSQG-TAIFSFHAIKNM-TCAEGAMFVTDDEALA
ARNB_ENT38      DAIRAVADRHGIPVIEDAAHAAGTYYKGS-----HVGNRG-TAIFSFHAIKNM-TCAEGGLIVTDDEQLA
ARNB_YERE8      DALRQIAQQYKIPLIEDAAHAVGT--RYGDQWVGEKGT----TIFSFHAIKNI-TCAEGGLIATDDDELA
ARNB_SODGM      DAIRALGERYGIPVIEDAAHAAGTAYKG-----RHVGAAG-TAIFSFHAIKNM-TCAEGGMVVTDDDALA
ARNB_PROMH      DALRAVADEAGIPLIEDAAHAIGTRYK--DEWIGEKGT----SIFSFHAIKNV-TCAEGGLVVTDDDELA
ARNB_KLEP3      DAIRAVGERHGIPVIEDAAHAAGTHYKG-----RHIGWQG-TAIFSFHAIKNM-TCAEGGLIVTDDDELA
ARNB_KLEP7      DAIRAVGERHGISVIEDAAHAAGTHYKG-----RHVGWQG-TAIFSFHAIKNM-TCAEGGLIVTDDDELA
ARNB_YERPY      DALRQISQRHGIPLIEDAAHAVGT--RYRDQWIGEQGT----AIFSFHAIKNI-TCAEGGLVATDDDELA
ARNB_YERPS      DALRQISQRHGIPLIEDAAHAVGT--RYRDQWIGEQGT----AIFSFHAIKNI-TCAEGGLVATDDDELA
ARNB_YERPP      DALRQISQRHGIPLIEDAAHAVGT--RYRDQWIGEQGT----AIFSFHAIKNI-TCAEGGLVATDDDELA
ARNB_YERPN      DALRQISQRHGIPLIEDAAHAVGT--RYRDQWIGEQGT----AIFSFHAIKNI-TCAEGGLVATDDDELA
ARNB_YERPG      DALRQISQRHGIPLIEDAAHAVGT--RYRDQWIGEQGT----AIFSFHAIKNI-TCAEGGLVATDDDELA
ARNB_YERPE      DALRQISQRHGIPLIEDAAHAVGT--RYRDQWIGEQGT----AIFSFHAIKNI-TCAEGGLVATDDDELA
ARNB_YERPB      DALRQISQRHGIPLIEDAAHAVGT--RYRDQWIGEQGT----AIFSFHAIKNI-TCAEGGLVATDDDELA
ARNB_YERPA      DALRQISQRHGIPLIEDAAHAVGT--RYRDQWIGEQGT----AIFSFHAIKNI-TCAEGGLVATDDDELA
ARNB_YERP3      DALRQISQRHGIPLIEDAAHAVGT--RYRDQWIGEQGT----AIFSFHAIKNI-TCAEGGLVATDDDELA
ARNB_SERP5      DALREVAKRHNLPLIEDAAHAVGAEWVGARG----------TAIFSFHAIKNL-TCAEGGLIATDDDQLA
ARNB_ERWT9      DAVHALGKRHGIAVIDDAAHAAGTYYR--GRHVGESGT----AIFSFHAIKNM-SCAEGGMIVTDDDALA
ARNB_PSEF5      DPLYALADKHGIAVIEDAAHAAGTTYRG-----RAIGARG-TAIFSFHAIKNM-TCAEGAMFVSDDEALA
ARNB_PHOLL      DILRGIAQEAGIPLIEDAAHALGTRYK--NEWIGEHGT----AIFSFHAIKN-ATCAEGGLIATDNNELV
NTDA_BACSU      QHIRQIANRYKLKVIEDACQGIG---------LTDLGKYADITTLSFNPYKNFGVCGKAGAIATDNEELA
ARNB_PECCP      TALRTLSERYGIPLIEDAAHAVGTQYRDEWIGAR------GTAIFSFHAIKNI-TCAEGGMVVTDDEALA
ARNB_ERWCT      DALRALSERYGIPLIEDAAHAVGTQYR---GE--WIGARG-TAIFSFHAIKNI-TCAEGGMVVTDDEALA
ARNB_PSEAE      EGLRTVAGRHGIALVEDAAHAVGSEYRG-----RPVGSRG-TAIFSFHAIKNL-TCAEGAMFVSDDSALA
ARNB_PSEAB      EGLRTVAGRHGIALVEDAAHAVGSEYRG-----RPVGSRG-TAIFSFHAIKNL-TCAEGAMFVSDDSALA
ARNB_PSEA8      EGLRTVAGRHGIALVEDAAHAVGSEYRG-----RPVGSRG-TAIFSFHAIKNL-TCAEGAMFVSDDSALA
ARNB_PSEA7      EGLRTVAGRHGIALVEDAAHAVGSEYRG-----RPVGARG-TAIFSFHAIKNL-TCAEGAMFVSDDSALA
ARNB_AERHH      DPILALARRHGIAVIEDAAHAVGTRYR-----ERWIGASG-TAIFSFHAIKNL-TCAEGGMLVTDDKALA
ARNB_SALSV      DAIYALGERYGIPVIEDAAHATGTSYKG-----RHIGARG-TAIFSFHAIKNI-TCAEGGIVVTDNPQFA
ARNB_AERS4      DPILKLARQYDIPVIEDAAHAIGTRYR-----DRWIGATG-TAIFSFHAIKNL-TCAEGGMLVTDDKALA
ARNB_SHISS      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_SHIBS      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_ECOSM      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_ECOSE      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_ECO55      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_ECO24      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_ECOLC      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_SHIFL      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_SHIF8      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_ECOLI      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_ECOHS      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_ECODH      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_ECOBW      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_ECO8A      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_SALTY      DAIYALGERYGIPVIEDAAHATGTSYKG-----RHIGARG-TAIFSFHAIKNI-TCAEGGIVVTDNPQFA
ARNB_SALPK      DAIYALGERYGIPVIEDAAHATGTSYKG-----RHIGARG-TAIFSFHAIKNI-TCAEGGIVVTDNPQFA
ARNB_SALPC      DAIYALGERYGIPVIEDAAHATGTSYKG-----RHIGARG-TAIFSFHAIKNI-TCAEGGIVVTDNPQFA
ARNB_SALPA      DAIYALGERYGIPVIEDAAHATGTSYKG-----RHIGARG-TAIFSFHAIKNI-TCAEGGIVVTDNPQFA
ARNB_SALNS      DAIYALGERYGIPVIEDAAHATGTSYKG-----RHIGARG-TAIFSFHAIKNI-TCAEGGIVVTDNPQFA
ARNB_SALHS      DAIYALGERYGIPVIEDAAHATGTSYKG-----RHIGARG-TAIFSFHAIKNI-TCAEGGIVVTDNPQFA
ARNB_SALDC      DAIYALGERYGIPVIEDAAHATGTSYKG-----RHIGARG-TAIFSFHAIKNI-TCAEGGIVVTDNPQFA
ARNB_SALPB      DAIYALGERYGIPVIEDAAHATGTSYKG-----RHIGARG-TAIFSFHAIKNI-TCAEGGIVVTDNPQFA
ARNB_SALG2      DAIYALGERYGIPVIEDAAHATGTSYKG-----RHIGARG-TAIFSFHAIKNI-TCAEGGIVVTDNPQFA
ARNB_SALEP      DAIYALGERYGIPVIEDAAHATGTSYKG-----RHIGARG-TAIFSFHAIKNI-TCAEGGIVVTDNPQFA
ARNB_SALA4      DAIYALGERYGIPVIEDAAHATGTSYKG-----RHIGARG-TAIFSFHAIKNI-TCAEGGIVVTDNPQFA
ARNB_EDWI9      DPIRALAQRQGIALIEDAAHAIGTAYR---GEIGQRGT----AIFSFHAIKNV-TCAEGGMVVTDDDRLA
ARNB_ECOLU      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_ECOUT      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_ECOL6      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_ECOL5      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_ECOK1      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_ECO7I      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_ECO45      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_SHESH      DAIYDLGERYKIPVIEDAAHALGCEYK--GHPIGKTGT----CLFSLHAIKNV-TTAEGGIFTTQDAELA
ARNB_ECO5E      NAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENIA
ARNB_ECO57      NAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENIA
ARNB_ECO27      DAIRAIGERYGIAVIEDAAHAVGTYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
ARNB_ESCF3      NALYAIAERHGIAVIEDAAHAVGTYYKGQHVGAR------GTAIFSFHAIKNI-TCAEGGLVVTDDESLA
ARNB_SALCH      DAIYALGERYGIPVIEDAAHATGTSYK--GLHIGARGT----AIFSFHAIKNI-TCAEGGIVVTDNPQFA
ARNB_SALTI      DAIYALGARYGIPVIEDAAHATGTSYKG-----RHIGARG-TAIFSFHAIKNI-TCAEGGIVVTDNPQFA
ARNB_ECO81      DAIRAIGERYGIAVIEDAAHAVGMYYKG-----RHIGAKG-TAIFSFHAIKNI-TCAEGGLIVTDNENLA
GLADA_STRSD     DALLEIARKHDLVVLEDCAHAHFAEWRG-----RCVGTHGDAGSFSFESSK-IMTSGEGGFLV-SGDETT
GLDSA_BACCI     DEINEIAQEHNLFVIEDCAQSHGSVW-----NNQRAGTIGDIGAFSCQQGKVL-TAGEGGIIVTKNPRLF
GLDSA_STRSD     XXXXXXXXXHGLPLIEDCAQAHGAEHRG-----RKVGSVGDVGTFSMQHSKVL-TSGEGGAAITNSAELA
GLDSA_STRLV     DALTALAERHSLPLIEDCAQAHGAAYRGV-----KVGALATAGTFSMQHSKML-TSGEGGAVITRDADFA
GLADA_MICEC     DALLDICRRHNLLLIEDCAHAHFAEWRG-----RCVGTIGDAGSYS-FETSKIMTSGEGGFLVTATEEAF
EPSN_BACSU      DEIVSLCDAYGVPVIEDAAESLGTVYKG-----KQSGTFGRFGIFSFNGNKIITTSG-GGMLVSNDEAAI
RFFA_ECOLI      DTIMALAKKHNLFVVEDAAQGVMSTYKG-----RALGTIGHIGCFSFHETKNYTAGGEGGATLINDKALI
GLDSA_STRRY     XXXXXXXXXHGLPLLEDCAQAHGAEYRGV-----KVGALATAGTFSMQHSKVL-TSGEGGAVITRDAEFA
GLDSA_STRRI     DALSAIAERHGLPLIEDCAQAHGATYRGV-----KVGALATAGTFSMQHSKVL-TSGEGGAVITRDEDFA
MOSB_RHIME      DEIICHAREQGIAVIEDCAQAHGALYKG-----QHVGLLSDIGCFSMQKSKHLSA-GDGGFMVTRDPTLA
GLADA_STRKN     XXXXXXXXKHGLAILEDTAHGHFAEWRGQC-----VGTHGDAGSFSFESSK-IMTAGEGGFLVARDEDVY
GLDSA_STRFR     DGLTRVAERHGLPLVEDCAQAHGASYRGV-----KVGALATAGTFSMQHSKVL-TSGEGGAVITRDADLA
GLDSA_STRKN     TRLKEVADRHGIVLIEDCAQAHGAEF-----EGHKVGTFGAVGTFSMQQSKVL-TSGEGGAAITADPVLA
RFBH_SALTY      SEVRRIADKYNLWLIEDCCDALGTTY-----EGQMVGTFGDIGTVSFYPAHHI-TMGEGGAVFTKSGELK
GLSA_STRGR      XXXXXIARRHGLPLIEDCAHAHGAGFRG-----RPVGAHGAAGVFSMQGSKLL-TCGEGGALVTDDADVA
GLDSA_MICEC     DALTAIAERHEIPLIEDCAQAHGARYR-----DRRVGTFGAFGTFSMQHSKVL-TSGEGGAVITGDAALS
Y3402_MYCTU     SVWEELAAEWELPIVLDSAAGFGST--YADGE--RLGGRGACEIFSFHATKPFAV-GEGGALVSRDPRLV
Y3436_MYCBO     SVWEELAAEWELPIVLDSAAGFGST--YADGE--RLGGRGACEIFSFHATKPFAV-GEGGALVSRDPRLV
SPSS_METTH      RGVADVCRKLGVPLLLNCAYSMG-RLPVNLRELGVDFVVGSG-------HKSMAASGPIGVLGMKSE---
HIS8_THEPX      EIIKIIQKSNGIVVVDE-----------------------------------------------------
HIS8_THEP3      EIIKIIQKSNGIVVVDE-----------------------------------------------------
CSD_PYRAB       EELGKMVKEEGAIFVVDAAQSVG-----------------------------------------------
HIS8_THETN      ----------------------------------------------------------------------
HIS8_SYNJB      ----------------------------------------------------------------------
GLYA_CALMQ      KELAQVAHENGAYLMHDSAHVLG---LIAGGQF--PNSLNEGADLMTSSTHKTFPGPQGGVIFTNNESI-
BIKB_BACHK      RELVQLKEKYGAIIIVDEAHASG-----------------------------------------------
GLYA_SYNAS      EKFRAIADKVGALVMADIAHIAG-----------------------------------------------
CSD_CHLMU       QEVAFLVHRYGALLAIDGAQGVGS----------------------------------------------
BIKB_BACC0      RELVQLKEKYGAIIIVDEAHASG-----------------------------------------------
BIKB2_BACAN     RELVQLKEKYGAIIIVDEAHASG-----------------------------------------------
HIS8_METAC      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPR
DEGT_BACST      EKCRVIRVHGSKPKYYHHVLGYNSRLDEMQAAILSVKFPHLDRWTEQRRKHAATYTRLLEEAVGDLVVTP
DNRJ_STRPE      XXXXXXXXXXXXXXXVVDTPGHNSRLDEVQAEILRRKLRRLDAYVEGRRAVARRYXXXXXXXXXXVL-PT
SPSC_BACSU      DKIRVLSLHGMSKAYEVESPGYKMNMFDLQAALGLHQLKRLDDMQKRREEIAGRYQTAFQQ--IPLITPF
Y1066_METJA     EKIKILRLHGAWKRYSSEECGYKYNMTDIQASIGIHQLKKAEIMRKRREEIAKIYNEEFENLEGLITPTI
ERBS_SACEN      ERIRLLRNYGSKQKYVHEVRGTNARLDELQAAVLRVKLRHLDDWNARRTTLAQHYQTELKDVTLPETHPW
ARNB_PSEU2      DRVRQLKFHGLGVDAYDREPGFKYNLADINASIARVQLQRLDAINAQRQALASHYERLANSPVLPLALPR
ARNB_PSEPF      NRVRMLKFHGAYDRLTHGRPGFKYNLADINAAIALVQLERLDAINARRTELATQYQKLEGLPVQPLAVPN
ARNB_ENT38      NRMRSLKFHGLGVDAFDRQTGYKYNLADINAAIALVQLKKLEKNNARRTEIAERYTELANTPFLPLSQPA
ARNB_YERE8      AKVRRLKFHGLGVDAFDRQIGYKYNLSDIHAAIAVVQLQRLPEINARRQALAARYHQALVDSPLQPLFVP
ARNB_SODGM      QRIRSLKFHGLAVDAFDRTMGYKYNLADINAAIALVQLEKLTQHNARRAALAQRYHGLADTPFLPLV-PP
ARNB_PROMH      NRVRCLKFHGLGVDAFDRQVGYKYNLSDIHAAIAVVQLSRLEEMNAKRAELVALYREKLQDSPLEMLYPH
ARNB_KLEP3      SRIRSLKFHGAYDRQTHGRAGFKYNLADINAALALVQLEKLSHANQRRTEIAQRYRELADTPFKPLTVPA
ARNB_KLEP7      SRIRSLKFHGAYDRQTHGRAGFKYNLADINAALALVQLEKLSHANQRRTEIAQRYRELADTPFKPLSVPT
ARNB_YERPY      ARVRRLKFHGLGVDAFDRQIGYKYNLSDIHAAIAVVQLRRLPEINARRQALVASYXXXXXXXXXXXXXXX
ARNB_YERPS      ARVRRLKFHGLGVDAFDRQIGYKYNLSDIHAAIAVVQLRRLPEINARRQALVASYXXXXXXXXXXXXXXX
ARNB_YERPP      ARVRRLKFHGLGVDAFDRQIGYKYNLSDIHAAIAVVQLRRLPEINARRQALVASYXXXXXXXXXXXXXXX
ARNB_YERPN      ARVRRLKFHGLGVDAFDRQIGYKYNLSDIHAAIAVVQLRRLPEINARRQALVASYXXXXXXXXXXXXXXX
ARNB_YERPG      ARVRRLKFHGLGVDAFDRQIGYKYNLSDIHAAIAVVQLRRLPEINARRQALVASYXXXXXXXXXXXXXXX
ARNB_YERPE      ARVRRLKFHGLGVDAFDRQIGYKYNLSDIHAAIAVVQLRRLPEINARRQALVASYXXXXXXXXXXXXXXX
ARNB_YERPB      ARVRRLKFHGLGVDAFDRQIGYKYNLSDIHAAIAVVQLRRLPEINARRQALVASYXXXXXXXXXXXXXXX
ARNB_YERPA      ARVRRLKFHGLGVDAFDRQIGYKYNLSDIHAAIAVVQLRRLPEINARRQALVASYXXXXXXXXXXXXXXX
ARNB_YERP3      ARVRRLKFHGLGVDAFDRQIGYKYNLSDIHAAIAVVQLRRLPEINARRQALVASYXXXXXXXXXXXXXXX
ARNB_SERP5      DRLRCLKFHGLAVDAFDREPGYKYNLSDIHAAIAVVQLARLPQLNARRKALAQRYLTALEGSPLPLGLPD
ARNB_ERWT9      DRMRSLKFHGLGVDAFDRQTGYKYNLADINAAIALVQLDKLAAHNARREQIAQRYSELADTPFLPLARPA
ARNB_PSEF5      NRVRMLKFHGAYDRLTHGRPGFKYNLADMNAAIALVQLQRLDEINAKREVLAKAYLQRLEGXXXXXXXXX
ARNB_PHOLL      ERIRCLKFHGLGIDAFDRQIGYKYNLSDIHAAIAVVQLSKLESMNIRRRQIVARYSTALKDSPLQMLSVP
NTDA_BACSU      KKCIQFSYHGFEVNVKNKKVGFNSKMDNLQAAIGLERMKYLSLNNFKRLFLADRYQLAELQNKGYIELPE
ARNB_PECCP      ERIRSLKFHGLGVDAFDRQPGFKYNLADINAAIALVQLDKLPAINARRQQLAARY--LTQLRSLPLQYPH
ARNB_ERWCT      ERIRSLKFHGLGVDAFDRQLGFKYNLADINAAIALVQLDKLPAINARRQQLAARY--LTQLHSLPLQYPH
ARNB_PSEAE      ERVRRLKFHGAYDRLSHGRPGFKYXXXXXXXXXXXVQLKRLDALNARRQALAERYLERXXXXXXXXXXXX
ARNB_PSEAB      ERVRRLKFHGAYDRLSHGRPGFKYXXXXXXXXXXXVQLKRLDALNARRQALAERYLERXXXXXXXXXXXX
ARNB_PSEA8      ERVRRLKFHGAYDRLSHGRPGFKYXXXXXXXXXXXVQLKRLDALNARRQALAERYLERXXXXXXXXXXXX
ARNB_PSEA7      ERVRRLKFHGAYDRLSHGRPGFKYXXXXXXXXXXXVQLKRLDALNARRQALAERYLERXXXXXXXXXXXX
ARNB_AERHH      DKVRMLKFHGLGVDAFDRTPGFKYNLADINAAIALVQLARLPELNAKRAELVARYQERXXXXXXXXXXXX
ARNB_SALSV      DKLRSLKFHGLGVDAWDRQPGYKYNLPDLNAAIALAQLQKLDXXXXXXXXXXXXXXXXXXDLPFQPLSLP
ARNB_AERS4      DKVRMLKFHGLGVDAFDRMTGFKYNLTDINAAIALIQLARLPELNARRAGLVARYQEKXXXXXXXXXXXX
ARNB_SHISS      RQLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLAKLEHLNTHRREIXXXXXXXXXXXXXXXXXXX
ARNB_SHIBS      RQLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLAKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECOSM      RQLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLAKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECOSE      RQLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLAKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECO55      RQLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLAKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECO24      RQLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLAKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECOLC      RQLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIAMTQLAKLEYLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_SHIFL      RQLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLVKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_SHIF8      RQLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLVKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECOLI      RQLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLVKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECOHS      RQLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLVKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECODH      RQLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLVKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECOBW      RQLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLVKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECO8A      RQLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLAKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_SALTY      DKLRSLKFHGLGVDAWDRQPGYKYNLPDLNAAIALAQLQKLDXXXXXXXXXXXXXXXXXXDLPFQPLSLP
ARNB_SALPK      DKLRSLKFHGLGVDAWDRQPGYKYNLPDLNAAIALAQLQKLDXXXXXXXXXXXXXXXXXXDLPFQPLSLP
ARNB_SALPC      DKLRSLKFHGLGVDAWDRQPGYKYNLPDLNAAIALAQLQKLDXXXXXXXXXXXXXXXXXXDLPFQPLSLP
ARNB_SALPA      DKLRSLKFHGLGVDAWDRQPGYKYNLPDLNAAIALAQLQKLDXXXXXXXXXXXXXXXXXXDLPFQPLSLP
ARNB_SALNS      DKLRSLKFHGLGVDAWDRQPGYKYNLPDLNAAIALAQLQKLDXXXXXXXXXXXXXXXXXXDLPFQPLSLP
ARNB_SALHS      DKLRSLKFHGLGVDAWDRQPGYKYNLPDLNAAIALAQLQKLDXXXXXXXXXXXXXXXXXXDLPFQPLSLP
ARNB_SALDC      DKLRSLKFHGLGVDAWDRQCGYKYNLPDLNAAIALAQLQKLDXXXXXXXXXXXXXXXXXXDLPFQPLSLP
ARNB_SALPB      DKLRSLKFHGLGVDAWDRQPGYKYNLPDLNAAIALAQLQKLDXXXXXXXXXXXXXXXXXXDLPFQPLSLP
ARNB_SALG2      DKLRSLKFHGLGVDAWDRQPGYKYNLPDLNAAIALAQLQKLDXXXXXXXXXXXXXXXXXXDLPFQPLSLP
ARNB_SALEP      DKLRSLKFHGLGVDAWDRQPGYKYNLPDLNAAIALAQLQKLDXXXXXXXXXXXXXXXXXXDLPFQPLSLP
ARNB_SALA4      DKLRSLKFHGLGVDAWDRQPGYKYNLPDLNAAIALAQLQKLDXXXXXXXXXXXXXXXXXXDLPFQPLSLP
ARNB_EDWI9      QQVRSLKFHGAYDRQTHGRAGYKYNLADINAAIARVQLAKLPELNXXXXXXXXXXXXXXXXHQLPFSPLN
ARNB_ECOLU      RLLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLAKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECOUT      RQLRMLKFHGLGVDAYDRHTGYKYNLTDINAAIALTQLVKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECOL6      RQLRMLKFHGLGVDAYDRHTGYKYNLTDINAAIALTQLVKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECOL5      RQLRMLKFHGLGVDAYDRHTGYKYNLTDINAAIALTQLVKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECOK1      RQLRMLKFHGLGVDAYDRHTGYKYNLTDINAAIALTQLVKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECO7I      RQLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLAKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECO45      RQLRMLKFHGLGVDAYDRHTGYKYNLTDINAAIALTQLVKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_SHESH      ARIRRLKFHGLGVDAFDRETGYKYNMPDICAVLALGQMKRIGEITQKRTELALHYRDLLTAVGTPLSIPS
ARNB_ECO5E      RQLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLAKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECO57      RQLRMLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLAKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ECO27      RQLRMLKFHGLGVDAYDRHTGYKYNLTDINAAIALTQLVKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
ARNB_ESCF3      RQLRTLKFHGLGVDAYDRQTGYKYNLTDINAAIALTQLHKLEQLNARRHDIATQYQHAFQPLALP-AWPH
ARNB_SALCH      DKLRSLKFHGLGVDAWDRQPGYKYNLPDLNAAIALAQLQKLDXXXXXXXXXXXXXXXXXXDLPFQPLSLP
ARNB_SALTI      DKLRSLKFHGLGVDAWDRQPGYKYNLPDFNAAIALAQLQKLDXXXXXXXXXXXXXXXXXXDLPFQPLSLP
ARNB_ECO81      RQLRMLKFHGLGVDAYDRHTGYKYNLTDINAAIALTQLVKLEHLNTRRREIXXXXXXXXXXXXXXXXXXX
GLADA_STRSD     HHRAMSLVNCGRKEEGYDSLGWNNRATELQAAFL------------------------------------
GLDSA_BACCI     ELIQQLRMHGDMQLVKKGDIGSNYCLSEFQSAILLDQLQELD----------------------------
GLDSA_STRSD     RRMEHLRADGGRMELVEELMGSNRCLSEFQAAVLVEQLRELDEQNALRRRNAELLNTLLAEQGL---RPQ
GLDSA_STRLV     RRVEHLRADGMELVETGELMGNNRCLSEFQAALLTEQLKDLDAQHAIRRRNAALLDGLLRE---------
GLADA_MICEC     HRAMSL-AHVGRKEAPYDRFGWNHRATEMQAAVLLGQLDRYDALDKQRTAMA------------------
EPSN_BACSU      EKARFLQAREPAVHYQHSEIGHNYRLSNILAGVGIAQLEVLDERVEKRRTIFTRYK--------------
RFFA_ECOLI      ERAEIIREKGTNRKYTWRDIGSSYLMSDLQAAYLWAQLEAADRINQQRLALWQNYYDALAAKAGRIELPS
GLDSA_STRRY     RRVEHLRADGMELVETGELMGSNRCVSEFQAALLVEQLGVLDEQNERRRRNAALLDKLLADE--------
GLDSA_STRRI     RRVEHLRADGMELVETGELMGNNRCLSEFQAAILAEQLTILDEQNETRRANAAHLDGLLGELGL---RPQ
MOSB_RHIME      QKMRDICNFGVRDGYACEQIGGMFRLQPMSAALVMHQLEHL------RQRIATAMEPLVEESAKIPFFKI
GLADA_STRKN     QRMMSLANCGRKEPFAGRTLGWNARASELQAAFM------------------------------------
GLDSA_STRFR     RRVEHLRADGMELVETGELMGSNRCLSEFQAAILTEQLTLLDE--QNRTRRA------------------
GLDSA_STRKN     RRMEHLRADGRCYRETGELMGSNRCISEFQAAVLTEQLGELDRFNALRRHNAELLDALLTD---------
RFBH_SALTY      KIIESFRPQGYDHKYTYSHLGYNLKITDMQAACGLAQLERVEEFVEQR----------------------
GLSA_STRGR      LRAEHLRADXXXXXXXXRMMGSNACLSEFHAAVLLDQLELLDGQNARRTRAA------------------
GLDSA_MICEC     RRAEHLRADG------------------------------------------------------------
Y3402_MYCTU     EHAYKFQNFGLVQTRESIQLGMNGKLSEISAAIGLRQLVGLDRRLASRRKVLECYR--------------
Y3436_MYCBO     EHAYKFQNFGLVQTRESIQLGMNGKLSEISAAIGLRQLVGLDRRLASRRKVLECYR--------------
SPSS_METTH      WEDTVLRRSGRHEKKELELLGCTSRLATLMASLPYVRER-VSRWDGE-----------------------
HIS8_THEPX      ----------------------------------------------------------------------
HIS8_THEP3      ----------------------------------------------------------------------
CSD_PYRAB       ----------------------------------------------------------------------
HIS8_THETN      ----------------------------------------------------------------------
HIS8_SYNJB      ----------------------------------------------------------------------
GLYA_CALMQ      ----------------------------------------------------------------------
BIKB_BACHK      ----------------------------------------------------------------------
GLYA_SYNAS      ----------------------------------------------------------------------
CSD_CHLMU       ----------------------------------------------------------------------
BIKB_BACC0      ----------------------------------------------------------------------
BIKB2_BACAN     ----------------------------------------------------------------------
HIS8_METAC      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSK
DEGT_BACST      KEVDG-RYHVFHQY---TIRAPKRDELQAFLKEQGIATMVYYPLPLHLQPVFASLGYKEGQLPXXXXXXX
DNRJ_STRPE      IAEG--NDHVYYVY---VVRHPERDRILEALTAYDIHLNISYPWPVHTMSGFAHLGYGPGDLPVTERLAG
SPSC_BACSU      VHDDG--RHAWHLYDEKKAGVTRSEMITALKDEYNIGTSVHF-IPVHIHPYYKQFGYKEADFPNAMNYYK
Y1066_METJA     KKHVKHAWHLYPLLINIDRLKINRTKFIEELKKQNIGTSVHF-IPLHLHPFYRTFGYKKGDFPNAEWVYE
ERBS_SACEN      ADS---AWHLF------VLRCENRDHLQRHLTDAGVQTLIHYPTPVHLSPAYADLGLPPGSFPVAESLAG
ARNB_PSEU2      YAQQ-HAWHLFILRIDPERCGLDRDAFMKALQARNIGTGIHF-IATHLHSYYRK-RFPDVRLPDTEWNSS
ARNB_PSEPF      YPQQ-HAWHLFILRIDSERCGMDREAFMKGLQEQGIGTGIHF-IATHLHTWYRQRA-PHLSLPDTEWNSA
ARNB_ENT38      WAHK-HAWHLFIVRVDEATCGISRNGLMDDLKAKGIGTGLHF-RAAHTQKYYRE-RYPALVLPNTEWNSD
ARNB_YERE8      DYAHQHAWHLFMVRVDKERCGIDRDSLMARLKEVGIGSGLHF-RAAHTQKYYRE-RYPSLHLPNTEWNSA
ARNB_SODGM      AWEHHHAWHLFIIRVDERWCGIDRDGLMQALKECGIGTGLHF-RAAHTQRYYRE-RFPDMVLPATEWNSV
ARNB_PROMH      LHAN----HLFMVRVDKNACGIDRDTFMEKLKQKEIGTGLHF-RAAHTQKYYRE-RYPSLSLPQSEWNSA
ARNB_KLEP3      WDHQ-HAWHLFIIRVDEAACGISRDALMEKLKAMGIGTGLHF-RAAHTQKYYRE-RFPEVSLPNTEWNSA
ARNB_KLEP7      WDHQ-HAWHLFIIRVDEAACGISRDALMEKLKAMGIGTGLHF-RAAHTQKYYRE-RFPEVSLPNTEWNSA
ARNB_YERPY      XYSHQHAWHLFMVRVDEERCGISRDQLMACLKDMGIGSGLHF-RAVHSQKYYRE-RYPHLCLPNTEWNSA
ARNB_YERPS      XYSHQHAWHLFMVRVDEERCGISRDQLMACLKDMGIGSGLHF-RAVHSQKYYRE-RYPHLCLPNTEWNSA
ARNB_YERPP      XYSHQHAWHLFMVRVDEERCGISRDQLMACLKDMGIGSGLHF-RAVHSQKYYRE-RYPHLCLPNTEWNSA
ARNB_YERPN      XYSHQHAWHLFMVRVDEERCGISRDQLMACLKDMGIGSGLHF-RAVHSQKYYRE-RYPHLCLPNTEWNSA
ARNB_YERPG      XYSHQHAWHLFMVRVDEERCGISRDQLMACLKDMGIGSGLHF-RAVHSQKYYRE-RYPHLCLPNTEWNSA
ARNB_YERPE      XYSHQHAWHLFMVRVDEERCGISRDQLMACLKDMGIGSGLHF-RAVHSQKYYRE-RYPHLCLPNTEWNSA
ARNB_YERPB      XYSHQHAWHLFMVRVDEERCGISRDQLMACLKDMGIGSGLHF-RAVHSQKYYRE-RYPHLCLPNTEWNSA
ARNB_YERPA      XYSHQHAWHLFMVRVDEERCGISRDQLMACLKDMGIGSGLHF-RAVHSQKYYRE-RYPHLCLPNTEWNSA
ARNB_YERP3      XYSHQHAWHLFMVRVDEERCGISRDQLMACLKDMGIGSGLHF-RAVHSQKYYRE-RYPHLCLPNTEWNSA
ARNB_SERP5      YPH-DHAWHLFMVRVDAERCGIDRDQLMERLKEMGIGTGLHF-RAAHTQKFYRD-RYPQLSLPNTEWNSA
ARNB_ERWT9      WPHQ-HAWHLFILRVDRESCGLSRDELMQQLKEQGIGTGLHF-RAAHTQKYYRD-RFPQLSLPETEWNSE
ARNB_PSEF5      XXXXXHAWHLFILRIDAERCGLDREAFMKGLQEQNIGTGIHF-IATHLHTYYRQ-RFPEVQLPHTEWNSA
ARNB_PHOLL      DYEHIHAHHLFMVRVNKDVCGIDRDTLMERLKNKNIGTGLHF-RAAHTQKYYRD-RYPQLSLPESEWNSV
NTDA_BACSU      LSED----HVWHLFPIKVRTEDRADIMTKLNEDFGVQTDVYYPILSHMQKTLVQDKYAGLQLVHTEKAHS
ARNB_PECCP      LH----AWHLFMVRVDETRCGISRDGLMAALQTHGIGTGLHF-RAVHTQKYYRE-RYPHLHLPETEWNSA
ARNB_ERWCT      LH----AWHLFMVRVDETQCGISRDDLMAALQTHGIGTGLHF-RAVHTQKYYRE-RYPHLHLPETEWNSA
ARNB_PSEAE      XHKQRHAWHLFILRIDAEVCGLGRDAFMEALKARGIGSGIHF-IASHLHHYYRQ-RQPRLSLPNSEWNSA
ARNB_PSEAB      XHKQRHAWHLFILRIDAEACGLGRDAFMEALKARGIGSGIHF-IASHLHHYYRQ-RQPRLSLPNSEWNSA
ARNB_PSEA8      XHKQRHAWHLFILRIDAEACGLGRDAFMEALKARGIGSGIHF-IASHLHHYYRQ-RQPRLSLPNSEWNSA
ARNB_PSEA7      XHAQRHAWHLFILRIDAEACGLGRDAFMEALKARGIGSGIHF-IASHLHHYYRQ-RQPRLSLPNSEWNSA
ARNB_AERHH      XXXHLHTWHLFMVRVDPDRCGLDRDQLMQALQERGIGTGLHF-RAAHTQKYYRE-RYPTLSLPHTEWNSS
ARNB_SALSV      AWEHIHAWHLFIIRVDETRCGITRDALMASLKTKGIGTGLHF-RAAHTQKYYRE-RFPTLTLPDTEWNSE
ARNB_AERS4      TYPHLHAWHLFMVRVDPERCGLDRDQLMQALQERGIGTGLHF-RAAHTQKYYRE-RYPALSLPHTEWNSS
ARNB_SHISS      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_SHIBS      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_ECOSM      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_ECOSE      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_ECO55      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_ECO24      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_ECOLC      XWPHVHAWHLFIIRVDEQRCGISRNALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_SHIFL      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_SHIF8      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_ECOLI      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_ECOHS      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_ECODH      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_ECOBW      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_ECO8A      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_SALTY      SWEHIHAWHLFIIRVDEARCGITRDALMASLKTKGIGTGLHF-RAAHTQKYYRE-RFPTLTLPDTEWNSE
ARNB_SALPK      SWEHIHAWHLFIIRVDEARCGITRDALMASLKTKGIGTGLHF-RAAHTQKYYRE-RFPTLTLPDTEWNSE
ARNB_SALPC      SWEHIHAWHLFIIRVDEARCGITRDALMASLKTKGIGTGLHF-RAAHTQKYYRE-RFPTLTLPDTEWNSE
ARNB_SALPA      SWEHIHAWHLFIIRVDEARCGITRDALMASLKTKGIGTGLHF-RAAHTQKYYRE-RFPTLTLPDTEWNSE
ARNB_SALNS      SWEHIHAWHLFIIRVDEARCGITRDALMASLKTKGIGTGLHF-RAAHTQKYYRE-RFPTLTLPDTEWNSE
ARNB_SALHS      SWEHIHAWHLFIIRVDEARCGITRDALMASLKTKGIGTGLHF-RAAHTQKYYRE-RFPTLTLPDTEWNSE
ARNB_SALDC      SWEHIHAWHLFIIRVDEARCGITRDALMASLKTKGIGTGLHF-RAAHTQKYYRE-RFPTLTLPDTEWNSE
ARNB_SALPB      SWEHIHAWHLFIIRVDEARCGITRDALMASLKTKGIGTGLHF-RAAHTQKYYRE-RFPTLTLPDTEWNSE
ARNB_SALG2      SWEHIHAWHLFIIRVDEARCSITRDALMASLKTKGIGTGLHF-RAAHTQKYYRE-RFPTLTLPDTEWNSE
ARNB_SALEP      SWEHIHAWHLFIIRVDEARCGITRDALMASLKTKGIGTGLHF-RAAHTQKYYRE-RFPTLTLPDTEWNSE
ARNB_SALA4      SWEHIHAWHLFIIRVDEARCGITRDALMASLKTKGIGTGLHF-RAAHTQKYYRE-RFPTLTLPDTEWNSE
ARNB_EDWI9      TPEHQHAWHLFIIRCDEARSGVDRDRLMQALKERNIGSGLHF-RAAHTQKYYRE-SYPQLRLAQTEWNSQ
ARNB_ECOLU      XWPHVHAWHLFIIRVNEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTMSLPNTEWNSE
ARNB_ECOUT      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_ECOL6      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_ECOL5      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_ECOK1      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_ECO7I      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RCPTLSLPNTEWNSE
ARNB_ECO45      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_SHESH      YEHR-HCWHLMIIRVDPLICGLNRDQLIARLKECNIGAGIHFK-ACHTQKYYREFGEITKSLTNTEHNSE
ARNB_ECO5E      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPSLSLPNTEWNSE
ARNB_ECO57      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHF-RAAHTQKYYRE-RFPSLSLPNTEWNSE
ARNB_ECO27      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKEIGIGTGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
ARNB_ESCF3      IHS----WHLFIIRVDEQRCGINRDTLMEALKEKGIGTGLHF-RAAHTQKYYRQ-HFPDLSLPNTEWNSE
ARNB_SALCH      SWEHIHAWHLFIIRVDEARCGITRDALMASLKTKGIGTGLHF-RAAHTQKYYRE-RFPTLTLPDTEWNSE
ARNB_SALTI      PWEHIHAWHLFIIRVDEARCGITRDALMASLKTKGIGTGLHF-RAAHTQKYYRE-RFPTLTLPDTEWNSE
ARNB_ECO81      XWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGAGLHF-RAAHTQKYYRE-RFPTLSLPNTEWNSE
GLADA_STRSD     ----------------------------------------------------------------------
GLDSA_BACCI     ----------------------------------------------------------------------
GLDSA_STRSD     ATSPGTTSRTYYVY--------------------------------------------------------
GLDSA_STRLV     ----------------------------------------------------------------------
GLADA_MICEC     ----------------------------------------------------------------------
EPSN_BACSU      ----------------------------------------------------------------------
RFFA_ECOLI      IPDGCVQN--AHMFYIKLRDIDDRSALINFLKEAEIM-AVFHYIPLHGCPAGEHFGEFHGEDRYTTKESE
GLDSA_STRRY     ----------------------------------------------------------------------
GLDSA_STRRI     TTSDGTTSRTYYTY--------------------------------------------------------
MOSB_RHIME      TRSHVDRTHVWHK---------------------------------------------------------
GLADA_STRKN     ----------------------------------------------------------------------
GLDSA_STRFR     ----------------------------------------------------------------------
GLDSA_STRKN     ----------------------------------------------------------------------
RFBH_SALTY      ----------------------------------------------------------------------
GLSA_STRGR      ----------------------------------------------------------------------
GLDSA_MICEC     ----------------------------------------------------------------------
Y3402_MYCTU     ----------------------------------------------------------------------
Y3436_MYCBO     ----------------------------------------------------------------------
SPSS_METTH      ----------------------------------------------------------------------
HIS8_THEPX      ----------------------------------------------------------------------
HIS8_THEP3      ----------------------------------------------------------------------
CSD_PYRAB       ----------------------------------------------------------------------
HIS8_THETN      ----------------------------------------------------------------------
HIS8_SYNJB      ----------------------------------------------------------------------
GLYA_CALMQ      ----------------------------------------------------------------------
BIKB_BACHK      ----------------------------------------------------------------------
GLYA_SYNAS      ----------------------------------------------------------------------
CSD_CHLMU       ----------------------------------------------------------------------
BIKB_BACC0      ----------------------------------------------------------------------
BIKB2_BACAN     ----------------------------------------------------------------------
HIS8_METAC      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RSLALPMFPELRDDEIKEVVDTIALFL
DEGT_BACST      XXLSLPMFPELKEEQQQYVVEKIAEF-
DNRJ_STRPE      EIFSLPMYPSLRPDAQEKVIDAV----
SPSC_BACSU      RTLSLPLYPSMSDDDVDDVIEAV----
Y1066_METJA     REISLPIYPKMTDDDVIDVVNAV----
ERBS_SACEN      EVLSLPIGPHLSREAADHVIATL----
ARNB_PSEU2      RLCSIPLFPDMSLDDVERVVGAI----
ARNB_PSEPF      RLCSIPLFPDMTDQDLDRVVGAI----
ARNB_ENT38      RICSIPLFPTMTDDDVTRVI-------
ARNB_YERE8      RLCTLPLFPDMLDSDVDRVVDALATII
ARNB_SODGM      RMCSLPLFPSMNDDDVERVITAL----
ARNB_PROMH      TLCSLPLFPDMSNKDVIRVVDAI----
ARNB_KLEP3      RICSLPLFPDMTDDDVTRVISAL----
ARNB_KLEP7      RICSLPLFPDMTDDDVTRVISAL----
ARNB_YERPY      RLCTLPLFPDMLDSDIERVANALTTII
ARNB_YERPS      RLCTLPLFPDMLDSDIERVANALTTII
ARNB_YERPP      RLCTLPLFPDMLDSDIERVANALTTII
ARNB_YERPN      RLCTLPLFPDMLDSDIERVANALTTII
ARNB_YERPG      RLCTLPLFPDMLDSDIERVANALTTII
ARNB_YERPE      RLCTLPLFPDMLDSDIERVANALTTII
ARNB_YERPB      RLCTLPLFPDMLDSDIERVANALTTII
ARNB_YERPA      RLCTLPLFPDMLDSDIERVANALTTII
ARNB_YERP3      RLCTLPLFPDMLDSDIERVANALTTII
ARNB_SERP5      RLCTLPLFPDMTDADVDRVV-------
ARNB_ERWT9      RICSIPLFPGMSDGDCDRVI-------
ARNB_PSEF5      RLCSIPLFPDMTLDDVERVTGAIANLL
ARNB_PHOLL      TLCSLPLFP------------------
NTDA_BACSU      QVLHLPLYPSFTLEEQDRVME------
ARNB_PECCP      SLMTLPLFPDMQDSDVDRVVVALTSIL
ARNB_ERWCT      SLMTLPLFPDMQDSDVDRVVAALTSIL
ARNB_PSEAE      RLCSIPLFPDMRDDDIERVARAI----
ARNB_PSEAB      RLCSIPLFPDMRDDDIERVARAI----
ARNB_PSEA8      RLCSIPLFPDMRDDDIERVARAI----
ARNB_PSEA7      RLCSIPLFPDMRDDDIERVARAI----
ARNB_AERHH      RLCTLPLFPDMTLADVDRVV-------
ARNB_SALSV      RICSLPLFPDMTESDFDRVITAL----
ARNB_AERS4      RLCTLPLFPDMTLADVDRVV-------
ARNB_SHISS      RICSLPLFPDMTTADADRVITAL----
ARNB_SHIBS      RICSLPLFPDMTTADADRVITAL----
ARNB_ECOSM      RICSLPLFPDMTTADADRVITAL----
ARNB_ECOSE      RICSLPLFPDMTTADADRVITAL----
ARNB_ECO55      RICSLPLFPDMTTADADRVITAL----
ARNB_ECO24      RICSLPLFPDMTTADADRVITAL----
ARNB_ECOLC      RICSLPLFPDMTTADADRVITAL----
ARNB_SHIFL      RICSLPLFPDMTTADADRVITAL----
ARNB_SHIF8      RICSLPLFPDMTTADADRVITAL----
ARNB_ECOLI      RICSLPLFPDMTTADADHVITAL----
ARNB_ECOHS      RICSLPLFPDMTTADADHVITAL----
ARNB_ECODH      RICSLPLFPDMTTADADHVITAL----
ARNB_ECOBW      RICSLPLFPDMTTADADHVITAL----
ARNB_ECO8A      RICSLPLFPDMTTADADRVITAL----
ARNB_SALTY      RICSLPLFPDMTESDFDRVITAL----
ARNB_SALPK      RICSLPLFPDMTESDFDRVITAL----
ARNB_SALPC      RICSLPLFPDMTESDFDRVITAL----
ARNB_SALPA      RICSLPLFPDMTESDFDRVITAL----
ARNB_SALNS      RICSLPLFPDMTESDFDRVITAL----
ARNB_SALHS      RICSLPLFPDMTESDFDRVITAL----
ARNB_SALDC      RICSLPLFPDMTESDFDRVITAL----
ARNB_SALPB      RICSLPLFPDMTESDFDRVITAL----
ARNB_SALG2      RICSLPLFPDMTESDFDRVITAL----
ARNB_SALEP      RICSLPLFPDMTESDFDRVITAL----
ARNB_SALA4      RICSLPLFPDMTESDFDRVITAL----
ARNB_EDWI9      RICSLPLFPDMTEADVDRVI-------
ARNB_ECOLU      RICSLPLFPDMTTADADRVITAL----
ARNB_ECOUT      RICSLPLFPDMTTADADRVITAL----
ARNB_ECOL6      RICSLPLFPDMTTADADRVITAL----
ARNB_ECOL5      RICSLPLFPDMTTADADRVITAL----
ARNB_ECOK1      RICSLPLFPDMTTADADRVITAL----
ARNB_ECO7I      RICSLPLFPDMTTADADRVITAL----
ARNB_ECO45      RICSLPLFPDMTTADADRVITAL----
ARNB_SHESH      QICSLPLFPDMNFSDVERVVAAIS---
ARNB_ECO5E      RICSLPLFPDMTTADADRVITAL----
ARNB_ECO57      RICSLPLFPDMTTADADRVITAL----
ARNB_ECO27      RICSLPLFPDMTTADADRVITAL----
ARNB_ESCF3      RICSLPLFPDMTNADAERVITAL----
ARNB_SALCH      RICSLPLFPDMTESDFDRVITAL----
ARNB_SALTI      RICSLPLFPDMTESDFDRVITAL----
ARNB_ECO81      RICSLPLFPDMTTADADRVITAL----
GLADA_STRSD     ---------------------------
GLDSA_BACCI     ---------------------------
GLDSA_STRSD     ---------------------------
GLDSA_STRLV     ---------------------------
GLADA_MICEC     ---------------------------
EPSN_BACSU      ---------------------------
RFFA_ECOLI      RLLRLPLFYNLSPVNQRTVIATL----
GLDSA_STRRY     ---------------------------
GLDSA_STRRI     ---------------------------
MOSB_RHIME      ---------------------------
GLADA_STRKN     ---------------------------
GLDSA_STRFR     ---------------------------
GLDSA_STRKN     ---------------------------
RFBH_SALTY      ---------------------------
GLSA_STRGR      ---------------------------
GLDSA_MICEC     ---------------------------
Y3402_MYCTU     ---------------------------
Y3436_MYCBO     ---------------------------
SPSS_METTH      ---------------------------
HIS8_THEPX      ---------------------------
HIS8_THEP3      ---------------------------
CSD_PYRAB       ---------------------------
HIS8_THETN      ---------------------------
HIS8_SYNJB      ---------------------------
GLYA_CALMQ      ---------------------------
BIKB_BACHK      ---------------------------
GLYA_SYNAS      ---------------------------
CSD_CHLMU       ---------------------------
BIKB_BACC0      ---------------------------
BIKB2_BACAN     ---------------------------
HIS8_METAC      ---------------------------