[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tmar0:AAD35944.1

[Show Plain Result]


## Summary of Sequence Search
    1::355
    2::353     2e-87  46%  355 aa  STRD_STRGR RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    2::237     8e-46  40%  289 aa  RMLA_STRMU RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    3::240     1e-45  39%  293 aa  RMLA1_ECOLI RecName: Full=Glucose-1-phosphate thymidylyltransferase
    4::240     2e-45  38%  292 aa  RMLA_SALAN RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    4::240     4e-45  38%  292 aa  RMLA1_SHIFL RecName: Full=Glucose-1-phosphate thymidylyltransferase
    4::240     5e-45  38%  292 aa  RMLA_SALTY RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    2::235     6e-44  34%  246 aa  SPSI_BACSU RecName: Full=Spore coat polysaccharide biosynthesis
    4::241     8e-44  38%  293 aa  RMLA3_ECOLX RecName: Full=Glucose-1-phosphate
    2::233     4e-43  38%  288 aa  RMLA_NEIMB RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    3::318     4e-43  40%  411 aa  GLMU_METM7 RecName: Full=Bifunctional protein glmU;Includes:
    3::318     5e-43  41%  411 aa  GLMU_METM5 RecName: Full=Bifunctional protein glmU;Includes:
    2::233     1e-42  38%  288 aa  RMLA_NEIMA RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    3::317     3e-42  37%  408 aa  GLMU_METJA RecName: Full=Bifunctional protein glmU;Includes:
    3::323     5e-42  37%  411 aa  GLMU_META3 RecName: Full=Bifunctional protein glmU;Includes:
    2::233     1e-40  37%  288 aa  RMLA_NEIGO RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    2::234     2e-40  38%  293 aa  RMLA2_SHIFL RecName: Full=Glucose-1-phosphate thymidylyltransferase
    2::234     2e-40  38%  293 aa  RMLA2_ECOLI RecName: Full=Glucose-1-phosphate thymidylyltransferase
    2::234     9e-40  37%  289 aa  RMLA_YEREN RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    2::233     1e-39  35%  286 aa  RMLA_RHISN RecName: Full=Probable glucose-1-phosphate
    3::322     2e-39  37%  414 aa  GLMU_METVS RecName: Full=Bifunctional protein glmU;Includes:
    4::236     7e-39  38%  295 aa  RMLA_XANCP RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    4::236     7e-39  38%  295 aa  RMLA_XANCB RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    3::360     6e-38  38%  411 aa  GLMU_METMP RecName: Full=Bifunctional protein glmU;Includes:
    2::232     1e-33  32%  303 aa  ACBA_ACTS5 RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    1::329     4e-32  30%  359 aa  MPG1_SULAC RecName: Full=Putative mannose-1-phosphate
    2::314     9e-32  31%  364 aa  GMPPB_CAEBR RecName: Full=Mannose-1-phosphate guanyltransferase
    2::315     7e-31  30%  365 aa  GMPPB_CAEEL RecName: Full=Mannose-1-phosphate guanyltransferase
    2::282     4e-30  34%  360 aa  GMPPB_MOUSE RecName: Full=Mannose-1-phosphate guanyltransferase
    2::282     6e-30  33%  360 aa  GMPPB_DANRE RecName: Full=Mannose-1-phosphate guanyltransferase
    2::282     1e-29  33%  360 aa  GMPPB_HUMAN RecName: Full=Mannose-1-phosphate guanyltransferase
    2::343     2e-29  29%  360 aa  GMPPB_PIG RecName: Full=Mannose-1-phosphate guanyltransferase beta;
    4::257     3e-28  40%  289 aa  GTAB2_STAS1 RecName: Full=UTP--glucose-1-phosphate
    2::282     6e-28  33%  360 aa  GMPPB_BOVIN RecName: Full=Mannose-1-phosphate guanyltransferase
    8::366     2e-27  32%  386 aa  GLGC_CLOBB RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::366     2e-27  32%  386 aa  GLGC_CLOBA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   14::320     3e-27  29%  371 aa  GMPPB_DROPS RecName: Full=Mannose-1-phosphate guanyltransferase
    2::357     4e-27  29%  364 aa  MPG1_CRYNE RecName: Full=Mannose-1-phosphate guanyltransferase;    
    4::257     4e-27  38%  292 aa  GTAB_BACSU RecName: Full=UTP--glucose-1-phosphate
    3::236     4e-27  39%  287 aa  GTAB1_STAS1 RecName: Full=UTP--glucose-1-phosphate
    2::339     4e-27  30%  359 aa  GMPPB_DICDI RecName: Full=Mannose-1-phosphate guanyltransferase
    2::264     8e-27  37%  283 aa  Y1334_METJA RecName: Full=Putative UTP--glucose-1-phosphate
    4::235     2e-26  38%  288 aa  GTAB_STAHJ RecName: Full=UTP--glucose-1-phosphate
    2::341     3e-26  29%  361 aa  MPG11_CANGA RecName: Full=Mannose-1-phosphate guanyltransferase 1; 
    2::314     4e-26  31%  360 aa  GMPBB_XENLA RecName: Full=Mannose-1-phosphate guanyltransferase
    2::264     5e-26  37%  279 aa  GALU_PSEAE RecName: Full=UTP--glucose-1-phosphate
    9::371     7e-26  31%  376 aa  GLGC_BACAH RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   13::257     9e-26  38%  288 aa  GTAB_STAES RecName: Full=UTP--glucose-1-phosphate
   13::257     9e-26  38%  288 aa  GTAB_STAEQ RecName: Full=UTP--glucose-1-phosphate
    2::314     9e-26  32%  360 aa  GMPBA_XENLA RecName: Full=Mannose-1-phosphate guanyltransferase
    2::314     1e-25  31%  360 aa  GMPPB_XENTR RecName: Full=Mannose-1-phosphate guanyltransferase
    4::241     1e-25  35%  306 aa  CAP3C_STRPN RecName: Full=UTP--glucose-1-phosphate
    2::334     2e-25  29%  361 aa  MPG1_YEAST RecName: Full=Mannose-1-phosphate guanyltransferase;    
    9::371     2e-25  30%  376 aa  GLGC_BACHK RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::371     2e-25  30%  376 aa  GLGC_BACCZ RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::371     2e-25  30%  376 aa  GLGC_BACAN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    2::343     3e-25  29%  361 aa  MPG12_CANGA RecName: Full=Mannose-1-phosphate guanyltransferase 2; 
    9::371     3e-25  30%  376 aa  GLGC_BACCR RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   12::318     5e-25  28%  369 aa  GMPPB_DROME RecName: Full=Mannose-1-phosphate guanyltransferase
    9::371     5e-25  30%  376 aa  GLGC_BACCQ RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    2::293     6e-25  30%  364 aa  MPG1_GIBZE RecName: Full=Mannose-1-phosphate guanyltransferase;    
    8::375     6e-25  30%  382 aa  GLGC_CLONN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::360     8e-25  32%  386 aa  GLGC_CLOB8 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::371     8e-25  30%  376 aa  GLGC_BACC1 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    2::341     2e-24  27%  361 aa  MPG1_ASHGO RecName: Full=Mannose-1-phosphate guanyltransferase;    
    4::268     4e-24  30%  291 aa  GALU_MYCPN RecName: Full=UTP--glucose-1-phosphate
    8::382     7e-24  29%  388 aa  GLGC_CLOPS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    2::264     1e-23  39%  279 aa  GALU2_PSEAE RecName: Full=UTP--glucose-1-phosphate
    2::259     1e-23  35%  272 aa  YTDA_BACSU RecName: Full=Putative UTP--glucose-1-phosphate
   13::257     1e-23  36%  288 aa  GTAB_STAAB RecName: Full=UTP--glucose-1-phosphate
   13::257     2e-23  36%  288 aa  GTAB_STAAR RecName: Full=UTP--glucose-1-phosphate
   13::257     3e-23  36%  288 aa  GTAB_STAAW RecName: Full=UTP--glucose-1-phosphate
   13::257     3e-23  36%  288 aa  GTAB_STAAS RecName: Full=UTP--glucose-1-phosphate
   13::257     3e-23  36%  288 aa  GTAB_STAAN RecName: Full=UTP--glucose-1-phosphate
   13::257     3e-23  36%  288 aa  GTAB_STAAM RecName: Full=UTP--glucose-1-phosphate
   13::257     3e-23  36%  288 aa  GTAB_STAAC RecName: Full=UTP--glucose-1-phosphate
   13::257     3e-23  36%  288 aa  GTAB_STAA8 RecName: Full=UTP--glucose-1-phosphate
   13::257     3e-23  36%  288 aa  GTAB_STAA3 RecName: Full=UTP--glucose-1-phosphate
    7::319     3e-23  33%  379 aa  GLGC_STRA3 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   13::387     3e-23  30%  393 aa  GLGC_CLOPE RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::352     3e-23  29%  380 aa  GLGC_STRSV RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::371     3e-23  29%  376 aa  GLGC_BACCN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    2::334     4e-23  26%  361 aa  MPG1_KLULA RecName: Full=Mannose-1-phosphate guanyltransferase;    
    4::241     4e-23  35%  304 aa  HASC_STRPY RecName: Full=UTP--glucose-1-phosphate
    4::241     4e-23  35%  304 aa  HASC1_STRP8 RecName: Full=UTP--glucose-1-phosphate
    8::340     4e-23  30%  381 aa  GLGC_MYCMO RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    4::241     6e-23  35%  299 aa  HASC2_STRP8 RecName: Full=UTP--glucose-1-phosphate
    4::241     6e-23  35%  304 aa  HASC2_STRP6 RecName: Full=UTP--glucose-1-phosphate
    4::241     6e-23  35%  299 aa  HASC2_STRP3 RecName: Full=UTP--glucose-1-phosphate
    4::241     6e-23  35%  299 aa  HASC2_STRP1 RecName: Full=UTP--glucose-1-phosphate
    4::241     6e-23  35%  299 aa  HASC1_STRP6 RecName: Full=UTP--glucose-1-phosphate
    4::241     6e-23  35%  304 aa  HASC1_STRP3 RecName: Full=UTP--glucose-1-phosphate
    5::242     6e-23  35%  299 aa  CAP4C_STRPN RecName: Full=UTP--glucose-1-phosphate
    7::319     7e-23  32%  379 aa  GLGC_STRU0 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::319     1e-22  32%  379 aa  GLGC_STRA5 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::319     1e-22  32%  379 aa  GLGC_STRA1 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::275     1e-22  35%  302 aa  GALU_SHIFL RecName: Full=UTP--glucose-1-phosphate
    8::275     1e-22  35%  302 aa  GALU_ECOLI RecName: Full=UTP--glucose-1-phosphate
    8::275     1e-22  35%  302 aa  GALU_ECOL6 RecName: Full=UTP--glucose-1-phosphate
    8::275     1e-22  35%  302 aa  GALU_ECO57 RecName: Full=UTP--glucose-1-phosphate
    4::241     1e-22  35%  304 aa  HASC1_STRP1 RecName: Full=UTP--glucose-1-phosphate
    8::379     1e-22  31%  380 aa  GLGC_LACCB RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::379     1e-22  31%  380 aa  GLGC_LACC3 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    2::337     2e-22  26%  364 aa  MPG1_PICAN RecName: Full=Mannose-1-phosphate guanyltransferase;    
    7::352     2e-22  29%  380 aa  GLGC_STRP4 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::359     2e-22  29%  398 aa  GLGC_DESHY RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::342     3e-22  29%  380 aa  GLGC_STRGC RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::371     3e-22  29%  376 aa  GLGC_BACWK RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    2::303     4e-22  28%  364 aa  MPG1_NEUCR RecName: Full=Mannose-1-phosphate guanyltransferase;    
    6::326     4e-22  31%  458 aa  GLMU_ENTFA RecName: Full=Bifunctional protein glmU;Includes:
    7::352     4e-22  28%  380 aa  GLGC_STRZT RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::352     4e-22  28%  380 aa  GLGC_STRZP RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::352     4e-22  28%  380 aa  GLGC_STRZJ RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::352     4e-22  28%  380 aa  GLGC_STRPN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::352     4e-22  28%  380 aa  GLGC_STRPJ RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::352     4e-22  28%  380 aa  GLGC_STRPI RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::352     5e-22  28%  380 aa  GLGC_STRR6 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::352     5e-22  28%  380 aa  GLGC_STRPS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::352     5e-22  28%  380 aa  GLGC_STRP7 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::352     5e-22  28%  380 aa  GLGC_STRP2 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::359     5e-22  29%  398 aa  GLGC_DESHD RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::346     5e-22  33%  379 aa  GLGC_BACLD RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::352     8e-22  27%  379 aa  GLGC_STRMU RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::268     8e-22  32%  292 aa  GALU_MYCGE RecName: Full=UTP--glucose-1-phosphate
    2::269     1e-21  36%  295 aa  GALU_HAEDU RecName: Full=UTP--glucose-1-phosphate
    2::269     1e-21  37%  295 aa  GALU_HAEIN RecName: Full=UTP--glucose-1-phosphate
    2::369     2e-21  33%  464 aa  GLMU_AQUAE RecName: Full=Bifunctional protein glmU;Includes:
    7::352     2e-21  30%  379 aa  GLGC_STRS7 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::344     2e-21  33%  461 aa  GLMU_CLOTH RecName: Full=Bifunctional protein glmU;Includes:
    6::344     2e-21  28%  454 aa  GLMU_BACSK RecName: Full=Bifunctional protein glmU;Includes:
    6::396     3e-21  31%  412 aa  GLGC_THEAB RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::398     3e-21  30%  415 aa  GLGC_FERNB RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::377     3e-21  30%  380 aa  GLGC_CLOAB RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::352     9e-21  28%  380 aa  GLGC_LACLM RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::354     1e-20  30%  456 aa  GLMU_BACLD RecName: Full=Bifunctional protein glmU;Includes:
    8::365     1e-20  26%  379 aa  GLGC_LACPL RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::351     2e-20  30%  423 aa  GLGC_EUBE2 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    3::320     2e-20  27%  451 aa  GLMU_STAES RecName: Full=Bifunctional protein glmU;Includes:
    3::320     2e-20  27%  451 aa  GLMU_STAEQ RecName: Full=Bifunctional protein glmU;Includes:
    3::320     2e-20  27%  451 aa  GLMU_STAEP RecName: Full=Bifunctional protein glmU;Includes:
    6::403     2e-20  31%  423 aa  GLGC_THENN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    4::323     3e-20  31%  462 aa  GLMU_LACSS RecName: Full=Bifunctional protein glmU;Includes:
    6::379     3e-20  29%  420 aa  GLGC_THELT RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    3::343     3e-20  29%  459 aa  GLMU_LACAC RecName: Full=Bifunctional protein glmU;Includes:
    6::353     3e-20  31%  459 aa  GLMU_GEOSW RecName: Full=Bifunctional protein glmU;Includes:
   10::383     3e-20  26%  384 aa  GLGC_FUSNN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::323     4e-20  29%  381 aa  GLGC_LACAC RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::312     6e-20  30%  457 aa  GLMU_CLOB6 RecName: Full=Bifunctional protein glmU;Includes:
    6::326     6e-20  29%  455 aa  GLMU_BACHD RecName: Full=Bifunctional protein glmU;Includes:
    6::354     8e-20  29%  456 aa  GLMU_BACA2 RecName: Full=Bifunctional protein glmU;Includes:
    6::394     8e-20  30%  423 aa  GLGC_THEP1 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    3::316     1e-19  32%  450 aa  GLMU_STAAW RecName: Full=Bifunctional protein glmU;Includes:
    3::316     1e-19  32%  450 aa  GLMU_STAAS RecName: Full=Bifunctional protein glmU;Includes:
    3::316     1e-19  32%  450 aa  GLMU_STAAR RecName: Full=Bifunctional protein glmU;Includes:
    3::316     1e-19  32%  450 aa  GLMU_STAAC RecName: Full=Bifunctional protein glmU;Includes:
    3::316     1e-19  32%  450 aa  GLMU_STAA3 RecName: Full=Bifunctional protein glmU;Includes:
    6::326     1e-19  29%  457 aa  GLMU_LISMH RecName: Full=Bifunctional protein glmU;Includes:
    6::344     1e-19  29%  456 aa  GLMU_BACSU RecName: Full=Bifunctional protein glmU;Includes:
    8::352     1e-19  27%  380 aa  GLGC_LACLS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    3::316     1e-19  32%  450 aa  GLMU_STAA8 RecName: Full=Bifunctional protein glmU;Includes:
    6::326     1e-19  29%  457 aa  GLMU_LISMC RecName: Full=Bifunctional protein glmU;Includes:
    5::316     1e-19  29%  449 aa  GLMU_EXIS2 RecName: Full=Bifunctional protein glmU;Includes:
    5::316     1e-19  32%  456 aa  GLMU_CLOK5 RecName: Full=Bifunctional protein glmU;Includes:
    5::316     1e-19  32%  456 aa  GLMU_CLOK1 RecName: Full=Bifunctional protein glmU;Includes:
    6::394     1e-19  29%  423 aa  GLGC_THESQ RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::352     1e-19  28%  380 aa  GLGC_LACLA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::326     2e-19  29%  457 aa  GLMU_LISW6 RecName: Full=Bifunctional protein glmU;Includes:
    6::326     2e-19  29%  457 aa  GLMU_LISMF RecName: Full=Bifunctional protein glmU;Includes:
    3::315     2e-19  30%  455 aa  GLMU_CLOBB RecName: Full=Bifunctional protein glmU;Includes:
    6::317     2e-19  31%  461 aa  GLMU_BREBN RecName: Full=Bifunctional protein glmU;Includes:
    8::360     2e-19  29%  386 aa  GLGC_EXIS2 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    2::329     2e-19  26%  362 aa  MPG1_CANAL RecName: Full=Mannose-1-phosphate guanyltransferase;    
    3::316     2e-19  31%  450 aa  GLMU_STAAN RecName: Full=Bifunctional protein glmU;Includes:
    3::316     2e-19  31%  450 aa  GLMU_STAAM RecName: Full=Bifunctional protein glmU;Includes:
    6::326     2e-19  28%  457 aa  GLMU_LISMO RecName: Full=Bifunctional protein glmU;Includes:
    5::361     2e-19  29%  466 aa  GLMU_DESAP RecName: Full=Bifunctional protein glmU;Includes:
    3::316     3e-19  32%  450 aa  GLMU_STAAB RecName: Full=Bifunctional protein glmU;Includes:
    3::343     3e-19  27%  461 aa  GLMU_LACJO RecName: Full=Bifunctional protein glmU;Includes:
    5::352     3e-19  30%  458 aa  GLMU_GEOKA RecName: Full=Bifunctional protein glmU;Includes:
    1::305     4e-19  26%  351 aa  MPG1_EMENI RecName: Full=Mannose-1-phosphate guanyltransferase;    
    3::343     4e-19  28%  451 aa  GLMU_STAHJ RecName: Full=Bifunctional protein glmU;Includes:
    6::326     4e-19  28%  457 aa  GLMU_LISIN RecName: Full=Bifunctional protein glmU;Includes:
    6::394     4e-19  29%  423 aa  GLGC_THEMA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    1::364     4e-19  30%  380 aa  GLGC_BACSU RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::344     5e-19  28%  459 aa  GLMU_BACHK RecName: Full=Bifunctional protein glmU;Includes:
    5::316     6e-19  31%  457 aa  GLMU_CLOBM RecName: Full=Bifunctional protein glmU;Includes:
    3::315     6e-19  30%  455 aa  GLMU_CLOBA RecName: Full=Bifunctional protein glmU;Includes:
    6::344     6e-19  28%  459 aa  GLMU_BACCN RecName: Full=Bifunctional protein glmU;Includes:
    6::379     6e-19  30%  412 aa  GLGC_THEM4 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::341     6e-19  27%  380 aa  GLGC_LACS1 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::356     6e-19  26%  399 aa  GLGC_DESRM RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    4::317     8e-19  30%  469 aa  GLMU_LACS1 RecName: Full=Bifunctional protein glmU;Includes:
    3::343     8e-19  27%  461 aa  GLMU_LACGA RecName: Full=Bifunctional protein glmU;Includes:
    6::344     8e-19  28%  459 aa  GLMU_BACWK RecName: Full=Bifunctional protein glmU;Includes:
    5::312     1e-18  30%  457 aa  GLMU_CLOBK RecName: Full=Bifunctional protein glmU;Includes:
    6::344     1e-18  28%  459 aa  GLMU_BACCR RecName: Full=Bifunctional protein glmU;Includes:
    6::344     1e-18  28%  459 aa  GLMU_BACCQ RecName: Full=Bifunctional protein glmU;Includes:
    6::344     1e-18  28%  459 aa  GLMU_BACC7 RecName: Full=Bifunctional protein glmU;Includes:
    6::344     1e-18  28%  459 aa  GLMU_BACC4 RecName: Full=Bifunctional protein glmU;Includes:
    6::344     1e-18  28%  459 aa  GLMU_BACC2 RecName: Full=Bifunctional protein glmU;Includes:
    6::344     1e-18  28%  459 aa  GLMU_BACC1 RecName: Full=Bifunctional protein glmU;Includes:
    1::352     1e-18  34%  387 aa  GLGC_GEOTN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::375     1e-18  27%  383 aa  GLGC_CLOK5 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    4::323     1e-18  31%  459 aa  GLMU_LACBA RecName: Full=Bifunctional protein glmU;Includes:
    2::329     2e-18  27%  363 aa  MPG1_SCHPO RecName: Full=Mannose-1-phosphate guanyltransferase;    
    2::332     2e-18  31%  445 aa  GLMU_THESQ RecName: Full=Bifunctional protein glmU;Includes:
    2::332     2e-18  32%  445 aa  GLMU_THEP1 RecName: Full=Bifunctional protein glmU;Includes:
    5::312     2e-18  30%  457 aa  GLMU_CLOBH RecName: Full=Bifunctional protein glmU;Includes:
    5::312     2e-18  30%  457 aa  GLMU_CLOB1 RecName: Full=Bifunctional protein glmU;Includes:
    6::344     2e-18  28%  459 aa  GLMU_BACCZ RecName: Full=Bifunctional protein glmU;Includes:
    6::344     2e-18  28%  459 aa  GLMU_BACC3 RecName: Full=Bifunctional protein glmU;Includes:
    6::344     2e-18  28%  459 aa  GLMU_BACC0 RecName: Full=Bifunctional protein glmU;Includes:
    6::344     2e-18  28%  459 aa  GLMU_BACAN RecName: Full=Bifunctional protein glmU;Includes:
    6::344     2e-18  28%  459 aa  GLMU_BACAH RecName: Full=Bifunctional protein glmU;Includes:
    6::344     2e-18  28%  459 aa  GLMU_BACAC RecName: Full=Bifunctional protein glmU;Includes:
    6::344     2e-18  28%  459 aa  GLMU_BACAA RecName: Full=Bifunctional protein glmU;Includes:
    5::312     2e-18  30%  457 aa  GLMU_CLOBJ RecName: Full=Bifunctional protein glmU;Includes:
    8::353     2e-18  28%  426 aa  GLGC_CLOTH RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    1::352     2e-18  34%  387 aa  GLGC_BACST RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    3::325     3e-18  30%  467 aa  GLMU_PEDPA RecName: Full=Bifunctional protein glmU;Includes:
    6::353     3e-18  30%  459 aa  GLMU_GEOTN RecName: Full=Bifunctional protein glmU;Includes:
    3::315     3e-18  30%  454 aa  GLMU_CLOPE RecName: Full=Bifunctional protein glmU;Includes:
    7::269     3e-18  28%  301 aa  EXON_RHIME RecName: Full=UTP--glucose-1-phosphate
    7::352     4e-18  27%  428 aa  GLGC_THERP RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::352     5e-18  28%  458 aa  GLMU_STRU0 RecName: Full=Bifunctional protein glmU;Includes:
    4::340     7e-18  28%  452 aa  GLMU_THEYD RecName: Full=Bifunctional protein glmU;Includes:
    3::314     7e-18  32%  458 aa  GLMU_LACLA RecName: Full=Bifunctional protein glmU;Includes:
    5::312     7e-18  29%  457 aa  GLMU_CLOBL RecName: Full=Bifunctional protein glmU;Includes:
    2::343     9e-18  24%  363 aa  MPG1_YARLI RecName: Full=Mannose-1-phosphate guanyltransferase;    
    4::378     9e-18  31%  455 aa  GLMU_LACRJ RecName: Full=Bifunctional protein glmU;Includes:
    4::378     9e-18  31%  455 aa  GLMU_LACRD RecName: Full=Bifunctional protein glmU;Includes:
    3::315     9e-18  30%  454 aa  GLMU_CLOPS RecName: Full=Bifunctional protein glmU;Includes:
    3::315     9e-18  30%  454 aa  GLMU_CLOP1 RecName: Full=Bifunctional protein glmU;Includes:
    3::316     9e-18  31%  456 aa  GLMU_CLONN RecName: Full=Bifunctional protein glmU;Includes:
    3::314     1e-17  31%  458 aa  GLMU_LACLM RecName: Full=Bifunctional protein glmU;Includes:
    4::315     1e-17  30%  459 aa  GLMU_CLOD6 RecName: Full=Bifunctional protein glmU;Includes:
    5::353     2e-17  30%  459 aa  GLMU_STRA5 RecName: Full=Bifunctional protein glmU;Includes:
    5::353     2e-17  30%  459 aa  GLMU_STRA1 RecName: Full=Bifunctional protein glmU;Includes:
    3::343     2e-17  27%  461 aa  GLMU_LACH4 RecName: Full=Bifunctional protein glmU;Includes:
    5::353     3e-17  30%  459 aa  GLMU_STRA3 RecName: Full=Bifunctional protein glmU;Includes:
    2::332     4e-17  30%  445 aa  GLMU_THEMA RecName: Full=Bifunctional protein glmU;Includes:
    3::325     4e-17  28%  461 aa  GLMU_LACDB RecName: Full=Bifunctional protein glmU;Includes:
    7::373     4e-17  27%  385 aa  GLGC_OCEIH RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    1::246     5e-17  32%  250 aa  GLGC_BACCL RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    3::343     6e-17  27%  451 aa  GLMU_STAS1 RecName: Full=Bifunctional protein glmU;Includes:
    3::314     6e-17  30%  458 aa  GLMU_LACLS RecName: Full=Bifunctional protein glmU;Includes:
    1::307     1e-16  31%  386 aa  GLGC_CLOD6 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::274     1e-16  31%  298 aa  GALF_KLEPN RecName: Full=UTP--glucose-1-phosphate
    2::355     1e-16  23%  362 aa  MPG1_DEBHA RecName: Full=Mannose-1-phosphate guanyltransferase;    
    5::316     1e-16  30%  451 aa  GLMU_EXISA RecName: Full=Bifunctional protein glmU;Includes:
    1::345     1e-16  31%  429 aa  GLGC_ANAVT RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    3::324     2e-16  29%  455 aa  GLMU_CLOB8 RecName: Full=Bifunctional protein glmU;Includes:
    5::256     2e-16  29%  284 aa  CELA_ACEXY RecName: Full=UTP--glucose-1-phosphate
   33::431     2e-16  29%  440 aa  GLGC_DECAR RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    3::325     3e-16  28%  461 aa  GLMU_LACDA RecName: Full=Bifunctional protein glmU;Includes:
    2::350     3e-16  31%  461 aa  GLMU_HYDS0 RecName: Full=Bifunctional protein glmU;Includes:
   16::355     4e-16  28%  439 aa  GLGC_SYNY3 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::336     4e-16  28%  426 aa  GLGC_CLOCE RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    1::345     4e-16  31%  429 aa  GLGC_ANASP RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::352     5e-16  26%  460 aa  GLMU_STRSZ RecName: Full=Bifunctional protein glmU;Includes:
    1::341     5e-16  27%  383 aa  GLGC_BACHD RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::323     7e-16  29%  453 aa  GLMU_PSEA6 RecName: Full=Bifunctional protein glmU;Includes:
    5::272     7e-16  29%  297 aa  GALF_ECOLI RecName: Full=UTP--glucose-1-phosphate
    5::272     7e-16  29%  297 aa  GALF_ECO57 RecName: Full=UTP--glucose-1-phosphate
    6::308     9e-16  30%  457 aa  GLMU_THETN RecName: Full=Bifunctional protein glmU;Includes:
   10::330     9e-16  24%  339 aa  GLMU_DESPS RecName: Full=Bifunctional protein glmU;Includes:
   81::420     9e-16  30%  508 aa  GLGS1_VICFA RecName: Full=Glucose-1-phosphate adenylyltransferase
    4::315     1e-15  29%  456 aa  GLMU_ALKMQ RecName: Full=Bifunctional protein glmU;Includes:
    5::272     1e-15  29%  297 aa  GALF_SHIFL RecName: Full=UTP--glucose-1-phosphate
    2::344     1e-15  22%  364 aa  MPG1_ASPOR RecName: Full=Mannose-1-phosphate guanyltransferase;    
    6::311     1e-15  31%  455 aa  GLMU_SHESH RecName: Full=Bifunctional protein glmU;Includes:
    2::344     2e-15  23%  364 aa  MPG1_ASPFU RecName: Full=Mannose-1-phosphate guanyltransferase;    
    6::344     2e-15  27%  460 aa  GLMU_STRSY RecName: Full=Bifunctional protein glmU;Includes:
    6::344     2e-15  27%  460 aa  GLMU_STRS2 RecName: Full=Bifunctional protein glmU;Includes:
    2::332     2e-15  30%  452 aa  GLMU_FERNB RecName: Full=Bifunctional protein glmU;Includes:
    5::316     3e-15  27%  454 aa  GLMU_STACT RecName: Full=Bifunctional protein glmU;Includes:
    4::313     3e-15  29%  455 aa  GLMU_LACF3 RecName: Full=Bifunctional protein glmU;Includes:
   87::426     3e-15  29%  514 aa  GLGS_ORYSJ RecName: Full=Glucose-1-phosphate adenylyltransferase
   86::425     3e-15  29%  513 aa  GLGS_HORVU RecName: Full=Glucose-1-phosphate adenylyltransferase
   93::432     3e-15  29%  520 aa  GLGS_BRANA RecName: Full=Glucose-1-phosphate adenylyltransferase
    2::335     3e-15  28%  450 aa  GLMU_THELT RecName: Full=Bifunctional protein glmU;Includes:
    5::343     3e-15  28%  459 aa  GLMU_STRSV RecName: Full=Bifunctional protein glmU;Includes:
    6::214     3e-15  31%  453 aa  GLMU_DESHD RecName: Full=Bifunctional protein glmU;Includes:
    6::310     4e-15  28%  471 aa  GLMU_SYMTH RecName: Full=Bifunctional protein glmU;Includes:
    2::293     6e-15  23%  364 aa  MPG1_TRIRE RecName: Full=Mannose-1-phosphate guanyltransferase;    
    5::343     6e-15  27%  460 aa  GLMU_STRT2 RecName: Full=Bifunctional protein glmU;Includes:
    6::214     6e-15  30%  453 aa  GLMU_DESHY RecName: Full=Bifunctional protein glmU;Includes:
   46::385     6e-15  29%  473 aa  GLGS_WHEAT RecName: Full=Glucose-1-phosphate adenylyltransferase
   74::413     6e-15  30%  489 aa  GLGS_BETVU RecName: Full=Glucose-1-phosphate adenylyltransferase
   85::424     7e-15  30%  512 aa  GLGS2_VICFA RecName: Full=Glucose-1-phosphate adenylyltransferase
    5::272     7e-15  29%  297 aa  GALF_SALTY RecName: Full=UTP--glucose-1-phosphate
    5::272     7e-15  29%  297 aa  GALF_SALTI RecName: Full=UTP--glucose-1-phosphate
    6::314     1e-14  25%  455 aa  GLMU_OCEIH RecName: Full=Bifunctional protein glmU;Includes:
   94::433     1e-14  29%  521 aa  GLGS_SOLTU RecName: Full=Glucose-1-phosphate adenylyltransferase
   94::433     1e-14  29%  521 aa  GLGS_SOLLC RecName: Full=Glucose-1-phosphate adenylyltransferase
    6::346     1e-14  28%  430 aa  GLGC_SYNP6 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::364     1e-14  30%  429 aa  GLGC_SYNP2 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::346     1e-14  28%  430 aa  GLGC_SYNE7 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   13::380     1e-14  29%  413 aa  GLGC_GEOLS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    1::386     1e-14  30%  429 aa  GLGC_CYAA5 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::343     2e-14  27%  460 aa  GLMU_STRTD RecName: Full=Bifunctional protein glmU;Includes:
    5::343     2e-14  27%  460 aa  GLMU_STRT1 RecName: Full=Bifunctional protein glmU;Includes:
    1::345     2e-14  31%  429 aa  GLGC_NOSP7 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::343     3e-14  28%  459 aa  GLMU_STRGC RecName: Full=Bifunctional protein glmU;Includes:
    4::317     3e-14  28%  460 aa  GLMU_LACPL RecName: Full=Bifunctional protein glmU;Includes:
    6::345     3e-14  28%  429 aa  GLGC_CYAP7 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::352     4e-14  29%  459 aa  GLMU_STRZT RecName: Full=Bifunctional protein glmU;Includes:
    5::352     4e-14  28%  459 aa  GLMU_STRR6 RecName: Full=Bifunctional protein glmU;Includes:
    5::352     4e-14  28%  459 aa  GLMU_STRP2 RecName: Full=Bifunctional protein glmU;Includes:
    1::345     4e-14  28%  429 aa  GLGC_CYAP4 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::311     5e-14  31%  454 aa  GLMU_SHEPA RecName: Full=Bifunctional protein glmU;Includes:
    6::322     5e-14  31%  454 aa  GLMU_SHELP RecName: Full=Bifunctional protein glmU;Includes:
    6::335     5e-14  27%  466 aa  GLMU_MYXXD RecName: Full=Bifunctional protein glmU;Includes:
    5::352     6e-14  29%  459 aa  GLMU_STRP4 RecName: Full=Bifunctional protein glmU;Includes:
    6::311     6e-14  31%  454 aa  GLMU_SHEHH RecName: Full=Bifunctional protein glmU;Includes:
   21::287     6e-14  34%  427 aa  GLGC_METFK RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::311     8e-14  30%  454 aa  GLMU_SHEWM RecName: Full=Bifunctional protein glmU;Includes:
    4::310     8e-14  27%  455 aa  GLMU_ALKOO RecName: Full=Bifunctional protein glmU;Includes:
    5::352     1e-13  28%  459 aa  GLMU_STRPI RecName: Full=Bifunctional protein glmU;Includes:
    5::352     1e-13  28%  459 aa  GLMU_STRP7 RecName: Full=Bifunctional protein glmU;Includes:
    5::352     1e-13  28%  459 aa  GLMU_STRZJ RecName: Full=Bifunctional protein glmU;Includes:
    2::285     1e-13  30%  446 aa  GLMU_FUSNN RecName: Full=Bifunctional protein glmU;Includes:
    9::336     2e-13  26%  434 aa  GLMU_SULDN RecName: Full=Bifunctional protein glmU;Includes:
    5::352     2e-13  28%  459 aa  GLMU_STRPN RecName: Full=Bifunctional protein glmU;Includes:
    6::311     2e-13  30%  454 aa  GLMU_SHESM RecName: Full=Bifunctional protein glmU;Includes:
    5::315     2e-13  28%  455 aa  GLMU_CLOTE RecName: Full=Bifunctional protein glmU;Includes:
    8::190     2e-13  29%  464 aa  GLMU_PELCD RecName: Full=Bifunctional protein glmU;Includes:
    8::347     2e-13  29%  463 aa  GLMU_CALS8 RecName: Full=Bifunctional protein glmU;Includes:
    6::378     2e-13  30%  431 aa  GLGC_SYNPW RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   15::397     2e-13  28%  420 aa  GLGC_RHIME RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::316     3e-13  26%  456 aa  GLMU_DESRM RecName: Full=Bifunctional protein glmU;Includes:
   11::322     3e-13  32%  481 aa  GLMU_DEIGD RecName: Full=Bifunctional protein glmU;Includes:
    5::359     4e-13  28%  459 aa  GLMU_STRMU RecName: Full=Bifunctional protein glmU;Includes:
    6::311     5e-13  30%  454 aa  GLMU_SHESA RecName: Full=Bifunctional protein glmU;Includes:
    3::312     5e-13  29%  456 aa  GLMU_CLOAB RecName: Full=Bifunctional protein glmU;Includes:
    3::322     5e-13  28%  460 aa  GLMU_BIFLI RecName: Full=Bifunctional protein glmU;Includes:
   15::397     5e-13  28%  420 aa  GLGC_RHISN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    1::345     5e-13  27%  429 aa  GLGC_CYAP8 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   20::218     5e-13  33%  422 aa  GLGC2_ALHEH RecName: Full=Glucose-1-phosphate adenylyltransferase
    5::343     7e-13  24%  449 aa  GLMU_SYNWW RecName: Full=Bifunctional protein glmU;Includes:
    6::312     7e-13  30%  454 aa  GLMU_SHEON RecName: Full=Bifunctional protein glmU;Includes:
    1::349     7e-13  26%  449 aa  GLMU_PROM9 RecName: Full=Bifunctional protein glmU;Includes:
    1::312     7e-13  29%  447 aa  GLMU_PROM5 RecName: Full=Bifunctional protein glmU;Includes:
    6::311     9e-13  29%  454 aa  GLMU_SHESW RecName: Full=Bifunctional protein glmU;Includes:
    6::311     9e-13  29%  454 aa  GLMU_SHEPC RecName: Full=Bifunctional protein glmU;Includes:
   22::218     9e-13  31%  431 aa  GLGC_SALDC RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::325     1e-12  27%  460 aa  GLMU_STRP6 RecName: Full=Bifunctional protein glmU;Includes:
   16::367     1e-12  27%  421 aa  GLGC_RHILO RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::222     2e-12  30%  498 aa  GLMU_MYCGI RecName: Full=Bifunctional protein glmU;Includes:
   22::218     2e-12  31%  431 aa  GLGC_SALTY RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     2e-12  31%  431 aa  GLGC_SALTI RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     2e-12  31%  431 aa  GLGC_SALSV RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     2e-12  31%  431 aa  GLGC_SALPK RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     2e-12  31%  431 aa  GLGC_SALPA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     2e-12  31%  431 aa  GLGC_SALNS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     2e-12  31%  431 aa  GLGC_SALHS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     2e-12  31%  431 aa  GLGC_SALEP RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::325     2e-12  27%  460 aa  GLMU_STRPM RecName: Full=Bifunctional protein glmU;Includes:
    6::311     2e-12  30%  454 aa  GLMU_SHESR RecName: Full=Bifunctional protein glmU;Includes:
    6::324     2e-12  30%  454 aa  GLMU_SHEAM RecName: Full=Bifunctional protein glmU;Includes:
    4::302     2e-12  27%  458 aa  GLMU_BDEBA RecName: Full=Bifunctional protein glmU;Includes:
    6::162     2e-12  31%  453 aa  GLMU_AERHH RecName: Full=Bifunctional protein glmU;Includes:
    7::387     3e-12  31%  412 aa  GMPPA_DICDI RecName: Full=Mannose-1-phosphate guanyltransferase
    5::325     3e-12  27%  460 aa  GLMU_STRPF RecName: Full=Bifunctional protein glmU;Includes:
    2::331     3e-12  27%  450 aa  GLMU_THEM4 RecName: Full=Bifunctional protein glmU;Includes:
    5::325     3e-12  28%  460 aa  GLMU_STRP1 RecName: Full=Bifunctional protein glmU;Includes:
    1::312     3e-12  29%  449 aa  GLMU_PROMP RecName: Full=Bifunctional protein glmU;Includes:
    1::329     3e-12  29%  427 aa  GLMU_NAUPA RecName: Full=Bifunctional protein glmU;Includes:
  101::432     3e-12  30%  520 aa  GLGS_ARATH RecName: Full=Glucose-1-phosphate adenylyltransferase
   22::218     3e-12  31%  431 aa  GLGC_SALPC RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     3e-12  31%  431 aa  GLGC_SALPB RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     3e-12  31%  431 aa  GLGC_SALCH RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     3e-12  31%  431 aa  GLGC_SALA4 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::368     5e-12  27%  460 aa  GLMU_STRPG RecName: Full=Bifunctional protein glmU;Includes:
    5::325     5e-12  27%  460 aa  GLMU_STRP3 RecName: Full=Bifunctional protein glmU;Includes:
    6::323     5e-12  27%  452 aa  GLMU_ALCBS RecName: Full=Bifunctional protein glmU;Includes:
    7::318     5e-12  26%  454 aa  GLMU_ACTSZ RecName: Full=Bifunctional protein glmU;Includes:
   15::397     5e-12  26%  418 aa  GLGC_GEMAT RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::368     6e-12  26%  460 aa  GLMU_STRPC RecName: Full=Bifunctional protein glmU;Includes:
    5::368     6e-12  26%  416 aa  GLMU_STRPB RecName: Full=Bifunctional protein glmU;Includes:
    6::319     6e-12  26%  452 aa  GLMU_RUTMC RecName: Full=Bifunctional protein glmU;Includes:
   22::218     6e-12  30%  431 aa  GLGC_SHISS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_SHIFL RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_SHIF8 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_SHIDS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_SHIBS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_SHIB3 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  29%  431 aa  GLGC_KLEP7 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECOUT RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECOSM RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECOSE RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECOLU RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECOLI RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECOLC RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECOL6 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECOL5 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECOHS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECODH RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECOBW RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECO8A RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECO81 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECO7I RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECO5E RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECO57 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECO55 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECO45 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     6e-12  30%  431 aa  GLGC_ECO24 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     8e-12  29%  431 aa  GLGC_KLEP3 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    1::199     1e-11  29%  422 aa  GMPAA_DANRE RecName: Full=Mannose-1-phosphate guanyltransferase
    4::305     1e-11  27%  464 aa  GLMU_RHOFD RecName: Full=Bifunctional protein glmU;Includes:
    6::333     1e-11  24%  430 aa  GLMU_NITSB RecName: Full=Bifunctional protein glmU;Includes:
   22::218     1e-11  30%  431 aa  GLGC_SALAR RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   15::397     1e-11  25%  420 aa  GLGC_RHOPT RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   15::397     1e-11  28%  420 aa  GLGC_RHIE6 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     1e-11  31%  427 aa  GLGC_ENTS8 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    2::311     1e-11  25%  446 aa  GLMU_CARHZ RecName: Full=Bifunctional protein glmU;Includes:
    4::356     1e-11  26%  453 aa  GLMU_BURXL RecName: Full=Bifunctional protein glmU;Includes:
   92::434     1e-11  31%  522 aa  GLGL1_ARATH RecName: Full=Glucose-1-phosphate adenylyltransferase
   15::397     1e-11  28%  420 aa  GLGC_RHITR RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   21::413     1e-11  28%  434 aa  GLGC_MANSM RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   13::380     1e-11  27%  412 aa  GLGC_GEOMG RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     1e-11  30%  431 aa  GLGC_ENT38 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     1e-11  30%  431 aa  GLGC_ECO27 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    2::362     2e-11  26%  414 aa  YBB2_SCHPO RecName: Full=Probable mannose-1-phosphate
   12::316     2e-11  29%  468 aa  GLMU_RUBXD RecName: Full=Bifunctional protein glmU;Includes:
    1::343     2e-11  29%  418 aa  GLMU_PROAC RecName: Full=Bifunctional protein glmU;Includes:
    6::320     2e-11  28%  457 aa  GLMU_GEOUR RecName: Full=Bifunctional protein glmU;Includes:
    9::326     2e-11  27%  456 aa  GLMU_ERWT9 RecName: Full=Bifunctional protein glmU;Includes:
    7::206     2e-11  30%  453 aa  GLMU_AGRRK RecName: Full=Bifunctional protein glmU;Includes:
   51::395     2e-11  28%  483 aa  GLGL3_SOLTU RecName: Full=Glucose-1-phosphate adenylyltransferase
   15::397     2e-11  25%  420 aa  GLGC_RHOPA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   21::422     2e-11  28%  436 aa  GLGC_HAES2 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   21::422     2e-11  28%  436 aa  GLGC_HAES1 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   16::385     2e-11  25%  423 aa  GLGC_FRAP2 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::311     2e-11  30%  454 aa  GLMU_SHEPW RecName: Full=Bifunctional protein glmU;Includes:
    1::322     2e-11  27%  451 aa  GLMU_SACD2 RecName: Full=Bifunctional protein glmU;Includes:
    5::216     2e-11  29%  460 aa  GLMU_ACHLI RecName: Full=Bifunctional protein glmU;Includes:
   15::397     2e-11  28%  420 aa  GLGC_RHIEC RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::271     2e-11  29%  411 aa  GLGC_ANADF RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::325     3e-11  27%  460 aa  GLMU_STRP8 RecName: Full=Bifunctional protein glmU;Includes:
   22::218     3e-11  29%  431 aa  GLGC_ESCF3 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   15::397     3e-11  29%  420 aa  GLGC_AGRRK RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::268     3e-11  30%  404 aa  GLGC2_VIBPA RecName: Full=Glucose-1-phosphate adenylyltransferase
    9::213     4e-11  29%  451 aa  GLMU_OLICO RecName: Full=Bifunctional protein glmU;Includes:
    9::326     4e-11  26%  456 aa  GLMU_HAEDU RecName: Full=Bifunctional protein glmU;Includes:
    3::322     4e-11  26%  460 aa  GLMU_BIFLO RecName: Full=Bifunctional protein glmU;Includes:
    4::333     4e-11  30%  432 aa  GLMU_ARCB4 RecName: Full=Bifunctional protein glmU;Includes:
   16::385     4e-11  25%  423 aa  GLGC_FRATN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::326     5e-11  28%  456 aa  GLMU_SERP5 RecName: Full=Bifunctional protein glmU;Includes:
    4::349     5e-11  28%  453 aa  GLMU_BURCH RecName: Full=Bifunctional protein glmU;Includes:
    4::349     5e-11  28%  453 aa  GLMU_BURCA RecName: Full=Bifunctional protein glmU;Includes:
   15::397     5e-11  28%  420 aa  GLGC_RHIRD RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   19::383     5e-11  28%  423 aa  GLGC_NITOC RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   16::385     5e-11  25%  423 aa  GLGC_FRATO RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   16::385     5e-11  25%  423 aa  GLGC_FRATH RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   16::385     5e-11  25%  423 aa  GLGC_FRATF RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    1::213     7e-11  29%  426 aa  GMPAB_XENLA RecName: Full=Mannose-1-phosphate guanyltransferase
    4::349     7e-11  26%  453 aa  GLMU_BURPP RecName: Full=Bifunctional protein glmU;Includes:
    3::322     7e-11  26%  460 aa  GLMU_BIFLD RecName: Full=Bifunctional protein glmU;Includes:
   25::393     7e-11  28%  433 aa  GLGC_NITEU RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   16::385     7e-11  25%  423 aa  GLGC_FRATM RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   15::397     7e-11  28%  420 aa  GLGC_AGRT5 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::323     8e-11  26%  453 aa  GLMU_VIBCM RecName: Full=Bifunctional protein glmU;Includes:
    6::323     8e-11  26%  453 aa  GLMU_VIBCH RecName: Full=Bifunctional protein glmU;Includes:
    1::349     8e-11  27%  449 aa  GLMU_PROM0 RecName: Full=Bifunctional protein glmU;Includes:
    4::312     8e-11  27%  487 aa  GLMU_CORJK RecName: Full=Bifunctional protein glmU;Includes:
    1::350     1e-10  29%  422 aa  GMPAB_DANRE RecName: Full=Mannose-1-phosphate guanyltransferase
    4::322     1e-10  25%  453 aa  GLMU_BURP8 RecName: Full=Bifunctional protein glmU;Includes:
   40::379     1e-10  26%  470 aa  GLGL1_SOLTU RecName: Full=Glucose-1-phosphate adenylyltransferase
   19::214     1e-10  32%  425 aa  GLGC_NITMU RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::323     2e-10  25%  453 aa  GLMU_VIBC3 RecName: Full=Bifunctional protein glmU;Includes:
    6::317     2e-10  27%  460 aa  GLMU_SHEB9 RecName: Full=Bifunctional protein glmU;Includes:
    7::365     2e-10  26%  404 aa  GLGC2_VIBVY RecName: Full=Glucose-1-phosphate adenylyltransferase
    7::365     2e-10  25%  404 aa  GLGC2_VIBVU RecName: Full=Glucose-1-phosphate adenylyltransferase
    6::365     2e-10  26%  407 aa  GLGC2_VIBCH RecName: Full=Glucose-1-phosphate adenylyltransferase
    6::342     3e-10  24%  453 aa  GLMU_NITOC RecName: Full=Bifunctional protein glmU;Includes:
   18::367     3e-10  27%  420 aa  GLGC2_PSEA6 RecName: Full=Glucose-1-phosphate adenylyltransferase
    6::317     4e-10  27%  460 aa  GLMU_SHEB2 RecName: Full=Bifunctional protein glmU;Includes:
    9::213     4e-10  29%  452 aa  GLMU_RHOPS RecName: Full=Bifunctional protein glmU;Includes:
    7::354     4e-10  27%  458 aa  GLMU_NITEC RecName: Full=Bifunctional protein glmU;Includes:
    8::320     4e-10  27%  456 aa  GLMU_HAEIG RecName: Full=Bifunctional protein glmU;Includes:
   19::394     4e-10  25%  422 aa  GLGC_THICR RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   24::224     4e-10  34%  429 aa  GLGC_MAGSA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::376     4e-10  28%  413 aa  GLGC_ANAD2 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::310     6e-10  30%  456 aa  GLMU_PECCP RecName: Full=Bifunctional protein glmU;Includes:
    9::352     6e-10  27%  456 aa  GLMU_NEIM0 RecName: Full=Bifunctional protein glmU;Includes:
   16::385     6e-10  25%  423 aa  GLGC_FRATW RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::385     6e-10  25%  405 aa  GLGC_CORA7 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::376     6e-10  27%  413 aa  GLGC_ANASK RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    1::324     7e-10  26%  420 aa  GMPPA_RAT RecName: Full=Mannose-1-phosphate guanyltransferase
    9::352     7e-10  25%  456 aa  GLMU_NEIMF RecName: Full=Bifunctional protein glmU;Includes:
    7::349     7e-10  24%  453 aa  GLMU_HAES1 RecName: Full=Bifunctional protein glmU;Includes:
   16::280     7e-10  30%  420 aa  GLGC_SHESA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   14::396     7e-10  26%  419 aa  GLGC_ROSDO RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::360     7e-10  29%  437 aa  GLGC_HAEI8 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::384     7e-10  24%  413 aa  GLGC_DEIDV RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    1::199     9e-10  29%  421 aa  GMPAA_XENLA RecName: Full=Mannose-1-phosphate guanyltransferase
    4::319     9e-10  27%  454 aa  GLMU_THICR RecName: Full=Bifunctional protein glmU;Includes:
    7::215     9e-10  28%  453 aa  GLMU_RHILW RecName: Full=Bifunctional protein glmU;Includes:
    4::361     9e-10  26%  458 aa  GLMU_HELMI RecName: Full=Bifunctional protein glmU;Includes:
    6::347     9e-10  29%  476 aa  GLMU_GEOSL RecName: Full=Bifunctional protein glmU;Includes:
    9::155     9e-10  32%  461 aa  GLMU_BUCAP RecName: Full=Bifunctional protein glmU;Includes:
   15::396     9e-10  24%  420 aa  GLGC_RHOP5 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    1::324     1e-09  26%  420 aa  GMPPA_MOUSE RecName: Full=Mannose-1-phosphate guanyltransferase
    6::303     1e-09  27%  454 aa  GLMU_SHEDO RecName: Full=Bifunctional protein glmU;Includes:
    6::317     1e-09  27%  460 aa  GLMU_SHEB8 RecName: Full=Bifunctional protein glmU;Includes:
    6::317     1e-09  27%  460 aa  GLMU_SHEB5 RecName: Full=Bifunctional protein glmU;Includes:
    9::321     1e-09  25%  456 aa  GLMU_SALG2 RecName: Full=Bifunctional protein glmU;Includes:
    1::310     1e-09  26%  449 aa  GLMU_PROM2 RecName: Full=Bifunctional protein glmU;Includes:
    1::318     1e-09  26%  454 aa  GLMU_MANSM RecName: Full=Bifunctional protein glmU;Includes:
    7::349     1e-09  24%  453 aa  GLMU_HAES2 RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-09  24%  487 aa  GLMU_CORA7 RecName: Full=Bifunctional protein glmU;Includes:
    7::318     1e-09  25%  454 aa  GLMU_ACTP7 RecName: Full=Bifunctional protein glmU;Includes:
   21::384     1e-09  28%  424 aa  GLGC_METCA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::376     1e-09  26%  413 aa  GLGC_ANADE RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    1::199     2e-09  28%  421 aa  GMPPA_XENTR RecName: Full=Mannose-1-phosphate guanyltransferase
    1::324     2e-09  25%  420 aa  GMPPA_PAPAN RecName: Full=Mannose-1-phosphate guanyltransferase
    9::321     2e-09  27%  456 aa  GLMU_YERPY RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-09  27%  456 aa  GLMU_YERPS RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-09  27%  456 aa  GLMU_YERPP RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-09  27%  456 aa  GLMU_YERPN RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-09  27%  456 aa  GLMU_YERPE RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-09  27%  456 aa  GLMU_YERPB RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-09  27%  456 aa  GLMU_YERPA RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-09  27%  456 aa  GLMU_YERP3 RecName: Full=Bifunctional protein glmU;Includes:
    5::311     2e-09  26%  452 aa  GLMU_VIBFM RecName: Full=Bifunctional protein glmU;Includes:
    5::323     2e-09  27%  452 aa  GLMU_VIBF1 RecName: Full=Bifunctional protein glmU;Includes:
    9::310     2e-09  25%  456 aa  GLMU_SALTI RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-09  25%  456 aa  GLMU_SALCH RecName: Full=Bifunctional protein glmU;Includes:
   16::280     2e-09  29%  420 aa  GLGC_SHESR RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   16::280     2e-09  29%  420 aa  GLGC_SHESM RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   15::366     2e-09  28%  419 aa  GLGC_NOVAD RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   31::407     2e-09  25%  427 aa  GLGC_CORDI RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::212     2e-09  31%  449 aa  GLMU_SILST RecName: Full=Bifunctional protein glmU;Includes:
    6::303     2e-09  28%  454 aa  GLMU_SHEFN RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-09  25%  456 aa  GLMU_SALTY RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-09  25%  456 aa  GLMU_SALPK RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-09  25%  456 aa  GLMU_SALPB RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-09  25%  456 aa  GLMU_SALPA RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-09  25%  456 aa  GLMU_SALNS RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-09  25%  456 aa  GLMU_SALHS RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-09  25%  456 aa  GLMU_SALEP RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-09  25%  456 aa  GLMU_SALDC RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-09  25%  456 aa  GLMU_SALA4 RecName: Full=Bifunctional protein glmU;Includes:
    7::215     2e-09  26%  453 aa  GLMU_RHIL3 RecName: Full=Bifunctional protein glmU;Includes:
    8::326     2e-09  26%  456 aa  GLMU_HAEIN RecName: Full=Bifunctional protein glmU;Includes:
    6::210     2e-09  29%  452 aa  GLMU_ALTMD RecName: Full=Bifunctional protein glmU;Includes:
   16::280     2e-09  30%  420 aa  GLGC_SHEON RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   25::405     2e-09  28%  439 aa  GLGC_PASMU RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    1::324     3e-09  25%  420 aa  GMPPA_HUMAN RecName: Full=Mannose-1-phosphate guanyltransferase
    7::215     3e-09  28%  453 aa  GLMU_RHIEC RecName: Full=Bifunctional protein glmU;Includes:
    7::215     3e-09  26%  453 aa  GLMU_RHIE6 RecName: Full=Bifunctional protein glmU;Includes:
    7::324     3e-09  26%  453 aa  GLMU_HAEPS RecName: Full=Bifunctional protein glmU;Includes:
    8::326     3e-09  26%  456 aa  GLMU_HAEIE RecName: Full=Bifunctional protein glmU;Includes:
    7::324     3e-09  24%  457 aa  GLMU_ACTP2 RecName: Full=Bifunctional protein glmU;Includes:
   28::394     3e-09  27%  446 aa  GLGC_RHOBA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   27::436     3e-09  30%  732 aa  EI2BE_CANAL RecName: Full=Translation initiation factor eIF-2B
    6::165     4e-09  32%  450 aa  GLMU_SILPO RecName: Full=Bifunctional protein glmU;Includes:
    9::321     4e-09  25%  456 aa  GLMU_SALSV RecName: Full=Bifunctional protein glmU;Includes:
    9::213     4e-09  29%  452 aa  GLMU_NITHX RecName: Full=Bifunctional protein glmU;Includes:
    3::282     4e-09  27%  446 aa  GLMU_KOSOT RecName: Full=Bifunctional protein glmU;Includes:
    6::151     4e-09  29%  453 aa  GLMU_CHRSD RecName: Full=Bifunctional protein glmU;Includes:
    5::311     4e-09  26%  452 aa  GLMU_ALISL RecName: Full=Bifunctional protein glmU;Includes:
   22::360     4e-09  29%  437 aa  GLGC_HAEIN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::273     4e-09  28%  405 aa  GLGC_CORJK RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::351     5e-09  26%  453 aa  GLMU_VIBVU RecName: Full=Bifunctional protein glmU;Includes:
    6::298     5e-09  25%  452 aa  GLMU_PSEMY RecName: Full=Bifunctional protein glmU;Includes:
    6::321     5e-09  26%  457 aa  GLMU_PHOLL RecName: Full=Bifunctional protein glmU;Includes:
    9::320     5e-09  25%  458 aa  GLMU_PASMU RecName: Full=Bifunctional protein glmU;Includes:
    6::329     5e-09  25%  457 aa  GLMU_GEOSF RecName: Full=Bifunctional protein glmU;Includes:
    9::344     5e-09  29%  456 aa  GLMU_ERWCT RecName: Full=Bifunctional protein glmU;Includes:
    9::154     5e-09  28%  456 aa  GLMU_EDWI9 RecName: Full=Bifunctional protein glmU;Includes:
   11::328     5e-09  29%  469 aa  GLMU_ACIBL RecName: Full=Bifunctional protein glmU;Includes:
   16::380     5e-09  27%  420 aa  GLGC_SHEFN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   10::349     5e-09  24%  404 aa  GLGC_RHOSR RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::350     6e-09  27%  453 aa  GLMU_VIBVY RecName: Full=Bifunctional protein glmU;Includes:
    1::349     6e-09  28%  449 aa  GLMU_PROMS RecName: Full=Bifunctional protein glmU;Includes:
    8::158     6e-09  33%  452 aa  GLMU_PARL1 RecName: Full=Bifunctional protein glmU;Includes:
    9::352     6e-09  26%  456 aa  GLMU_NEIG1 RecName: Full=Bifunctional protein glmU;Includes:
    1::336     6e-09  27%  433 aa  GLMU_HELAH RecName: Full=Bifunctional protein glmU;Includes:
    8::326     6e-09  26%  456 aa  GLMU_HAEI8 RecName: Full=Bifunctional protein glmU;Includes:
    6::331     6e-09  27%  461 aa  GLMU_COLP3 RecName: Full=Bifunctional protein glmU;Includes:
   10::349     6e-09  24%  404 aa  GLGC_RHOOB RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::351     8e-09  25%  453 aa  GLMU_VIBPA RecName: Full=Bifunctional protein glmU;Includes:
    5::368     8e-09  26%  460 aa  GLMU_STRPZ RecName: Full=Bifunctional protein glmU;Includes:
    6::320     8e-09  24%  455 aa  GLMU_PSEFS RecName: Full=Bifunctional protein glmU;Includes:
    6::317     8e-09  25%  454 aa  GLMU_PSEA7 RecName: Full=Bifunctional protein glmU;Includes:
    8::216     8e-09  27%  454 aa  GLMU_OCHA4 RecName: Full=Bifunctional protein glmU;Includes:
    6::323     8e-09  25%  460 aa  GLMU_GEOLS RecName: Full=Bifunctional protein glmU;Includes:
    8::216     8e-09  27%  454 aa  GLMU_BRUSU RecName: Full=Bifunctional protein glmU;Includes:
    8::216     8e-09  27%  454 aa  GLMU_BRUSI RecName: Full=Bifunctional protein glmU;Includes:
    8::216     8e-09  27%  454 aa  GLMU_BRUME RecName: Full=Bifunctional protein glmU;Includes:
    8::216     8e-09  27%  454 aa  GLMU_BRUMB RecName: Full=Bifunctional protein glmU;Includes:
    8::216     8e-09  27%  454 aa  GLMU_BRUC2 RecName: Full=Bifunctional protein glmU;Includes:
   22::218     8e-09  26%  428 aa  GLGC_YERPY RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     8e-09  26%  428 aa  GLGC_YERPS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     8e-09  26%  476 aa  GLGC_YERPP RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     8e-09  26%  476 aa  GLGC_YERPN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     8e-09  26%  476 aa  GLGC_YERPE RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     8e-09  26%  428 aa  GLGC_YERPB RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     8e-09  26%  476 aa  GLGC_YERPA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   22::218     8e-09  26%  428 aa  GLGC_YERP3 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   10::204     8e-09  27%  408 aa  GLGC_PROAC RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::298     1e-08  25%  455 aa  GLMU_PSEPF RecName: Full=Bifunctional protein glmU;Includes:
    7::354     1e-08  26%  458 aa  GLMU_NITEU RecName: Full=Bifunctional protein glmU;Includes:
   10::304     1e-08  25%  492 aa  GLMU_MYCLE RecName: Full=Bifunctional protein glmU;Includes:
   10::304     1e-08  25%  492 aa  GLMU_MYCLB RecName: Full=Bifunctional protein glmU;Includes:
    1::323     1e-08  26%  453 aa  GLMU_CELJU RecName: Full=Bifunctional protein glmU;Includes:
    7::324     1e-08  23%  454 aa  GLMU_ACTPJ RecName: Full=Bifunctional protein glmU;Includes:
    4::318     1e-08  27%  456 aa  GLMU_IDILO RecName: Full=Bifunctional protein glmU;Includes:
    6::373     1e-08  26%  411 aa  GLGC_THEYD RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::374     1e-08  28%  414 aa  GLGC_THECA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   16::212     1e-08  34%  421 aa  GLGC_BURXL RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::350     2e-08  26%  453 aa  GLMU_VIBHB RecName: Full=Bifunctional protein glmU;Includes:
    9::352     2e-08  26%  456 aa  GLMU_NEIGO RecName: Full=Bifunctional protein glmU;Includes:
    6::157     2e-08  30%  448 aa  GLMU_BARQU RecName: Full=Bifunctional protein glmU;Includes:
    7::158     2e-08  31%  449 aa  GLMU_BARBK RecName: Full=Bifunctional protein glmU;Includes:
   10::384     2e-08  23%  404 aa  GLGC_MYCSS RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::386     2e-08  26%  411 aa  GLGC_CORK4 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   18::281     2e-08  28%  431 aa  GLGC_ALTMD RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::351     2e-08  26%  457 aa  GLMU_THEP3 RecName: Full=Bifunctional protein glmU;Includes:
    6::317     2e-08  25%  454 aa  GLMU_PSEAE RecName: Full=Bifunctional protein glmU;Includes:
    6::317     2e-08  25%  454 aa  GLMU_PSEAB RecName: Full=Bifunctional protein glmU;Includes:
    6::317     2e-08  25%  454 aa  GLMU_PSEA8 RecName: Full=Bifunctional protein glmU;Includes:
    5::323     2e-08  27%  453 aa  GLMU_PHOPR RecName: Full=Bifunctional protein glmU;Includes:
    9::213     2e-08  27%  452 aa  GLMU_NITWN RecName: Full=Bifunctional protein glmU;Includes:
    9::374     2e-08  27%  414 aa  GLGC_THET2 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   16::280     2e-08  29%  420 aa  GLGC_SHEB5 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   15::397     2e-08  27%  420 aa  GLGC_RHILW RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   16::148     2e-08  28%  440 aa  EI2BG_DICDI RecName: Full=Translation initiation factor eIF-2B
    7::167     3e-08  33%  451 aa  GLMU_SPHAL RecName: Full=Bifunctional protein glmU;Includes:
    9::213     3e-08  26%  452 aa  GLMU_RHOPT RecName: Full=Bifunctional protein glmU;Includes:
    6::298     3e-08  27%  452 aa  GLMU_PSEU5 RecName: Full=Bifunctional protein glmU;Includes:
    7::217     3e-08  28%  455 aa  GLMU_DESVH RecName: Full=Bifunctional protein glmU;Includes:
   10::320     3e-08  26%  484 aa  GLMU_CORDI RecName: Full=Bifunctional protein glmU;Includes:
    9::361     3e-08  26%  435 aa  GLGC_ACIAC RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::213     4e-08  26%  452 aa  GLMU_RHOPA RecName: Full=Bifunctional protein glmU;Includes:
   11::239     4e-08  30%  457 aa  GLMU_LAWIP RecName: Full=Bifunctional protein glmU;Includes:
    6::334     4e-08  26%  476 aa  GLMU_GEOMG RecName: Full=Bifunctional protein glmU;Includes:
    3::322     4e-08  26%  460 aa  GLMU_BIFAA RecName: Full=Bifunctional protein glmU;Includes:
   91::433     4e-08  27%  521 aa  GLGL3_ARATH RecName: Full=Glucose-1-phosphate adenylyltransferase
    9::374     4e-08  27%  414 aa  GLGC_THET8 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   20::216     4e-08  30%  423 aa  GLGC_RHORU RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   20::216     4e-08  30%  423 aa  GLGC_RHORT RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   16::212     4e-08  35%  422 aa  GLGC_BURP8 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   18::382     4e-08  25%  439 aa  GLGC1_PSEA6 RecName: Full=Glucose-1-phosphate adenylyltransferase
    9::321     5e-08  28%  456 aa  GLMU_YERE8 RecName: Full=Bifunctional protein glmU;Includes:
    6::320     5e-08  23%  455 aa  GLMU_PSEF5 RecName: Full=Bifunctional protein glmU;Includes:
    9::352     5e-08  25%  456 aa  GLMU_NEIMA RecName: Full=Bifunctional protein glmU;Includes:
    1::336     5e-08  26%  433 aa  GLMU_HELPJ RecName: Full=Bifunctional protein glmU;Includes:
   90::437     5e-08  27%  519 aa  GLGL2_SOLTU RecName: Full=Glucose-1-phosphate adenylyltransferase
   16::280     5e-08  29%  420 aa  GLGC_SHEB8 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   16::280     5e-08  29%  420 aa  GLGC_SHEB2 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   28::420     5e-08  37%  712 aa  EI2BE_YEAST RecName: Full=Translation initiation factor eIF-2B
   10::227     7e-08  30%  484 aa  GLMU_THEFY RecName: Full=Bifunctional protein glmU;Includes:
    6::317     7e-08  26%  452 aa  GLMU_HAHCH RecName: Full=Bifunctional protein glmU;Includes:
    7::205     7e-08  29%  455 aa  GLMU_DESVV RecName: Full=Bifunctional protein glmU;Includes:
    6::215     7e-08  28%  448 aa  GLMU_BARHE RecName: Full=Bifunctional protein glmU;Includes:
    7::214     7e-08  25%  452 aa  GLMU_AGRVS RecName: Full=Bifunctional protein glmU;Includes:
    6::323     7e-08  24%  454 aa  GLMU_ACIBS RecName: Full=Bifunctional protein glmU;Includes:
    6::323     7e-08  25%  454 aa  GLMU_ACIBC RecName: Full=Bifunctional protein glmU;Includes:
   10::349     7e-08  25%  404 aa  GLGC_RHOE4 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    4::452     7e-08  32%  452 aa  EI2BG_RAT RecName: Full=Translation initiation factor eIF-2B
    4::452     7e-08  33%  452 aa  EI2BG_HUMAN RecName: Full=Translation initiation factor eIF-2B
    6::336     9e-08  27%  455 aa  GLMU_PSESM RecName: Full=Bifunctional protein glmU;Includes:
    6::326     9e-08  24%  457 aa  GLMU_PROMH RecName: Full=Bifunctional protein glmU;Includes:
    8::156     9e-08  28%  451 aa  GLMU_NOVAD RecName: Full=Bifunctional protein glmU;Includes:
    6::323     9e-08  25%  454 aa  GLMU_ACIBY RecName: Full=Bifunctional protein glmU;Includes:
   15::397     9e-08  27%  420 aa  GLGC_RHIL3 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    4::452     9e-08  35%  452 aa  EI2BG_BOVIN RecName: Full=Translation initiation factor eIF-2B
    6::323     1e-07  24%  454 aa  GLMU_TOLAT RecName: Full=Bifunctional protein glmU;Includes:
    1::185     1e-07  28%  453 aa  GLMU_THET8 RecName: Full=Bifunctional protein glmU;Includes:
    1::185     1e-07  28%  453 aa  GLMU_THET2 RecName: Full=Bifunctional protein glmU;Includes:
    7::157     1e-07  27%  456 aa  GLMU_RHIME RecName: Full=Bifunctional protein glmU;Includes:
   17::251     1e-07  27%  491 aa  GLMU_KINRD RecName: Full=Bifunctional protein glmU;Includes:
    9::213     1e-07  29%  451 aa  GLMU_BRAJA RecName: Full=Bifunctional protein glmU;Includes:
    7::158     1e-07  30%  454 aa  GLMU_BART1 RecName: Full=Bifunctional protein glmU;Includes:
    7::223     1e-07  28%  476 aa  GLMU_ACISJ RecName: Full=Bifunctional protein glmU;Includes:
   87::430     1e-07  25%  518 aa  GLGL2_ARATH RecName: Full=Glucose-1-phosphate adenylyltransferase
   16::280     1e-07  29%  420 aa  GLGC_SHEB9 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   10::205     1e-07  29%  414 aa  GLGC_LEIXX RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   13::390     1e-07  23%  409 aa  GLGC_COREF RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    1::206     1e-07  28%  454 aa  GLMU_SYNS3 RecName: Full=Bifunctional protein glmU;Includes:
    6::162     1e-07  27%  452 aa  GLMU_PSYIN RecName: Full=Bifunctional protein glmU;Includes:
    6::336     1e-07  25%  455 aa  GLMU_PSE14 RecName: Full=Bifunctional protein glmU;Includes:
    1::304     1e-07  31%  433 aa  GLMU_HELPH RecName: Full=Bifunctional protein glmU;Includes:
   10::153     1e-07  30%  444 aa  GLMU_GLUOX RecName: Full=Bifunctional protein glmU;Includes:
   89::436     1e-07  27%  521 aa  GLGL2_MAIZE RecName: Full=Glucose-1-phosphate adenylyltransferase
   16::212     1e-07  32%  420 aa  GLGC_BURPP RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::317     2e-07  32%  459 aa  GLMU_THISH RecName: Full=Bifunctional protein glmU;Includes:
    9::352     2e-07  24%  456 aa  GLMU_NEIMB RecName: Full=Bifunctional protein glmU;Includes:
    9::169     2e-07  28%  448 aa  GLMU_BRASO RecName: Full=Bifunctional protein glmU;Includes:
   92::438     2e-07  27%  522 aa  GLGL2_WHEAT RecName: Full=Glucose-1-phosphate adenylyltransferase
   10::273     2e-07  29%  404 aa  GLGC_NOCFA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   10::380     2e-07  23%  404 aa  GLGC_MYCGI RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    4::438     2e-07  36%  452 aa  EI2BG_MACFA RecName: Full=Translation initiation factor eIF-2B
   19::181     2e-07  25%  678 aa  EI2BE_SCHPO RecName: Full=Probable translation initiation factor
    1::351     3e-07  26%  449 aa  GLMU_SYNP2 RecName: Full=Bifunctional protein glmU;Includes:
    7::157     3e-07  26%  456 aa  GLMU_SINMW RecName: Full=Bifunctional protein glmU;Includes:
    6::306     3e-07  30%  460 aa  GLMU_PELPD RecName: Full=Bifunctional protein glmU;Includes:
    6::323     3e-07  23%  455 aa  GLMU_FRATW RecName: Full=Bifunctional protein glmU;Includes:
    6::323     3e-07  23%  455 aa  GLMU_FRATT RecName: Full=Bifunctional protein glmU;Includes:
    6::323     3e-07  23%  455 aa  GLMU_FRATN RecName: Full=Bifunctional protein glmU;Includes:
    6::323     3e-07  23%  455 aa  GLMU_FRATM RecName: Full=Bifunctional protein glmU;Includes:
    6::323     3e-07  23%  455 aa  GLMU_FRATH RecName: Full=Bifunctional protein glmU;Includes:
    6::323     3e-07  23%  455 aa  GLMU_FRATF RecName: Full=Bifunctional protein glmU;Includes:
    6::323     3e-07  23%  455 aa  GLMU_FRAT1 RecName: Full=Bifunctional protein glmU;Includes:
    9::310     3e-07  25%  456 aa  GLMU_ECO81 RecName: Full=Bifunctional protein glmU;Includes:
   93::439     3e-07  27%  523 aa  GLGL1_HORVU RecName: Full=Glucose-1-phosphate adenylyltransferase
   22::218     3e-07  27%  425 aa  GLGC_SERP5 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    1::165     3e-07  29%  450 aa  GLMU_ROSDO RecName: Full=Bifunctional protein glmU;Includes:
    7::222     3e-07  26%  492 aa  GLMU_MYCVP RecName: Full=Bifunctional protein glmU;Includes:
    9::323     3e-07  25%  456 aa  GLMU_ENTS8 RecName: Full=Bifunctional protein glmU;Includes:
    6::317     3e-07  25%  454 aa  GLMU_AZOVD RecName: Full=Bifunctional protein glmU;Includes:
    6::298     4e-07  26%  455 aa  GLMU_PSEPG RecName: Full=Bifunctional protein glmU;Includes:
    5::343     4e-07  23%  461 aa  GLMU_METCA RecName: Full=Bifunctional protein glmU;Includes:
    1::304     4e-07  30%  433 aa  GLMU_HELPY RecName: Full=Bifunctional protein glmU;Includes:
    6::323     4e-07  23%  455 aa  GLMU_FRATO RecName: Full=Bifunctional protein glmU;Includes:
   12::213     4e-07  25%  462 aa  GLMU_CAUCR RecName: Full=Bifunctional protein glmU;Includes:
   12::213     4e-07  25%  462 aa  GLMU_CAUCN RecName: Full=Bifunctional protein glmU;Includes:
   10::206     4e-07  27%  470 aa  GLGC_ARTAT RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::109     6e-07  34%  450 aa  GLMU_ZYMMO RecName: Full=Bifunctional protein glmU;Includes:
    9::310     6e-07  24%  456 aa  GLMU_SHIB3 RecName: Full=Bifunctional protein glmU;Includes:
    1::347     6e-07  25%  450 aa  GLMU_MICAN RecName: Full=Bifunctional protein glmU;Includes:
    9::320     6e-07  24%  456 aa  GLMU_ECOL5 RecName: Full=Bifunctional protein glmU;Includes:
    7::324     6e-07  24%  455 aa  GLMU_CHRVO RecName: Full=Bifunctional protein glmU;Includes:
    9::316     6e-07  26%  469 aa  GLMU_BAUCH RecName: Full=Bifunctional protein glmU;Includes:
    9::320     7e-07  24%  456 aa  GLMU_ECO8A RecName: Full=Bifunctional protein glmU;Includes:
    9::320     7e-07  24%  456 aa  GLMU_ECO5E RecName: Full=Bifunctional protein glmU;Includes:
    9::320     7e-07  24%  456 aa  GLMU_ECO27 RecName: Full=Bifunctional protein glmU;Includes:
    8::276     7e-07  27%  413 aa  GLGC_DEIRA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::353     7e-07  28%  405 aa  GLGC1_VIBVY RecName: Full=Glucose-1-phosphate adenylyltransferase
    7::353     7e-07  28%  405 aa  GLGC1_VIBVU RecName: Full=Glucose-1-phosphate adenylyltransferase
    9::320     1e-06  24%  456 aa  GLMU_SHISS RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-06  24%  456 aa  GLMU_SHIFL RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-06  24%  456 aa  GLMU_SHIF8 RecName: Full=Bifunctional protein glmU;Includes:
    9::310     1e-06  24%  456 aa  GLMU_SHIBS RecName: Full=Bifunctional protein glmU;Includes:
    6::298     1e-06  27%  455 aa  GLMU_PSEP1 RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-06  24%  456 aa  GLMU_ESCF3 RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-06  24%  456 aa  GLMU_ECOUT RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-06  24%  456 aa  GLMU_ECOSM RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-06  24%  456 aa  GLMU_ECOSE RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-06  24%  456 aa  GLMU_ECOLU RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-06  24%  456 aa  GLMU_ECOLI RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-06  24%  456 aa  GLMU_ECOLC RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-06  24%  456 aa  GLMU_ECOL6 RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-06  24%  456 aa  GLMU_ECOK1 RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-06  24%  456 aa  GLMU_ECOHS RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-06  24%  456 aa  GLMU_ECODH RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-06  24%  456 aa  GLMU_ECOBW RecName: Full=Bifunctional protein glmU;Includes:
    9::310     1e-06  24%  456 aa  GLMU_ECO7I RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-06  24%  456 aa  GLMU_ECO57 RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-06  24%  456 aa  GLMU_ECO45 RecName: Full=Bifunctional protein glmU;Includes:
    9::320     1e-06  24%  456 aa  GLMU_ECO24 RecName: Full=Bifunctional protein glmU;Includes:
    7::329     1e-06  29%  455 aa  GLMU_DESVM RecName: Full=Bifunctional protein glmU;Includes:
   73::347     1e-06  28%  500 aa  GLGL3_WHEAT RecName: Full=Glucose-1-phosphate adenylyltransferase
    7::213     1e-06  27%  301 aa  GLGL1_WHEAT RecName: Full=Glucose-1-phosphate adenylyltransferase
    9::214     1e-06  26%  414 aa  GLGC_BIFLO RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::214     1e-06  26%  414 aa  GLGC_BIFLD RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::320     1e-06  24%  456 aa  GLMU_SHIDS RecName: Full=Bifunctional protein glmU;Includes:
    6::298     1e-06  26%  455 aa  GLMU_PSEPK RecName: Full=Bifunctional protein glmU;Includes:
    6::306     1e-06  28%  452 aa  GLMU_PROMA RecName: Full=Bifunctional protein glmU;Includes:
    7::201     1e-06  29%  405 aa  GLGC_VIBFM RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::201     1e-06  29%  405 aa  GLGC_VIBF1 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   30::226     1e-06  27%  439 aa  GLGC_THIDA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::220     2e-06  33%  225 aa  ISPD_CLOPE RecName: Full=2-C-methyl-D-erythritol 4-phosphate
    6::220     2e-06  33%  225 aa  ISPD_CLOP1 RecName: Full=2-C-methyl-D-erythritol 4-phosphate
    8::154     2e-06  34%  452 aa  GLMU_SPHWW RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-06  23%  455 aa  GLMU_SALAR RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-06  24%  456 aa  GLMU_KLEP3 RecName: Full=Bifunctional protein glmU;Includes:
    6::323     2e-06  23%  454 aa  GLMU_ACIAD RecName: Full=Bifunctional protein glmU;Includes:
    9::205     2e-06  26%  470 aa  GLGC_ARTCA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    7::204     2e-06  28%  405 aa  GLGC1_VIBPA RecName: Full=Glucose-1-phosphate adenylyltransferase
    7::268     2e-06  28%  405 aa  GLGC1_VIBCH RecName: Full=Glucose-1-phosphate adenylyltransferase
    8::207     2e-06  28%  458 aa  GLMU_RHILO RecName: Full=Bifunctional protein glmU;Includes:
    9::320     2e-06  24%  456 aa  GLMU_ECO55 RecName: Full=Bifunctional protein glmU;Includes:
   15::211     2e-06  30%  423 aa  GLGC_RHOS5 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   15::211     2e-06  30%  423 aa  GLGC_RHOS4 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   15::211     2e-06  30%  423 aa  GLGC_RHOS1 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::214     2e-06  26%  414 aa  GLGC_BIFLI RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::204     2e-06  26%  414 aa  GLGC_BIFAA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::322     3e-06  23%  458 aa  GLMU_SODGM RecName: Full=Bifunctional protein glmU;Includes:
    7::196     3e-06  31%  426 aa  GLMU_OENOB RecName: Full=Bifunctional protein glmU;Includes:
   93::435     3e-06  23%  523 aa  GLGL4_ARATH RecName: Full=Probable glucose-1-phosphate
    9::205     3e-06  27%  465 aa  GLGC_ARTS2 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::56      3e-06  38%  404 aa  EI2BG_CAEEL RecName: Full=Probable translation initiation factor
   10::103     4e-06  34%  495 aa  GLMU_MYCTU RecName: Full=Bifunctional protein glmU;Includes:
   10::103     4e-06  34%  495 aa  GLMU_MYCTA RecName: Full=Bifunctional protein glmU;Includes:
   10::103     4e-06  34%  495 aa  GLMU_MYCBT RecName: Full=Bifunctional protein glmU;Includes:
   10::103     4e-06  34%  495 aa  GLMU_MYCBP RecName: Full=Bifunctional protein glmU;Includes:
   10::103     4e-06  34%  495 aa  GLMU_MYCBO RecName: Full=Bifunctional protein glmU;Includes:
    1::173     4e-06  26%  460 aa  GLMU_METPP RecName: Full=Bifunctional protein glmU;Includes:
   10::333     4e-06  25%  460 aa  GLMU_DESDG RecName: Full=Bifunctional protein glmU;Includes:
    6::351     5e-06  22%  430 aa  GLMU_SULNB RecName: Full=Bifunctional protein glmU;Includes:
    6::298     5e-06  25%  455 aa  GLMU_PSEE4 RecName: Full=Bifunctional protein glmU;Includes:
    1::206     5e-06  26%  446 aa  GLMU_PROMM RecName: Full=Bifunctional protein glmU;Includes:
    9::321     5e-06  23%  456 aa  GLMU_KLEP7 RecName: Full=Bifunctional protein glmU;Includes:
    4::160     5e-06  24%  452 aa  GLMU_JANMA RecName: Full=Bifunctional protein glmU;Includes:
    6::270     5e-06  24%  409 aa  GLGC_MYXXD RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   10::377     5e-06  26%  415 aa  GLGC_BIFA0 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::319     6e-06  24%  455 aa  GLMU_PSYWF RecName: Full=Bifunctional protein glmU;Includes:
    6::320     6e-06  25%  455 aa  GLMU_PSEU2 RecName: Full=Bifunctional protein glmU;Includes:
   10::103     6e-06  30%  490 aa  GLMU_MYCPA RecName: Full=Bifunctional protein glmU;Includes:
    9::204     6e-06  26%  449 aa  GLMU_MAGSA RecName: Full=Bifunctional protein glmU;Includes:
    9::321     6e-06  24%  456 aa  GLMU_ENT38 RecName: Full=Bifunctional protein glmU;Includes:
    4::353     6e-06  26%  428 aa  GLMU_ANAMM RecName: Full=Bifunctional protein glmU;Includes:
    4::353     6e-06  26%  428 aa  GLMU_ANAMF RecName: Full=Bifunctional protein glmU;Includes:
   10::186     6e-06  29%  414 aa  GLGC_ACIC1 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    1::336     8e-06  25%  433 aa  GLMU_HELP2 RecName: Full=Bifunctional protein glmU;Includes:
   22::218     8e-06  29%  425 aa  GLGC_ERWCT RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::220     1e-05  33%  225 aa  ISPD_CLOPS RecName: Full=2-C-methyl-D-erythritol 4-phosphate
    6::323     1e-05  21%  452 aa  GLMU_PSEHT RecName: Full=Bifunctional protein glmU;Includes:
    8::362     1e-05  22%  413 aa  GLGC_DEIGD RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    2::243     1e-05  26%  257 aa  RFBF_SALTY RecName: Full=Glucose-1-phosphate cytidylyltransferase; 
    4::150     1e-05  26%  452 aa  GLMU_HERAR RecName: Full=Bifunctional protein glmU;Includes:
   10::207     1e-05  26%  404 aa  GLGC_MYCVP RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::63      2e-05  39%  395 aa  ISPDF_DESVV RecName: Full=Bifunctional enzyme ispD/ispF;Includes:
    6::63      2e-05  39%  395 aa  ISPDF_DESVH RecName: Full=Bifunctional enzyme ispD/ispF;Includes:
    9::180     2e-05  24%  473 aa  GLMU_POLNA RecName: Full=Bifunctional protein glmU;Includes:
    8::172     2e-05  30%  461 aa  GLMU_HYPNA RecName: Full=Bifunctional protein glmU;Includes:
    7::326     2e-05  25%  474 aa  GLMU_ACIAC RecName: Full=Bifunctional protein glmU;Includes:
   22::218     2e-05  25%  425 aa  GLGC_PECCP RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::333     2e-05  25%  431 aa  GLMU_WOLSU RecName: Full=Bifunctional protein glmU;Includes:
   14::210     2e-05  26%  451 aa  GLMU_GRABC RecName: Full=Bifunctional protein glmU;Includes:
   27::321     2e-05  23%  485 aa  GLMU_CORGB RecName: Full=Bifunctional protein glmU;Includes:
    9::321     2e-05  23%  456 aa  GLMU_CITK8 RecName: Full=Bifunctional protein glmU;Includes:
   10::207     2e-05  27%  404 aa  GLGC_MYCUA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   10::207     2e-05  27%  404 aa  GLGC_MYCMM RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  344::392     2e-05  47%  721 aa  EI2BE_HUMAN RecName: Full=Translation initiation factor eIF-2B
    8::319     3e-05  23%  458 aa  GLMU_THIDA RecName: Full=Bifunctional protein glmU;Includes:
    7::223     3e-05  26%  476 aa  GLMU_DIAST RecName: Full=Bifunctional protein glmU;Includes:
   18::315     3e-05  26%  486 aa  GLMU_COREF RecName: Full=Bifunctional protein glmU;Includes:
   86::432     3e-05  26%  516 aa  GLGL1_MAIZE RecName: Full=Glucose-1-phosphate adenylyltransferase
    7::268     3e-05  28%  417 aa  GLGC_ACIBL RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   11::165     4e-05  29%  454 aa  GLMU_JANSC RecName: Full=Bifunctional protein glmU;Includes:
    6::65      4e-05  37%   68 aa  GLMU_BACME RecName: Full=Bifunctional protein glmU;Includes:
   10::103     5e-05  29%  490 aa  GLMU_MYCA1 RecName: Full=Bifunctional protein glmU;Includes:
    8::157     5e-05  26%  473 aa  GLMU_HALHL RecName: Full=Bifunctional protein glmU;Includes:
    6::224     5e-05  26%  429 aa  GLMU_CAMLR RecName: Full=Bifunctional protein glmU;Includes:
   10::109     5e-05  35%  487 aa  GLMU_ANADF RecName: Full=Bifunctional protein glmU;Includes:
   21::411     7e-05  25%  413 aa  GLGC_FRASN RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   13::277     7e-05  25%  409 aa  GLGC_CORGB RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   17::77      9e-05  40%  246 aa  ISPD_CLOTE RecName: Full=2-C-methyl-D-erythritol 4-phosphate
    9::213     9e-05  24%  452 aa  GLMU_RHOP2 RecName: Full=Bifunctional protein glmU;Includes:
    9::326     9e-05  22%  455 aa  GLMU_HAMD5 RecName: Full=Bifunctional protein glmU;Includes:
   27::227     9e-05  23%  485 aa  GLMU_CORGL RecName: Full=Bifunctional protein glmU;Includes:
    8::212     1e-04  25%  458 aa  GLMU_PSYA2 RecName: Full=Bifunctional protein glmU;Includes:
    7::268     1e-04  29%  405 aa  GLGC_PHOPR RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::273     1e-04  25%  405 aa  GLGC_CORGL RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  340::388     1e-04  45%  717 aa  EI2BE_MOUSE RecName: Full=Translation initiation factor eIF-2B
   26::83      1e-04  28%  707 aa  EI2BE_DICDI RecName: Full=Translation initiation factor eIF-2B
   64::154     2e-04  38%  230 aa  YAIX_ECOLI RecName: Full=Putative uncharacterized acetyltransferase
   64::154     2e-04  38%  230 aa  YAIX_ECOL5 RecName: Full=Uncharacterized acetyltransferase yaiX;   
    8::321     2e-04  24%  480 aa  GLMU_POLSJ RecName: Full=Bifunctional protein glmU;Includes:
    5::83      2e-04  32%  452 aa  GLMU_MARMM RecName: Full=Bifunctional protein glmU;Includes:
   10::206     2e-04  27%  404 aa  GLGC_MYCA9 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  339::387     2e-04  43%  716 aa  EI2BE_RAT RecName: Full=Translation initiation factor eIF-2B
   33::94      2e-04  34%  291 aa  ISPD_BIFLO RecName: Full=2-C-methyl-D-erythritol 4-phosphate
   33::94      2e-04  34%  291 aa  ISPD_BIFLI RecName: Full=2-C-methyl-D-erythritol 4-phosphate
   33::94      2e-04  34%  291 aa  ISPD_BIFLD RecName: Full=2-C-methyl-D-erythritol 4-phosphate
   12::166     2e-04  27%  458 aa  GLMU_METFK RecName: Full=Bifunctional protein glmU;Includes:
   11::275     2e-04  28%  406 aa  GLGC_STRAW RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   10::181     2e-04  27%  404 aa  GLGC_MYCTU RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   10::181     2e-04  27%  404 aa  GLGC_MYCTA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   10::181     2e-04  27%  404 aa  GLGC_MYCBT RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   10::181     2e-04  27%  404 aa  GLGC_MYCBP RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   10::181     2e-04  27%  404 aa  GLGC_MYCBO RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  344::392     2e-04  45%  721 aa  EI2BE_RABIT RecName: Full=Translation initiation factor eIF-2B
   27::174     3e-04  40%  261 aa  LPXA_AQUAE RecName:
    6::202     3e-04  29%  446 aa  GLMU_RHORT RecName: Full=Bifunctional protein glmU;Includes:
   18::87      3e-04  36%  253 aa  ISPD_IDILO RecName: Full=2-C-methyl-D-erythritol 4-phosphate
    7::215     3e-04  28%  436 aa  GLMU_CAMFF RecName: Full=Bifunctional protein glmU;Includes:
   10::180     3e-04  28%  404 aa  GLGC_MYCPA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::273     3e-04  24%  404 aa  GLGC_AZOSE RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   14::129     5e-04  32%  159 aa  Y304_METJA RecName: Full=Uncharacterized protein MJ0304;
    5::58      5e-04  42%  201 aa  MOBA_PYRKO RecName: Full=Probable molybdopterin-guanine
    7::66      5e-04  36%  229 aa  ISPD_CLOBL RecName: Full=2-C-methyl-D-erythritol 4-phosphate
    8::212     5e-04  25%  458 aa  GLMU_PSYCK RecName: Full=Bifunctional protein glmU;Includes:
    3::61      6e-04  34%  233 aa  LICC_HAEIN RecName: Full=Protein licC;
    7::111     6e-04  26%  244 aa  ISPD_CORDI RecName: Full=2-C-methyl-D-erythritol 4-phosphate
    1::218     6e-04  27%  226 aa  ISPD_CLOB8 RecName: Full=2-C-methyl-D-erythritol 4-phosphate
    6::163     6e-04  28%  455 aa  GLMU_COXB2 RecName: Full=Bifunctional protein glmU;Includes:
   10::99      8e-04  29%  488 aa  GLMU_ANADE RecName: Full=Bifunctional protein glmU;Includes:
    7::107     8e-04  26%  453 aa  GLMU_AGRT5 RecName: Full=Bifunctional protein glmU;Includes:
    1::355

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKAIVLCAGKGTRLRPLTFTTAKHLIPIANKPILFYSLENIARAGIEEVGIVVSPHNAEEFKSIVGTGE
STRD_STRGR      --KALVLAGGTGTRLRPITHTSAKQLVPVANKPVLFYGLEAIRAAGIIDVGIVVGD-TADEIVAAVGDGS
RMLA_STRMU      --KGIILAGGSGTRLYPLTRAASKQLMPVYDKPMIYYPLSTLMLAGIKDILIISTPQDLPRFKELLQDGS
RMLA1_ECOLI     MRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGS
RMLA_SALAN      -RKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGS
RMLA1_SHIFL     -RKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGS
RMLA_SALTY      -RKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGS
SPSI_BACSU      --KGVILAGGNGSRLMPLTKAVNKHLLPVGPYPMIYWSIMKLQEAGIKDILLISQKEHMPQFYKLLGNGE
RMLA3_ECOLX     -RKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGS
RMLA_NEIMB      --KGIILAGGSGTRLYPITRGVSKQLLPVYDKPMIYYPLSVLMLAGIRDILVITAPEDNASFKRLLGDGS
GLMU_METM7      ---AIILCAGKGTRLYPITESRPKPMIPIAGKPILEHIIEKIENY-VEKIYLVVGXXXXXXXXXXXXNP-
GLMU_METM5      ---AIILCAGKGTRLHPITESRPKPMIPIAGKPILEHIIEKIEN-HVEKIYLVV---GFEKEKIIEYFNE
RMLA_NEIMA      --KGIILAGGSGTRLYPITRGVSKQLLPVYDKPMIYYPLSVLMLAGIRDILVITAPEDNASFKRLLGDGS
GLMU_METJA      ---AIILCAGKGERLRPLTENRPKPMIPIAGKPILQHIIEKVEDL-VDNIYLIVKYKK----EKIVDYFK
GLMU_META3      ---AVILCAGKGTRLMPLTENIPKPMLPVGGAPILERIINKIDKL-VENIYLIVKYE-----KEIIINHF
RMLA_NEIGO      --KGIILAGGSGTRLYPITRGVSKQLLPVYDKPMIYYPLSVLMLAGIRDILVITAPEDNAAFQRLLGDGS
RMLA2_SHIFL     --KGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPEDKGYFQRLLGDGS
RMLA2_ECOLI     --KGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPEDKGYFQRLLGDGS
RMLA_YEREN      --KGIVLAGGAGTRLHPITRGVSKQLLPVYDKPMIYYPISVLMLAGIQDILIISTPEDLPSFKRLLGDGS
RMLA_RHISN      --KGIILAGGSGTRLHPMTLVMSKQILPVYDKPMIFYPLTTLMLAGIREILIISTPHHMPLFQALLGDGS
GLMU_METVS      ---AVILCAGSGTRLYPITENRPKPMIPIAGKPILEHIIEKIEN-HVEKIYLVVGFEKEKIIDYFYGNE-
RMLA_XANCP      -RKGIILAGGSGTRLYPITKGVSKQLLPVYDKPMIYYPLSVLMLAGIRDILIINTPHEQALFQSLLGDGA
RMLA_XANCB      -RKGIILAGGSGTRLYPITKGVSKQLLPVYDKPMIYYPLSVLMLAGIRDILIINTPHEQALFQSLLGDGA
GLMU_METMP      ---AIILCAGKGTRLHPITESRPKPMIPIAGKPXXXXXXXXXXXXXXXXYLIV----GYQKEKIIDYFKD
ACBA_ACTS5      --RGILLAGGTGSRLRPVTWAVSKQLMPVYDKPMIYYPLATLVSCGIREILVITTETEAAQFQRLLGDGS
MPG1_SULAC      MVSAIVLAGGYATRLRPLSLTKPKALLPVLGKPLMDYTLYSLASSDVDTIYLVMADKVLDHVKQL-----
GMPPB_CAEBR     --KALILVGGYGTRLRPLTLTQPKPLVEFANKPMMLHQMEALAAVGVDTVVLAVS-YRAEQLEAMTVHAD
GMPPB_CAEEL     --KALILVGGYGTRLRPLTLTQPKPLVEFANKPMMLHQMEALAEVGVDTVVLAVSYRAEQLEQEMTVHAD
GMPPB_MOUSE     --KALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQMLEKEMKAQEQ
GMPPB_DANRE     --KALILVGGYGTRLRPLTLTVPKPLVEFCNKPILLHQVEALVKAGVRHVILAVSYMSELLEREMRAQEQ
GMPPB_HUMAN     --KALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVLEKEMKAQEQ
GMPPB_PIG       --KALILVGGYGTRLRPLTLSIPKPLVDFCNKPILLHQVEALASAGVDHVILAVSYMSQMLEKEMKAQEQ
GTAB2_STAS1     IKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGKHNQKELEMILQEKG
GMPPB_BOVIN     --KALILVGGYGTRLRPLTLSIPKPLADFCNKPILLHQVEALAAAGVDHVILAVSYMSQVLEKEMKAQEQ
GLGC_CLOBB      ---AMILAGGQGSRLGVLTKKLAKPAVPFGGKRIIDFPLSNCANSGIYTVG-VLTQYKPLELNAHIGIGK
GLGC_CLOBA      ---AMILAGGQGSRLGVLTKKLAKPAVPFGGKRIIDFPLSNCANSGIYTVG-VLTQYKPLELNAHIGIGK
GMPPB_DROPS     --RALILVGGYGTRLRPLTLSTPKPLVEFANKPILLHQLEALVDAGCRQVILAVSYRAEQMEKELKVEAD
MPG1_CRYNE      --KALILVGGFGTRLRPLTLSWPKPLVEFCNKAMILHQIEALVKAGVKDIVLAVNYRPEVMVSVLKKTEE
GTAB_BACSU      VRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKSKRDHFDYSPELER
GTAB1_STAS1     IKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAVAAGIEDIIIVTGKHNQKELEMILEEKG
GMPPB_DICDI     --KALILVGGFGTRLRPLTLSKPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRPQLMSQYLEPYEK
Y1334_METJA     IRKAVIPVAGFGTRLLPITKAQPKEMLPVVNKPIVQYVVEDLVEAGVKDILFVLEKSGKYELLKIIKEID
GTAB_STAHJ      IKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEASRAGIEDIIIVTGKHNQKELEMVLEEKG
MPG11_CANGA     --KGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNCRPEVMVETLQKYEK
GMPBB_XENLA     --KALILVGGYGTRLRPLTLSVPKPLVDFCNKPILLHQVEALVKAGVTHVILAVSYMSDMLEKEMKEQEK
GALU_PSEAE      IKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYAVEEALEAGLSEIGIVTGRRNTDKEKYLVGIRR
GLGC_BACAH      ---AMLLAGGKGSRLSALTKNLAKPAVPFGGKRIIDFTLSNCANSGIETVGILTQ-YQPLELHNYIGIGN
GTAB_STAES      ---------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEASKAGIEDIIIVTGKHNQKELEMVL---E
GTAB_STAEQ      ---------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEASKAGIEDIIIVTGKHNQKELEMVL---E
GMPBA_XENLA     --KALILVGGYGTRLRPLTLSVPKPLVDFCNKPILLHQVEALVKAGVTHVILAVSYMSDMLEKEMKEQEK
GMPPB_XENTR     --KALILVGGYGTRLRPLTLSVPKPLVDFCNKPILLHQVEALVKAGVNHVILAVSYMSDMLEKEMKEQEK
CAP3C_STRPN     VKKAVIPAAGLGTRFLPATKALAKEMLPIVDRPTIHFVIEEALRSGIEDILVVTSKRSIEDYELLKSVNE
MPG1_YEAST      --KGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNYRPEVMVETLKKYEK
GLGC_BACHK      ---AMLLAGGKGSRLSALTKNLAKPAVPFGGKRIIDFTLSNCANSGIETVGILTQ-YQPLELHNYIGIGN
GLGC_BACCZ      ---AMLLAGGKGSRLSALTKNLAKPAVPFGGKRIIDFTLSNCANSGIETVGILTQ-YQPLELHNYIGIGN
GLGC_BACAN      ---AMLLAGGKGSRLSALTKNLAKPAVPFGGKRIIDFTLSNCANSGIETVGILTQ-YQPLELHNYIGIGN
MPG12_CANGA     --KGLILVGGYGTRLRPLTLSVPKPLVEFCNRPMILHQIEALAEAGVTDIVLAVNYRPEVMVDTLKKYEK
GLGC_BACCR      ---AMLLAGGKGSRLSALTKNLAKPAVPFGGKRIIDFTLSNCANSGIETVGILTQ-YQPLELHNYIGIGN
GMPPB_DROME     --RALILVGGYGTRLRPLTLSTPKPLVEFANKPILLHQLEALVDAGCRQVILAVSYRAEQMEKELKVEAK
GLGC_BACCQ      ---AMLLAGGKGSRLSALTKNLAKPAVPFGGKRIIDFTLSNCANSGIETVGILTQ-YQPLELHNYIGIGN
MPG1_GIBZE      --KGLILVGGYGTRLRPLTLSVPKPLVEFANKPMIVHQIEALVAAGVTDIVLAVNYRPEVMEKFLAEYEE
GLGC_CLONN      ---AMILAGGQGTRLKILTKNNAKPAVPFGGKRIIDFTLSNCSNSGIDTIG-VLTQYEPHILNSHIGIGS
GLGC_CLOB8      ---AMILAGGQGSRLGVLTKKLAKPAVPFGGKRIIDFPLSNCSNSGIYTVG-VLTQYKPLELNAHIGIGE
GLGC_BACC1      ---AMLLAGGKGSRLSALTKNLAKPAVPFGGKRIIDFTLSNCANSGIETVGILTQ-YQPLELHNYIGIGN
MPG1_ASHGO      --KGLILVGGYGTRLRPLTLTVPKPLVEFCNRPMILHQIEALAAAGVTDIVLAVNYRPEVMVETLKKYEK
GALU_MYCPN      IRKAVIPAAGLGTRLLPATKAIPKEMLPLVNKPTIQYIVEEAVASGIKEILVIVSKHKDQEHQEIKDIAN
GLGC_CLOPS      ---AMILAGGQGSRLGVLTKNLAKPAVPFGGKRIIDFPLSNCSNSGIYTVG-VLTQYKPLKLNEHIGIGD
GALU2_PSEAE     IKKYLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVLEDHSYELENQIKGTDK
YTDA_BACSU      IKKAIIPAGGFGTRNLPVTKVIPKEMFPVGSKPVIHYLVEELKESGIEDILMVVSSHKVDYFDSSLAL-E
GTAB_STAAB      ---------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHSQKELEMVXXXXX
GTAB_STAAR      ---------GLGTRFLPATKAMPKEMLPILDKPTIQYIIEEAARAGIEDIIIVTGRHSQKELEMVXXXXX
GTAB_STAAW      ---------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHSQKELEMVXXXXX
GTAB_STAAS      ---------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHSQKELEMVXXXXX
GTAB_STAAN      ---------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHSQKELEMVXXXXX
GTAB_STAAM      ---------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHSQKELEMVXXXXX
GTAB_STAAC      ---------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHSQKELEMVXXXXX
GTAB_STAA8      ---------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHSQKELEMVXXXXX
GTAB_STAA3      ---------GLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHSQKELEMVXXXXX
GLGC_STRA3      ---ALILAGGQGTRLGKLTQSIAKPAVQFGGRRIIDFALSNCANSGINNVG-VITQYQPLELNTHIGNGS
GLGC_CLOPE      ---AMILAGGQGSRLGVLTKNLAKPAVPFGGKRIIDFPLSNCSNSGIYTVG-VLTQYKPLKLNEHIGIGD
GLGC_STRSV      ---ALILAGGQGTRLGKLTQSIAKPAVQFGGRRIIDFALSNCANSGIHNVG-VITQYQPLALNSHIGNGS
GLGC_BACCN      ---AMLLAGGKGSRLSALTKNLAKPAVPFGGKRIIDFTLSNCSNSGIETVGILTQ-YQPLELHNYIGIGN
MPG1_KLULA      --KGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALAAAGVTDIVLAVNYRPEVMVETLKKYED
HASC_STRPY      VRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVIEDHFDSNFENLQAKGK
HASC1_STRP8     VRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVIEDHFDSNFENLQAKGK
GLGC_MYCMO      ---AMILAGGQGTRLKNLTKKIAKPAVPFGAKRIIDFTLSNCINSGIDTVGVLTQYRPLSLLKHI-GSGI
HASC2_STRP8     VRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVIEDHFDSNFENLQAKGE
HASC2_STRP6     VRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVIEDHFDSNFENLQAKGK
HASC2_STRP3     VRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVIEDHFDSNFENLQAKGE
HASC2_STRP1     VRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVIEDHFDSNFENLQAKGE
HASC1_STRP6     VRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVIEDHFDSNFENLQAKGE
HASC1_STRP3     VRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVIEDHFDSNFENLQAKGK
CAP4C_STRPN     VRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVIEDHFDSNFELEYNLKE
GLGC_STRU0      ---ALILAGGQGTRLGKLTQNIAKPAVQFGGRRIIDFALSNCANSGIDNVG-VITQYQPLVLNSHIGNGS
GLGC_STRA5      ---ALILAGGQGTRLGKLTQSIAKPAVQFGGRRIIDFALSNCANSGINNVG-VITQYQPLELNTHIGNGS
GLGC_STRA1      ---ALILAGGQGTRLGKLTQSIAKPAVQFGGRRIIDFALSNCANSGINNVG-VITQYQPLELNTHIGNGS
GALU_SHIFL      VKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTSSKNSIEFDTSFELEA
GALU_ECOLI      VKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTSSKNSIEFDTSFELEA
GALU_ECOL6      VKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTSSKNSIEFDTSFELEA
GALU_ECO57      VKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTSSKNSIEFDTSFELEA
HASC1_STRP1     VRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVIEDHFDSNFENLQAKGK
GLGC_LACCB      ----MILAGGQGTRLGKLTKTTAKPSVPFGGRRIIDFTLSNLANSGVNTAG-VITQYQPLELNRHIQNGA
GLGC_LACC3      ----MILAGGQGTRLGKLTKTTAKPSVPFGGRRIIDFTLSNLANSGVNTAG-VITQYQPLELNRHIQNGA
MPG1_PICAN      --KGLILVGGYGTRLRPLTLSLPKPLVEFGNRPMILHQIEALANAGCTDIVLAVNYKPEVMVGALKQYEK
GLGC_STRP4      ---ALILAGGQGTRLGKLTQSIAKPAVQFGGRRIIDFALSNCANSGIHNVG-VVTQYQPLALNNHIGNGS
GLGC_DESHY      ---AMLLAGGQGSRLGCLTRNIPKPAVSFAGKRIIDFSLSNCSNSNIDTVG-VLTQYKPFALNTYINMGS
GLGC_STRGC      ---ALILAGGQGTRLGKLTQSIAKPAVQFGGRRIIDFALSNCANSGIHNVG-VITQYQPLALNSHIGNGS
GLGC_BACWK      ---AMLLAGGKGSRLSALTKNLAKPAVPFGGKRIIDFTLSNCANSGIETVGILTQ-YQPLELHNYIGIGN
MPG1_NEUCR      --KALILVGGFGTRLRPLTLTMPKPLVEFGNKRMILHQIEALAAAGVTDIVLAVNYRPEIMEKYLAEYEK
GLMU_ENTFA      ---AIILAAGKGTRMKSKLY---KVLHPVAGKPMVEHILDQVEQTEPTEIVTIVG-HGAEMIKS------
GLGC_STRZT      ---ALILAGGQGTRLGKLTQSIAKPAVQFGGRRIIDFALSNCANSGIHNVG-VVTQYQPLALNNHIGNGS
GLGC_STRZP      ---ALILAGGQGTRLGKLTQSIAKPAVQFGGRRIIDFALSNCANSGIHNVG-VVTQYQPLALNNHIGNGS
GLGC_STRZJ      ---ALILAGGQGTRLGKLTQSIAKPAVQFGGRRIIDFALSNCANSGIHNVG-VVTQYQPLALNNHIGNGS
GLGC_STRPN      ---ALILAGGQGTRLGKLTQSIAKPAVQFGGRRIIDFALSNCANSGIHNVG-VVTQYQPLALNNHIGNGS
GLGC_STRPJ      ---ALILAGGQGTRLGKLTQSIAKPAVQFGGRRIIDFALSNCANSGIHNVG-VVTQYQPLALNNHIGNGS
GLGC_STRPI      ---ALILAGGQGTRLGKLTQSIAKPAVQFGGRRIIDFALSNCANSGIHNVG-VVTQYQPLALNNHIGNGS
GLGC_STRR6      ---ALILAGGQGTRLGKLTQSIAKPAVQFGGRRIIDFALSNCANSGIHNVG-VVTQYQPLALNNHIGNGS
GLGC_STRPS      ---ALILAGGQGTRLAKLTQSIAKPAVQFGGRRIIDFALSNCANSGIHNVG-VVTQYQPLALNNHIGNGS
GLGC_STRP7      ---ALILAGGQGTRLGKLTQSIAKPAVQFGGRRIIDFALSNCANSGIHNVG-VVTQYQPLALNNHIGNGS
GLGC_STRP2      ---ALILAGGQGTRLGKLTQSIAKPAVQFGGRRIIDFALSNCANSGIHNVG-VVTQYQPLALNNHIGNGS
GLGC_DESHD      ---AMLLAGGQGSRLGCLTRNIPKPAVSFAGKRIIDFSLSNCSNSNIDTVG-VLTQYKPFALNTYINMGS
GLGC_BACLD      ---AMLLAGGKGSRLNALTKNLAKPAVPFGGKRIIDFALSNCANSGIHHVG-VLTQYQPLLLNSYIGIGE
GLGC_STRMU      ---ALILAGGQGTRLGKLTQSIAKPAVQFGGRRIIDFALSNCANSGINNVGIITQ-YQPLALNSHIGNGS
GALU_MYCGE      IRKAVIPAAGLGVRLLPATKAIPKEMLPLVNKPTIQYIVEEAVKSGIEQILVIVSKNKLQEHKEIEDIAN
GALU_HAEDU      --KVIIPVAGLGTRMLPATKAIPKEMLTIADKPLIQYIVNECVAAGIKEIVFVTSSKNADEVRSIVPN--
GALU_HAEIN      --KAVIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGIKEIVLVTSSKNAEEVRSICPK--
GLMU_AQUAE      --RAVILAAGLGTRFKS---EKPKVLHEILGKPMLWYVITNVRNGRIDDIAVVVG-HKAQE---VMEAFK
GLGC_STRS7      ---ALILAGGQGTRLGKLTQSIAKPAVQFGGRRIIDFALSNCANSGIHNVG-VITQYQPLALNNHIGNGS
GLMU_CLOTH      ---AVILAAGEGKRMKS---KKAKVVHEIQGIPLVEWVYRSVKNAGIDEVVLVVG-HKAEEVK------E
GLMU_BACSK      ---AVILAAGQGTRMKSKLY---KVLHPVCGKPMVEHVVDQVSKLEFDKTAVIVG-HGAEEVKKTLTE--
GLGC_THEAB      ---ALILAGGQGTRLGVLTEKIAKPAVQFGGKRLIDFTLSNCVNSGIYKIGVLTQPHLLNQH---IGIGK
GLGC_FERNB      ----LILAGGQGTRLGVLTEKIPKPAVQFGGKRIIDFTLSNCVNSGIYRIGVLTQPHLLNKH---IGIGK
GLGC_CLOAB      ---AMILAGGQGSRLGILTRRTAKPAVPFGGKRIIDFTLSNCSNSGIDTVG-VLTQYKPLALNSHIGIGS
GLGC_LACLM      ----LILAGGQGTRLGKLTKDVAKPAVPFGGRRIIDFALSNCANSNVKNVG-VITQYQPLTLNAHIGNGA
GLMU_BACLD      ---AVVLAAGQGTRMKSKLY---KVLHPVCGKPMVEHVVDEARKLSLEKLVTIVG-HGAEDVK------K
GLGC_LACPL      ----IILAGGQGTRLGKLTKDTAKPAVPFGGRRIIDFTLSNCANSGVNTVG-VITQYQPLELNAHIGSGA
GLGC_EUBE2      ---AMLLAGGQGSRLGVLTSKVAKPAVAFGGKRIIDFPLSNCINSGIDTVG-VLTQYQPLRLNTHIGIGI
GLMU_STAES      -RHAIILAAGKGTRMKSKKY---KVLHEVAGKPMVEHVLNNVKQAGVDQI-VTIIGHGAESVKDTLGN--
GLMU_STAEQ      -RHAIILAAGKGTRMKSKKY---KVLHEVAGKPMVEHVLNNVKQAGVDQI-VTIIGHGAESVKDTLGN--
GLMU_STAEP      -RHAIILAAGKGTRMKSKKY---KVLHEVAGKPMVEHVLNNVKQAGVDQI-VTIIGHGAESVKDTLGN--
GLGC_THENN      ---AMILAGGQGTRLGVLTERIAKPAVPFGGKRLIDFTLSNCVNSGIYRVG-VLTQYRPHVLAKHIGIGR
GLMU_LACSS      -KNAIILAAGKGTRMKSKLY---KVLHEVCGRPMVDHVLTEVEKTEPATVVTIVG-HGAEKVKDYLGD--
GLGC_THELT      ---ALILAGGHGKRLGVLTEKIAKPAVPFGGKRLIDFTLSNCVNSGIYHVGVLTQPHLLNNHINI-GRPW
GLMU_LACAC      -KYVVVLAAGKGTRMKSKLY---KVLHKVCGKTMVEHVVD--AASGVEPTEIV----------TVVGTGA
GLMU_GEOSW      ---AVILAAGQGTRMKSKQY---KVLHPVCGKPMVQHVVDQVLQLGIEKL-ITVVGFGAEQVKAQLGD--
GLGC_FUSNN      ---AMILAGGQGTRLKELTEDLAKPAVAFGGKRIIDFTLTNCSNSGIDTVG-VLTQYEPRILNNHIGRGS
GLGC_LACAC      ----LILAGGKGTRLGKLTSDQAKPAVPFGGRRIIDFTLSNCANSGVKNIGIITQ-YQPLLLNEHIGNGV
GLMU_CLOB6      ---AIILAAGKGKRMKS---SMPKVVHKVCGKEMINHVIDNVRKANIKDVNLVIGK-GSETVKE-----H
GLMU_BACHD      ---AVILAAGQGTRMKSKLY---KVLHSVCGKPMVQHVVDQVSALGFDEIVTIIG-HGADAVKSQLGE--
GLMU_BACA2      ---AVILAAGKGTRMKSKLY---KVLHPVCGKPMVEHVADEALKLSLAKLVTIVG-HGAEDVK------K
GLGC_THEP1      ---AMILAGGQGTRLGVLTERVAKPAIPFGGKRLIDFTLSNCVNSGIYRVG-VLTQYRPHVLSKHIGIGR
GLMU_STAAW      -RHAIILAAGKGTRMKSKKY---KVLHEVAGKPMVEHVLESVKGSGVDQVVTIVG-HGAESVKG------
GLMU_STAAS      -RHAIILAAGKGTRMKSKKY---KVLHEVAGKPMVEHVLESVKGSGVDQVVTIVG-HGAESVKG------
GLMU_STAAR      -RHAIILAAGKGTRMKSKKY---KVLHEVAGKPMVEHVLESVKGSGVDQVVTIVG-HGAESVKG------
GLMU_STAAC      -RHAIILAAGKGTRMKSKKY---KVLHEVAGKPMVEHVLESVKGSGVDQVVTIVG-HGAESVKG------
GLMU_STAA3      -RHAIILAAGKGTRMKSKKY---KVLHEVAGKPMVEHVLESVKGSGVDQVVTIVG-HGAESVKG------
GLMU_LISMH      ---AVVLAAGQGTRMKSKLY---KVLHPVCGKPMVEHVVDQISTLNVDKVVTIVG-HGAEKVQ------E
GLMU_BACSU      ---AVVLAAGQGTRMKSKLY---KVLHPVCGKPMVEHVVDEALKLSLSKLVTIVG-HGAEEVKKQLGD--
GLGC_LACLS      ----LILAGGQGTRLGKLTKDVAKPAVPFGGRRIIDFALSNCANSNVKNVG-VITQYQPLTLNAHIGNGA
GLMU_STAA8      -RHAIILAAGKGTRMKSKKY---KVLHEVAGKPMVEHVLESVKGSGVDQVVTIVG-HGAESVKG------
GLMU_LISMC      ---AVVLAAGQGTRMKSKLY---KVLHPVCGKPMVEHVVDQISTLNVDKVVTIVG-HGAEKVQ------E
GLMU_EXIS2      ---AVILAAGKGTRMKSKLY---KVLHPVAGKPMVQHVVDQLTTLGVTRQVVIVG-HGAESVKEVLGTS-
GLMU_CLOK5      ---AIILAAGEGKRMKS---SKPKVLHKICGKEMINVVIDVVKKAQIKDINVVIGK-NSEKVKKATEVKN
GLMU_CLOK1      ---AIILAAGEGKRMKS---SKPKVLHKICGKEMINVVIDVVKKAQIKDINVVIGK-NSEKVKKATEVKN
GLGC_THESQ      ---AMILAGGQGTRLGVLTERIAKPAVPFGGKRLIDFTLSNCVNSGIYRVG-VLTQYRPHVLSKHIGIGR
GLGC_LACLA      ----LILAGGQGTRLGKLTKDVAKPAVPFGGRRIIDFALSNCANSNVKNVG-VITQYQPLTLNAHIGNGA
GLMU_LISW6      ---AVVLAAGQGTRMKSKLY---KVLHPVCGKPMVEHVVDQISTLDVDKVVTIVG-HGAEKVQ------E
GLMU_LISMF      ---AVVLAAGQGTRMKSKLY---KVLHPVCGKPMVEHVVDQISTLNVDKVVTIVG-HGAEKVQ------E
GLMU_CLOBB      -KCALVLAAGQGKRIKS---DLPKVLHKVCGKEMVNHVIDTIRKAGIQDANIIIGK-GAELVKE--RTEE
GLMU_BREBN      ---AVVLAAGQGTRMKSKLY---KVLHPVCGKPMVQHVVDTMASMQVQDIVVVVG-HGADAVRAKLGED-
GLGC_EXIS2      ---AMLLAGGEGKRLGALTKHTAKPAVAFGGKRIIDFPLSNCTNSGIDTVG-VLTQYEPLELNRYLGIGS
MPG1_CANAL      --KGLILVGGYGXXXXXXXXXXXXXXVEFGNRPMILHQIEALAAAGVTDIVLAVNYRPEVMVSTLKKYEE
GLMU_STAAN      -RHAIILAAGKGTRMKSKKY---KVLHEVAGKPMVEHVLESVKGSGVDQVVTIVG-HGAESVKG------
GLMU_STAAM      -RHAIILAAGKGTRMKSKKY---KVLHEVAGKPMVEHVLESVKGSGVDQVVTIVG-HGAESVKG------
GLMU_LISMO      ---AVVLAAGQGTRMKSKLY---KVLHPVCGKPMVEHVVDQISTLNVDKVVTIVG-HGAEKVQ------E
GLMU_DESAP      ---AVVLAAGRGTRMKS---RRPKVLHRVAGRPMVGYVMEAVREAGANRI-IVVAGYGHEEVAAVVNE--
GLMU_STAAB      -RHAIILAAGKGTRMKSKKY---KVLHEVAGKPMVEHVLESVKGSGVDQVVTIVG-HGAESVKG------
GLMU_LACJO      -KYVVILAAGKGTRMKSKLY---KVLHKVCGKTMVEHVVEAAKGTNPDKI-ITVVGNGAESVKDVLAGQS
GLMU_GEOKA      ---AVILAAGQGTRMKSKRY---KVLHPICGKPMVQHVIDQVSKLGVEKA-IAVVGFGAEQVK------E
MPG1_EMENI      --------------MRPLTLTLPKPLVEFGNRPMILHQVESLAAAGVTDIVLAVNYRPDVMVSALKKYEE
GLMU_STAHJ      -RNAVILAAGKGTRMKSNKY---KVLHKVAGKSMVEHVLTNVKNAGVNQIVTIVG-HGAEDVK------E
GLMU_LISIN      ---AVVLAAGQGTRMKSKLY---KVLHPVCGKPMVEHVVDQISTLDVDKVVTIVG-HGAEKVQ------E
GLGC_THEMA      ---AMILAGGQGTRLGVLTERIAKPAVPFGGKRLIDFTLSNCVNSGIYRVG-VLTQYRPHVLSKHIGIGR
GLGC_BACSU      MKKAMLLAGGKGSRLSGLTKNMAKPAVSFGGKRIIDFTLSNCSNSGIDTVGILTQ-YQPLELNSYIGIGS
GLMU_BACHK      ---AVILAAGKGTRMKSKLY---KVLHPVCGKPMVQHVVDQVSQLGLQKLVTVVG-HGAEMVQEQLGNVS
GLMU_CLOBM      ---AIILAAGKGKRMKS---SMPKVVHKVCGKEMVNHVIDNVRKANISDVNLVIGK-GSETVKE-----H
GLMU_CLOBA      -KCALVLAAGQGKRIKS---DLPKVLHKVCGKEMVNHVIDTIRKAGIQDANIIIGK-GAELVKE--RTEE
GLMU_BACCN      ---AVILAAGKGTRMKSKLY---KVLHPVCGKPMVQHVVDQVSQLGLQKLVTVVG-HGAEKVQEQLGNVS
GLGC_THEM4      ---ALILAGGQGTRLGVLTEKIAKPAVQFGGKRLIDFTMSNCVNSGIYKIGVLTQPHLLNRH---IGIGK
GLGC_LACS1      ----VILAGGKGTRLGKLTHNQAKPAVPFGGRRIIDFTLSNCVNSGVKNIG-VITQYQPLNLNAHIGNGA
GLGC_DESRM      ---AMLLAGGQGSRLGVLTKKLAKPAVPFGGRRIIDFTLSNCNNSGFDTVG-VLTQYQPLALNTYIGIGS
GLMU_LACS1      -KYAIILAAGQGTRMKSKLY---KVLHPVCGKPMVDHVLTEIEKNNMDEIVTVVG-HGAEMVEKTLGD--
GLMU_LACGA      -KYVVILAAGKGTRMKSQLY---KVLHKVCGKTMVEHVV-NAAKGTNPDKIITVVGNGADSVKDVLAGQS
GLMU_BACWK      ---AVILAAGKGTRMKSKLY---KVLHPVCGKPMVQHVVNEVSQLGLQKLVTVVG-HGAEKVQEQLGNVS
GLMU_CLOBK      ---AIILAAGKGKRMKS---SMPKVVHKVCGKEMVNHVIDNVRKANIKDVNLVIGK-GSETVKE-----H
GLMU_BACCR      ---AVILAAGKGTRMKSKLY---KVLHPVCGKPMVQHVVDQVSQLGLQKLVTVVG-HGAEMVQEQLGNVS
GLMU_BACCQ      ---AVILAAGKGTRMKSKLY---KVLHPVCGKPMVQHVVDQVSQLGLQKLVTVVG-HGAEMVQEQLGNVS
GLMU_BACC7      ---AVILAAGKGTRMKSKLY---KVLHPVCGKPMVQHVVDQVSQLGLQKLVTVVG-HGAEMVQEQLGNVS
GLMU_BACC4      ---AVILAAGKGTRMKSKLY---KVLHPVCGKPMVQHVVDQVSQLGLQKLVTVVG-HGAEMVQEQLGNVS
GLMU_BACC2      ---AVILAAGKGTRMKSKLY---KVLHPVCGKPMVQHVVDQVSQLGLQKLVTVVG-HGAEMVQEQLGNVS
GLMU_BACC1      ---AVILAAGKGTRMKSKLY---KVLHPVCGKPMVQHVVDQVSQLGLQKLVTVVG-HGAEMVQEQLGNVS
GLGC_GEOTN      MKKAMLLAGGQGSRLRSLTTNIAKPAVPFGGKRIIDFTLSNCTNSGIDTVG-VLTQYQPLLLHSYIGIGS
GLGC_CLOK5      ---SMILAGGQGSRLGILTKKLAKPAVPFGGKRIIDFVLSNCSNSGIYTVG-VLTQYKPLELNSHIGIGT
GLMU_LACBA      -RNTIILAAGKGTRMKSKLY---KVLHKVCGKAMVDHVLTQVEKTDMSKIVTVVG-YGADEVKSTLGD--
MPG1_SCHPO      --KALILVGGFGXXXXXXXXXXXXXXVEFGNKPMILHQVEALAAAGVTDIVLAVNYRPEIMVEALKKYEK
GLMU_THESQ      --RALVLAAGKGTRMKS---KIPKVLHPLSGKPMIEWVVETAGKVA-QKVGVVLG-FEAELVRKTLPEW-
GLMU_THEP1      --RALVLAAGKGTRMKS---KIPKVLHPLSGKPMIEWVVETAGKVA-QKVGVVLG-FEAELVRKTLPEW-
GLMU_CLOBH      ---AIILAAGKGKRMKS---SMPKVVHKVCGKEMVNHVIDNVRKANIKDVNLVIGK-GSETVKE-----H
GLMU_CLOB1      ---AIILAAGKGKRMKS---SMPKVVHKVCGKEMVNHVIDNVRKANIKDVNLVIGK-GSETVKE-----H
GLMU_BACCZ      ---AVILAAGKGTRMKSKLY---KVLHPVCGKPMVQHVVDQVSQLGLQKLVTVVG-HGAEMVQEQLGNVS
GLMU_BACC3      ---AVILAAGKGTRMKSKLY---KVLHPVCGKPMVQHVVDQVSQLGLQKLVTVVG-HGAEMVQEQLGNVS
GLMU_BACC0      ---AVILAAGKGTRMKSKLY---KVLHPVCGKPMVQHVVDQVSQLGLQKLVTVVG-HGAEMVQEQLGNVS
GLMU_BACAN      ---AVILAAGKGTRMKSKLY---KVLHPVCGKPMVQHVVDQVSQLGLQKLVTVVG-HGAEMVQEQLGNVS
GLMU_BACAH      ---AVILAAGKGTRMKSKLY---KVLHPVCGKPMVQHVVDQVSQLGLQKLVTVVG-HGAEMVQEQLGNVS
GLMU_BACAC      ---AVILAAGKGTRMKSKLY---KVLHPVCGKPMVQHVVDQVSQLGLQKLVTVVG-HGAEMVQEQLGNVS
GLMU_BACAA      ---AVILAAGKGTRMKSKLY---KVLHPVCGKPMVQHVVDQVSQLGLQKLVTVVG-HGAEMVQEQLGNVS
GLMU_CLOBJ      ---AIILAAGKGKRMKS---SMPKVVHKVCGKEMVNHVIDNVRKANIKDVNLVIGKGS----KTVKEHTK
GLGC_CLOTH      ---ALLLAGGQGSRLGVLTKNIAKPAVLYGGKRIIDFSLSNCVNSDIDTVG-VLTQYQPLELNAHIGIGK
GLGC_BACST      MKKAMLLAGGQGSRLRSLTTNIAKPAVPFGGKRIIDFTLSNCTNSGIDTVG-VLTQYQPLLLHSYIGIGS
GLMU_PEDPA      -KNTIILAAGQGTRMKSKLY---KVLHQVCGKAMVDHMLTQVEKTNMDHIVTIVG-HGAEKVRELLGD--
GLMU_GEOTN      ---AVILAAGQGTRMKSKLY---KVLHPVCGKPMVQHVVDQVSKLGVEKT-IAVVGFGAEQVK------E
GLMU_CLOPE      -KCAIILAAGQGTRIKS---KLPKVLHKACGKEMVNHVIDAMRNAEIEDVNVIIGK-GAELVKERT-TSR
EXON_RHIME      VRKAVIPVAGNGTRFLPATKAVPKEMLTIVDRPVVQYAVDEARQAGIEHIVFVTSRNKPELISSLSRSGK
GLGC_THERP      ----MILAGGQGERLSILSRQRAKPAVPFGGKRIIDFALSNCVNSGLYDVAVLTQPHSLNEH---IGHGR
GLMU_STRU0      ---AIILAAGKGTRMKS---DLPKVLHQVSGLTMLEHVFRSVAHI-TPQMNVTVIGHKAELVQEVLKEKS
GLMU_THEYD      ----VILAAGLGTRMKS---SKPKVLHRILEKPIIDYVIDCAKSLNPFNSFVVINP----SLKEVAEHLE
GLMU_LACLA      -KFAIVLAAGKGTRMKS---ALPKVLHQVAGKSMLAHVLTSVSEVEIAK-NVVIVGHEADRVIATLPKGT
GLMU_CLOBL      ---AIILAAGKGKRMKS---SMPKVVHKVCGKEMVNHVIDNVRKANIKDVNLVIGK-GSETVKE-----H
MPG1_YARLI      --KGLILVGGYGXXXXXXXXXXXXXXVEFGNKPMILHQVESLAAAGVKDIVLAVNYRPEVMIETLKKYEE
GLMU_LACRJ      -RNAIILAAGKGTRMRSKLY---KVLHQVCGKTMVEHVLTQLEKAKIDNI-ITIVGFGAETVE------Q
GLMU_LACRD      -RNAIILAAGKGTRMRSKLY---KVLHQVCGKTMVEHVLTQLEKAKIDNI-ITIVGFGAETVE------Q
GLMU_CLOPS      -KCAIILAAGQGTRIKS---KLPKVLHKACGKEMVNHVIDAMRNAEIDDVNVIIGK-GAELVKERT-TSK
GLMU_CLOP1      -KCAIILAAGQGTRIKS---KLPKVLHKACGKEMVNHVIDAMRNAEIDDVNVIIGK-GAELVKERT-TSR
GLMU_CLONN      -KSAVILAAGKGTRMKS---ALPKVLHKVCGKEMVNQVIDTLRKSDIEDIDLVIG-NGAEEVKKATKD--
GLMU_LACLM      -KFAIVLAAGKGTRMKS---ALPKVLHQVAGKSMLAHVLKSVSEVEIAK-NVVIVGHEADRVIATLPKGT
GLMU_CLOD6      --KAIILAAGKGTRMKS---KYPKVIHKVCGKEMVNHIIDVSKKSGVKDT-VVILGHEADVVK------E
GLMU_STRA5      ---AIILAAGKGTRMK-------SDLPKVMHKVSGITMLEHVFRSAIEPSKIVVIGHKAELVRDVLGDKS
GLMU_STRA1      ---AIILAAGKGTRMK-------SDLPKVMHKVSGITMLEHVFRSAIEPSKIVVIGHKAELVRDVLGDKS
GLMU_LACH4      -KYVVVLAAGKGTRMKSKLY---KVLHKVCGKTMVEHVVD--AASGINPTKIXXXXXXXXXXXXKILANK
GLMU_STRA3      ---AIILAAGKGTRMK-------SDLPKVMHKVSGITMLEHVFRSAIEPSKIVVIGHKAELVRDVLGDKS
GLMU_THEMA      --RALVLAAGKGTRMKS---KIPKVLHPLSGRPMIEWVIETAGKVA-QKVGVVLG-FEAELVRKALPEW-
GLMU_LACDB      -KYVVVLAAGKGTRMKTKLY---KVLHQVCGKAMVEHVVD-AARAVKPSKIVTIVGHGAEDVEKVLAGKS
GLGC_OCEIH      ----MLLAGGEGKRLGMLTKQGAKPAVPFGGKRIIDFTLSNCTNSGIQTVGILTQ-YAPLELNKHIGNGK
GLGC_BACCL      MKKAMLLAGGQGSRLRSLTKNIAKPAVPFGGKRIIDFTLSNCTNSGIDTVG-VLTQYQPLLLHSYIGIGS
GLMU_STAS1      -RHAIVLAAGKGTRMKSKKY---KVLHDVAGKTMIEHVADNVKQSGIDQLVTIVG-HGADSVK------E
GLMU_LACLS      -KFAIVLAAGKGTRMKS---ALPKVLHQVAGKSMLAHVLKSVSEVEIAK-NVVIVGHEADRVIATLPKGT
GLGC_CLOD6      MKKAMILAGGQGSRLGVFTKRIAKPAVSFGGKRIIDFVLSNCSNSGIDTVG-VLTQYRPLILNSHIGMGS
GALF_KLEPN      --KAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTSSKNAVENRQLLAEVQ
MPG1_DEBHA      --KGLILVGGYGXXXXXXXXXXXXXXVEFGNRPMILHQIEALAKAGVTDIVLAVNYRPEVMVSTLKKYEA
GLMU_EXISA      ---AVILAAGKGTRMKSKLY---KVLHPVLGKPMVEHVVDQLDQIGVSRQ-IVIVGHGAEAVQDTLGT--
GLGC_ANAVT      MKKAIILGGGAGTRLYPLTKLRAKPAVPVAGKRLIDIPVSNCINSEIFKIYVLTQFNSASLNRHIARTYN
GLMU_CLOB8      -KCALVLAAGQGKRIKS---DLPKVLHKVCGKEMLKHVIDSI-RKSXXXXXXXXXXXXAELVKE-----R
CELA_ACEXY      LKKAVLPVAGLGTRFLPATKCVPKEMLTVVDRPLIQYAIDEAREAGIEEFCLVISYELEDTLKARKKTSA
GLGC_DECAR      ---AIILAGGRGTRLKQLTDFRSKPAVPFAGKRILDFTLSNCVNSGIRKIG-VATQYKAHSLIRHIQRGW
GLMU_LACDA      -KYVVVLAAGKGTRMKSKLY---KVLHQVCGKAMVEHVVD-AARAVKPSKIVTIVGHGAEDVEKVLAGKS
GLMU_HYDS0      --KAIILAAGLGTR-----FKSEKHKVEMLGKPIIWYVLNYIKQSNIVDIALVVS-HKKESIIEAL-KHE
GLGC_SYNY3      ---AIILGGGAGTRLYPLTKLRAKPAVPLAGKRLIDIPVSNCINSEIVKI-YVLTQFNSASLNRHISRAY
GLGC_CLOCE      ---AMLLAGGQGSRLGVLTKNVAKPAVLYGGKRIIDFSLSNCTNSGIDTVG-VLTQYQPLKLNAHIGIGK
GLGC_ANASP      MKKAIILGGGAGTRLYPLTKLRAKPAVPVAGKRLIDIPVSNCINSEIFKIYVLTQFNSASLNRHIARTYN
GLMU_STRSZ      ---AIILAAGKGTRMNS---GLSKVLHKVSGLSMLEHVLKSVS-ALAPQKQLTVIGHQAEQVRAVLGD--
GLGC_BACHD      MKKEIVLAGGEGKRLGQLTRKLAKPAVYFGGKRIIDFPLSNCTNSGIDTVG-VLTQYEPLALNGHIGIGS
GLMU_PSEA6      ----VILAAGKGTRMKS---SMPKVLHPIGAKPMVQRIIDTVHQLGAASINLVYG-HQAEQLQQALGHNA
GALF_ECOLI      --KAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTASKNAVENRQLLAEVQ
GALF_ECO57      --KAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTASKNAVENRQLLAEVQ
GLMU_THETN      ---SVILAAGLGKRMKS---KYPKVVHKVCGKPMVKWVVEAAQEAGSKEV-IVVVGHGREMVEEVLGD--
GLMU_DESPS      ----VILAAGKGTRMKS---ELAKVLHPVFGRPMIQHVLASTAGLPSDK-RIIIIGHQRHAVREALADDA
GLGS1_VICFA     ----IILGGGAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLLNRHLSRAYASNLGGYK
GLMU_ALKMQ      --KAIILAAGTGTRMKS---KMPKVLHKVCGQTMLGHVID-VSKDSKAEECIVVVGHGAEEVQKTLPEG-
GALF_SHIFL      --KAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTASKNAVENRQLLAEVQ
MPG1_ASPOR      --KALILVGGFGXXXXXXXXXXXXXXVEFGNRPMILHQVESLAAAGVTDIVLAVNYRPDVMVSALKKYEE
GLMU_SHESH      ----VILAAGKGTRMRS---ELPKVLHPIAHKSMVQHVIDTAHSVGSDAIQLVYG-YGAEKLQSVLGEQQ
MPG1_ASPFU      --KALILVGGFGXXXXXXXXXXXXXXVEFGNRPMILHQVESLAAAGVTDIVLAVNYRPDVMVAALKKYEE
GLMU_STRSY      ---AIILAAGKGTRMK-------SDLPKVLHKVAGITMLEHVKRAAMEPAKTVIVGHKAELVQAVLEGQS
GLMU_STRS2      ---AIILAAGKGTRMK-------SDLPKVLHKVAGITMLEHVKRAAMEPAKTVIVGHKAELVQAVLEGQS
GLMU_FERNB      --KVLILAAGLGKRMKS---KYPKVVHKILGKPMINWVVDLGKAFG--EVGVVVG-HKADIVKSYLPED-
GLMU_STACT      ---AVVLAAGKGTRMKSKLY---KVLHKVADKTMIEHVVNSVQQSGADQIVTIVG-HGAERVKDTLGDQS
GLMU_LACF3      -KNAIILAAGKGTRMKS---KLHKVLHQVCGKTMVEHVLTQLQAADIQNIVTVVG-YGADTVKDALGD--
GLGS_ORYSJ      ----IILGGGAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLLNRHLSRAYGNNIGGYK
GLGS_HORVU      ----IILGGGAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLLNRHLSRAYGSNIGGYK
GLGS_BRANA      ----IILGGGAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLLNRHLSRAYASNMGGYK
GLMU_THELT      --RCIVLAAGMGVRMNS---KYAKVTHTVCGKPMIRWILDTVLNL-LDKVCVVVG-HDADSVKKLLP--E
GLMU_STRSV      ---AIILAAGKGTRMKS---DLPKVLHKVAGISMLEHVFRSVSAIDPEKTVTVVG-HKAELVEQVLAGQT
GLMU_DESHD      ---AVIMAAGKGTRMKS---KLPKVMHTLAGKPMLQHVLDCVRSVEIPR-SMVVLGHGREQIEATLDD--
GLMU_SYMTH      ---AVLLAAGHGTRMKS---DLIKVMHPLAGKPMIGHIVDNVRRAGLEDIVVVVG-YQQERIR------E
MPG1_TRIRE      --KGLILVGGFGXXXXXXXXXXXXXXVEFCNKPMIVHQIEALVAAGVTDIVLAVNYRPEIMEKFLAEYEE
GLMU_STRT2      ---AIILAAGKGTRMK-------SDLPKVLHKVSGITMLEHVFRAVIEPANVTVIGHKAELVREVLD-GQ
GLMU_DESHY      ---AVIMAAGKGTRMKS---KLPKVMHTLAGKPMLQHVLDCVRSVEIPR-SMVVLGHGREQIEATLDD--
GLGS_WHEAT      ----IILGGGAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVSLNRHLSRAYGSNIGGYK
GLGS_BETVU      ----IILGGGAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLLNRHLSRAYASNMGGYK
GLGS2_VICFA     ----IILGGGAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLLNRHLSRAYASNLGGYK
GALF_SALTY      --KAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTASKNAVENRQLLAEVQ
GALF_SALTI      --KAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTASKNAVENRQLLAEVQ
GLMU_OCEIH      ---AVILAAGQGTRMKS---KLHKMLHPVAGRPMVQHVVDQLQQVNLNKIVTIVG-FGAEKVKAQLGSSS
GLGS_SOLTU      ----IILGGGAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLLNRHLSRAYASNMGGYK
GLGS_SOLLC      ----IILGGGAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLLNRHLSRAYASNMGEYK
GLGC_SYNP6      ---AIILGGGAGSRLYPLTKQRAKPAVPLAGKRLIDIPVSNCINADINKIYVLLNRHLSQTYNLSSGFGN
GLGC_SYNP2      ----IILGGGAGTRLYPLTKLRAKPAVPLAGKRLIDIPVSNCINSEIHKIYILTQFNSASLNRHISRTYN
GLGC_SYNE7      ---AIILGGGAGSRLYPLTKQRAKPAVPLAGKRLIDIPVSNCINADINKIYVLLNRHLSQTYNLSSGFGN
GLGC_GEOLS      ---AMVLAGGKGERLMPLTLRRAKPSVTFGGKKIIDFVLSNLFNSGIRRMYILLNKHIRESWGKWTGLGE
GLGC_CYAA5      MKKAIILGGGAGTRLYPLTKLRAKPAVPLAGKRLIDIPVSNCINAEILKIYVLTQFNSASLNRHLTRTYN
GLMU_STRTD      ---AIILAAGKGTRMK-------SDLPKVLHKVSGITMLEHVFRAVIEPANVTVIGHKAELVREVLD-GQ
GLMU_STRT1      ---AIILAAGKGTRMK-------SDLPKVLHKVSGITMLEHVFRAVIEPANVTVIGHKAELVREVLD-GQ
GLGC_NOSP7      MKKSIILGGGAGTRLYPLTKLRAKPAVPVAGKRLIDIPVSNCINSEIFKIYVLTQFNSASLNRHIARTGF
GLMU_STRGC      ---AIILAAGKGTRMKS---DLPKVLHKVAGISMLEHVFRSVNAINPEKTVTVIG-HKAELVEQVLAGQT
GLMU_LACPL      -KNAIIMAAGKGTRMKS---KLVKVLHQVCGKSMVDHVLTQVEATHMANIVTIVG-HGAKDVEAALGD--
GLGC_CYAP7      ---AIILGGGAGTRLYPLTKLRAKPAVPLAGKRLIDIPVSNCINSEITKIYVLTQFNSASLNRHLSRTYN
GLMU_STRZT      ---AIILAAGKGTRMKS---DLPKVLHKVAGISMLEHVFRSVGAIQPEKTVTVVG-HKAELVEEVL-TGQ
GLMU_STRR6      ---AIILAAGKGTRMKS---DLPKVLHKVAGISMLEHVFRSVGAIQPEKTVTVVG-HKAELVEEVLAEQT
GLMU_STRP2      ---AIILAAGKGTRMKS---DLPKVLHKVAGISMLEHVFRSVGAIQPEKTVTVVG-HKAELVEEVLAEQT
GLGC_CYAP4      MKKAIILGGGAGTRLYPLTKQRAKPAVPLAGKRLIDIPVSNCINSEITHVYVLTQFNSASLNRHIARTYN
GLMU_SHEPA      ----VILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAYQVGSDAIQLVYG-YGADKLQARLGEQQ
GLMU_SHELP      ----VILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHQLGSEAIQLVYG-YGADKLQARLGEQA
GLMU_MYXXD      ---AVVLCAGKGTRMKS---EKAKVLHPILGRPLCAYPLKRALELGATSVVPVVG-HQAEAVKAVRGLFP
GLMU_STRP4      ---AIXLAAGKGTRMKS---DLPKVLHKVAGIPMLEYVXRSVGAIXPXKTVTVVG-HKAELVEEVL-TGQ
GLMU_SHEHH      ----VILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHQVGSDAIQLVYG-YGADKLQAKLGEQQ
GLGC_METFK      ---ALILAGGKGSRLRDLTNWTAKPAVPFGGKRIIDFPLSNCINSGVRRIG-VVTQYKAHTLIQHIQRGW
GLMU_SHEWM      ----VILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHNVGSDAIQLVYG-YGGEKLQSVLGEQQ
GLMU_ALKOO      --KAIILAAGAGTRMKS---KLPKVLHKVCGRTMLNHVID-VAKGSMVQECIVVVGHGAEDVK------E
GLMU_STRPI      ---AIILAAGKGTRMKS---DLPKVLHKVAGISMLEHVFRSVGAIQPEKTVTVVG-HKAELVEEVLAGQT
GLMU_STRP7      ---AIILAAGKGTRMKS---DLPKVLHKVAGISMLEHVFRSVGAIQPEKTVTVVG-HKAELVEEVLAGQT
GLMU_STRZJ      ---AIILAAGKGTRMKS---DLPKVLHKVAGISMLEHVFRSVGAIQPEKTVTVVG-HKAELVEEVLAGQT
GLMU_FUSNN      --KSIIMAAGKGTRMK----SDLPKVVHLAHKPMIVRIIDALNTLDVEE-NILILGHKREKVLEVLGND-
GLMU_SULDN      ----VILAAGKGSRMKS---SKAKVLHPICGKEMLYYIIKT-SRAISDDVSVVV----AHQRDAVVESMS
GLMU_STRPN      ---AIILAAGKGTRMKS---DLPKVLHKVAGISMLEHVFRSVGAIQPEKTVTVVG-HKAELVEEVLAGQT
GLMU_SHESM      ----VILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHSIGSDAIQLVYG-YGADKLKSALGEQQ
GLMU_CLOTE      ---AILLAAGEGKRMKS---ATPKVLHKVCGKEMVNHVIDALREANIEDVNVIVGK-KAKEVQL-----K
GLMU_PELCD      ---AVILAAGKGTRMKS---EQPKVLHPIAGKPMVTFPVAGALKHGCQPTVLVVG-HGAEAVQAELAEDP
GLMU_CALS8      ----IILAAGEGKRMKS---KYSKVVQKIMGKPMILYIIDEIEK-NFEDGRIVVVVGNKKEDVYKVLEGR
GLGC_SYNPW      ---AIILGGGAGTRLYPLTKMRAKPAVPLAGKYRLMYVLTQFNSASLNR-------HLSQTYNLSAGFGQ
GLGC_RHIME      ---AYVLAGGRGSRLKELTDRRAKPAVYFGGKAIIDFALSNALNSGIRRIG-VATQYKAHSLIRHLQRGW
GLMU_DESRM      ---AVILAAGKGTRMKS---NLPKVLHQLCGRPMLSHVL-NSXXXXXXXXXXXXXGFGAEQVTDFVGE--
GLMU_DEIGD      ----VILAAGQGTRMKS---ALPKVLHPVAGRPMXXXXXXXXXXLGARDI-VVVTGHGAEQVEALAGSGV
GLMU_STRMU      ---AIILAAGKGTRMK-------SDLPKVLHQVAGLTMLEHVKRA-VDTMNVTVVGHKAELVQKVLEDQS
GLMU_SHESA      ----VILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHSIGSNAIQLVYG-YGADKLKSALGEQQ
GLMU_CLOAB      -KCALILAAGKGKRMKS---DLPKVLHKVCDKEMVNHVIDTMRKSELQDVNVVIGK-GAELVREATSKKN
GLMU_BIFLI      LSAAIVLAAGEGTRMRS---NKPKVLHTFAGKTFLNRVMDSVAALNPDTLAVVVH----FQAERVAEAAR
GLGC_RHISN      ---AYVLAGGRGSRLKELTDRRAKPAVYFGGKAIIDFALSNALNSGIRRIG-VATQYKAHSLIRHLQRGW
GLGC_CYAP8      MKKAIILGGGAGTRLYPLTKLRAKPAVPLAGKRLIDIPLSNCINSEILKIYVLTQFNSASLNRHLTRTYN
GLGC2_ALHEH     ----LILAGGRGSRLMDLTTWRAKPAVPFGGKRIIDFTLSNCINSGIRRIGVLTQYKAHSLIRHLLGWGS
GLMU_SYNWW      ---AVILAAGKGLRMRSDLPKVAHR---VAGKPIILHVIQAVKEAGIEDIXXXXXXXXXXXQE--ICSGE
GLMU_SHEON      ----VILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHSIGSDAIQLVYG-YGADKLKSTLGEQ-
GLMU_PROM9      MLSVAILAAGKGTRMES---SIPKVLHKISGKSLLQRVIDSCVELNPDQI-FVITGHKSKEVQESIPDNK
GLMU_PROM5      MLTVAILAAGKGTRMAS---SLPKVLHKLSGKTLLQRVIDSCNELKPDKIFIIVG-HKSKEVKDSVFKNN
GLMU_SHESW      ----VILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHSIGSDAIQLVYG-YGADKLQASLGEQQ
GLMU_SHEPC      ----VILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHSIGSDAIQLVYG-YGADKLQASLGEQQ
GLGC_SALDC      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWS
GLMU_STRP6      ---AIILAAGKGTR---MTSDLPKVLHKVSGLTMLEHVFRSV-KAISPEKAVTVIGHKSEMVRAVLAD--
GLGC_RHILO      ---AYVLAGGRGSRLKELTDRRAKPAVYFGGKTIIDFALSNALNSGIRRLG-VATQYKAHSLIRHLQRGW
GLMU_MYCGI      ----VILAAGAGTRMKS---DTPKVLHSLAGRSMLAHSMHAVAGLGPRHLVVVVGKHREQVAPAALQIGE
GLGC_SALTY      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWS
GLGC_SALTI      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWS
GLGC_SALSV      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWS
GLGC_SALPK      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWS
GLGC_SALPA      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWS
GLGC_SALNS      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWS
GLGC_SALHS      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWS
GLGC_SALEP      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWS
GLMU_STRPM      ---AIILAAGKGTR---MTSDLPKVLHKVSGLTMLEHVFRSV-KAISPEKSVTVIGHKSEMVRAVLAD--
GLMU_SHESR      ----VILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHCIGSDAIQLVYG-YGADKLKLALGEQQ
GLMU_SHEAM      ----VILAAGKGTRMRS---DLPKVLHSVAHKPMVQHVIDTARELNADNINLVYG-YGGELLKAKLGEQP
GLMU_BDEBA      ----IALAAGKGTRMKPLP----KVLHPVAGRPMIEKVIQASKQAGAAEVRVIVG-HGQNLVRQVV---E
GLMU_AERHH      ----VILAAGKGTRMRS---SLPKVLHPVANKPMVSHVIETARKVGAEQLHLVYG-HGAELLKERIQASD
GMPPA_DICDI     --KAIILVGGKGTRFRPLSLDVPKLLFPIAGKPMIYHHIEACSKVNMKEIILIGFFQESVLSKFISETSK
GLMU_STRPF      ---AIILAAGKGTR---MTSDLPKVLHKVSGLTMLEHVFRSV-KAINPEKAVTVIGHKSEMVRAVLAD--
GLMU_THEM4      --KTLILAAGLGKRMNS---KYPKVIHKIFNKPMINWVIETAKNFG--KVAVVLG-HKYELVKKVIPED-
GLMU_STRP1      ---AIILAAGKGTR---MTSDLPKVLHKVSGLTMLEHVFRSV-KAISPEKSVTVIGHKSEMVRAVLAD--
GLMU_PROMP      MLTVAILAAGKGTR---MTSLLPKVLHKLSGKTLLQRVINSCNELKPDKIFIIVG-HKSKEVEESVLKNK
GLMU_NAUPA      MLQIIILAAGKGTRMKS---STAKVLHKLCGKSMIEYIIEESLKL-TPNIDIVLN----HQFEKVSETVK
GLGS_ARATH      ------------TRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLLNRHLSRAYASNMGGYK
GLGC_SALPC      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWS
GLGC_SALPB      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWS
GLGC_SALCH      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWS
GLGC_SALA4      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWS
GLMU_STRPG      ---AIILAAGKGTR---MTSDLPKVLHKVSGLTMLEHVFRSV-KAISPEKAVTVIGHKSEKVRAVLAD--
GLMU_STRP3      ---AIILAAGKGTR---MTSDLPKVLHKVSGLTMLEHVFRSV-KAINPEKAVTVIGHKSEMVRAVLAD--
GLMU_ALCBS      ----VILAAGKGTRMKS---ALPKVLHAVAGKPMVQHVVD--AAASLEPANVIVYGHGGEQVKASV-TGE
GLMU_ACTSZ      ----VILAAGKGTRMYS---DLPKVLHKVAGKPMVKHVIDTAKQLSAEQIHLIYG-HGADLLKERLADEP
GLGC_GEMAT      ---AYVLAGGRGSRLYELTDPRAKPAVYFGGKTIIDFALSNAINSGIRRIG-VATQYKAHSLIRHLQRGW
GLMU_STRPC      ---AIILAAGKGTR---MTSDLPKVLHKVSGLTMLEHVFRSV-KAISPEKAVTVIGHKSEKVRAVLAD--
GLMU_STRPB      ---AIILAAGKGTR---MTSDLPKVLHKVSGLTMLEHVFRSV-KAISPEKAVTVIGHKSEKVRAVLAD--
GLMU_RUTMC      ---AIILAAGKGSRMNS---SKPKVLQTLSNNTLLGHILSQV-KGLCDKVHVVYGFEGNQVQRKINDSN-
GLGC_SHISS      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_SHIFL      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_SHIF8      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_SHIDS      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_SHIBS      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_SHIB3      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_KLEP7      ---ALILAGGRGTRLKDLTIKRAKPAVHFGGKRIIDFALSNCINSGIRRIGVITQYQSHTLVQHIQRGWS
GLGC_ECOUT      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECOSM      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECOSE      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECOLU      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECOLI      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECOLC      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECOL6      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECOL5      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECOHS      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECODH      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECOBW      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECO8A      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECO81      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECO7I      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECO5E      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECO57      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECO55      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECO45      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_ECO24      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
GLGC_KLEP3      ---ALILAGGRGTRLKDLTIKRAKPAVHFGGKRIIDFALSNCINSGIRRIGVITQYQSHTLVQHIQRGWS
GMPAA_DANRE     MLKAVILIGGKGTRFRPLSFEVPKPLFPVAGVPMLQHHIEACSKPNMKEILLIGFYQPNEELNRFLSCAQ
GLMU_RHOFD      ----VIMAAGKGTRMKS---KLPKVLHLLAGRALLQHVVDTAAQLSARQV-VVITGHGAMEVEAAVSTGA
GLMU_NITSB      ----VILAAGQGTRMKS---SLPKVLHTICGRPMIWHIIKEAQK--ISDDITVILYHQAEIIKEYIQK-E
GLGC_SALAR      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWS
GLGC_RHOPT      ---AYVLAGGRGSRLMELTDWRAKPAVYFGGKSIIDFALSNALNSGIRRIA-VATQYKAHSLIRHLQRGW
GLGC_RHIE6      ---AYVLAGGRGSRLKELTDRRAKPAVYFGGKAIIDFALSNALNSGIRRIG-VATQYKAHSLIRHMQRGW
GLGC_ENTS8      ---ALILAGGRGTRLKDLTATRAKPAVHFGGKRIIDFALSNCINSGIRRIGVITQYQSHTLVQHIQRGWS
GLMU_CARHZ      --EGIILAAGKGTRMKS---DLPKVVHEVAEKPMVLRVYEXXXXXXXXXXXXXXX-YRKEKVEEILRG--
GLMU_BURXL      ----VILAAGTGKRMRS---ALPKVLHPLAGRPLLAHVIDT-ARTLKPTHLVVVIGHGAEAVRKAVAAPD
GLGL1_ARATH     ---SIILGGGAGTRLFPLTKRRAKPAVPIGGARLIDVPMSNCINSGINKVYILTQYNSASLNRHLASNGL
GLGC_RHITR      ---AYVLAGGRGSRLKELTDRRAKPAVYFGGKTIIDFALSNALNSGIRRIG-VATQYKAHSLIRHMQRGW
GLGC_MANSM      ----LILAGGRGSRLHELTDKRAKPALYFGNRRIIDFALSNCINSGLNRIG-VITQYAAHSLLRHLQTGW
GLGC_GEOMG      ---AMVLAGGKGERLAPLTLRRPKPGVAFGGKKIIDFVLSNMFNSGIKKVYILLMKHIRESWGKWAGLGE
GLGC_ENT38      ---ALILAGGRGTRLKDLTIKRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWS
GLGC_ECO27      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWS
YBB2_SCHPO      ISSAVILVGGRGTRFRPLSFDVPKPLFKIGGREMIYHHLAALSKIESVKDVFLVGFYDESVFKDFINVAS
GLMU_RUBXD      ---AVVLAAGKGTRMKS---NRAKVLHTLCGVPMVNYVIGAIXXXXXXXXXXXXG-HQAEQVRAVLPED-
GLMU_PROAC      MAAVIVLAAGGGTRMKS---TKSKLLHEVAGRPMLSWAI-GAARGLNPEHLVVVVGHRREQVEAHLAEDA
GLMU_GEOUR      ---AVILAAGKGTRMKS---NIVKVMHPLGGLPMVSWPVNTAREAGASNI-VLVTGHQSEKVQDFFEGQS
GLMU_ERWT9      ----VILAAGKGTRMYS---DLPKVLHLLAGKPMVQHVIDAARELNAQRVNLVYG-HGGELLKTALDDRS
GLMU_AGRRK      ---AIILAAGDSTRMKS---SISKVLHPIAGRPMIAHVMEAIARTDISAAALVVG-RNAEEVAAAADIG-
GLGL3_SOLTU     ---AIILGGGAGTRLFPLTKRRAKPAVPMGGARLIDVPMSNCINSGINKV-YILTQFNSASLNRHIARAY
GLGC_RHOPA      ---AYVLAGGRGSRLMELTDWRAKPAVYFGGKSIIDFALSNALNSGIRRIA-VATQYKAHSLIRHLQRGW
GLGC_HAES2      ----LILAGGRGSRLHELTDKRAKPALYFGNRRIIDFALSNCINSGLNRIGVVTQPQERGEFIDMLPARQ
GLGC_HAES1      ----LILAGGRGSRLHELTDKRAKPALYFGNRRIIDFALSNCINSGLNRIGVVTQPQERGEFIDMLPARQ
GLGC_FRAP2      ---ALVLAGGRGSRLYNLTDTRAKPAVYFGGKRIVDFALSNCLNSGIRRIGVVTQYKSHSLLRHIQGWGF
GLMU_SHEPW      ----VILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHEVGSDAIQLVYG-YGADKLQAKLGEQQ
GLMU_SACD2      MLEIIILAAGKGTRMRS---DKPKVLHTLAGKPFLEHVLDRSAELNADKVHVIIG-HGADMVREALA---
GLMU_ACHLI      ---ALVLAAGKGTRMKS---DIPKVAFPILRKPMIEYIVENIEKSSVEEIYLVLG-YKREVVEGIVKD--
GLGC_RHIEC      ---AYVLAGGRGSRLKELTDRRAKPAVYFGGKAIIDFALSNALNSGIRRIG-VATQYKAHSLIRHMQRGW
GLGC_ANADF      ---AMILAGGEGRRLDPLTRERAKPAVPFGGRRIVDFVLSNFANSGVLKMKVLVQ-YKSESLNAHIQRGW
GLMU_STRP8      ---AIILAAGKGTR---MTSDLPKVLHKVSGLTMLEHVFRSV-KAISPEKSVTVIGHKSEMVRAVLAD--
GLGC_ESCF3      ---ALILAGGRGTRLKDLTNKRAKPAVHFGGKRIIDFALSNCINSGIRRIGVITQYQSHTLVQHIQRGWS
GLGC_AGRRK      ---AYVLAGGRGSRLKELTDRRAKPAVYFGGKTIIDFALSNALNSGIRRIG-VATQYKAHSLIRHMQRGW
GLGC2_VIBPA     ---AVILAGGMGSRLSPLTDDRAKPAVPFGGKRIIDFTLTNCLNSGLRKI-LVLTQYKSHSLQKHLRDGW
GLMU_OLICO      ----LVLAAGEGTRMRS---SRPKVLHEVAGRSLLANVLLAAPAGKQDRLAVVVGP----DHQAVADEAR
GLMU_HAEDU      ----VILAAGKGTRMYS---DLPKVLHPIAGKSMVKHVIDTVKQMDAKQIHLVYG-HGGDLLKTHLKTEP
GLMU_BIFLO      LSAAIVLAAGEGTRMRS---NKPKVLHAFAGKTFLNRVMDSVAALNPDTLAVVVH----FQAERVAEAAR
GLMU_ARCB4      -KSIIILAAGAGTRMKS---DTPKVLHKISGKPMLYYSIKEALK--LSDDITVVLYHQFEKVKAEI---E
GLGC_FRATN      ---ALVLAGGRGSRLYNLTDTRAKPAVYFGGKRIIDFALSNCLNSGIRRIGVVTQYKSHSLLRHLQGWGF
GLMU_SERP5      ----VILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGAKNVHLVYG-HGGDLLKNTLTDGA
GLMU_BURCH      ----VILAAGTGKRMRS---ALPKVLHPLAGRPLLSHVIDT-ARTLQPSRLVVVVGHGAEQVKAAVAAPD
GLMU_BURCA      ----VILAAGTGKRMRS---ALPKVLHPLAGRPLLSHVIDT-ARTLQPSRLVVVVGHGAEQVKAAVAAPD
GLGC_RHIRD      ---AYVLAGGRGSRLKELTDRRAKPAVYFGGKAIIDFALSNALNSGIRRIG-VATQYKAHSLIRHLQRGW
GLGC_NITOC      ---ALILAGGRGSRLKNLTAWRAKPAVPIGGKRIIDFPLSNCVNSGVRRI-CVLTQYKAHSLVRHIQQGW
GLGC_FRATO      ---ALVLAGGRGSRLYNLTDTRAKPAVYFGGKRIIDFALSNCLNSGIRRIGVVTQYKSHSLLRHLQGWGF
GLGC_FRATH      ---ALVLAGGRGSRLYNLTDTRAKPAVYFGGKRIIDFALSNCLNSGIRRIGVVTQYKSHSLLRHLQGWGF
GLGC_FRATF      ---ALVLAGGRGSRLYNLTDTRAKPAVYFGGKRIIDFALSNCLNSGIRRIGVVTQYKSHSLLRHLQGWGF
GMPAB_XENLA     MLKAVILIGGKGTRFRPLSFEVPKPLFPVAGVPMVQHHIEACSKVNLKEILLIGFYQPNEALSSLLKAQQ
GLMU_BURPP      ----VILAAGTGKRMRS---ALPKVLHPLAGQPLLAHVIDT-ARTLKPTHLVVVVGHGAEAVRKAVAAPD
GLMU_BIFLD      LSAAIVLAAGEGTRMRS---NKPKVLHAFAGKTFLNRVMDSVAVLNPDTLAVVVH----FQAERVAEAAR
GLGC_NITEU      ---ALILAGGRGTRLKNLTDWRAKPAVPFGGKRIIDFTLSNCVNSGVRRIG-VVTQYKAQSLIRHIQRGW
GLGC_FRATM      ---ALVLAGGRGSRLYNLTDTRAKPAVYFGGKRIIDFALSNCLNSGIRRIGVVTQYKSHSLLRHLQGWGF
GLGC_AGRT5      ---AYVLAGGRGSRLKELTDRRAKPAVYFGGKAIIDFALSNALNSGIRRIG-VATQYKAHSLIRHLQRGW
GLMU_VIBCM      ----VILAAGKGTRMHS---NMPKVLHTLAGKPMVKHVIDTCNNLGAQNIHLVYG-HGGDQMQQAL-VNE
GLMU_VIBCH      ----VILAAGKGTRMHS---NMPKVLHTLAGKPMVKHVIDTCNNLGAQNIHLVYG-HGGDQMQQAL-ANE
GLMU_PROM0      MLSVAILAAGKGTRMES---SLPKVLHKISGKSLLQRVIDSCVELKPDQI-FVITGHKSKEVEKSISNEK
GLMU_CORJK      ----IVLAAGAGTRMKS---TTQKTLHSIGGRTLLSHSLH--AAAGIDPARIVVIGHGREQVPAVAEVAE
GMPAB_DANRE     MLKAIILIGGKGTRFRPLSFEVPKPLFPVAGVPMLQHHIEACAQVDMKEIMLIFYQPNDELNRFIYSAQQ
GLMU_BURP8      ----VILAAGTGKRMRS---ALPKVLHPLAGRPLLAHVIDTARTLNPTRLVVVVG-HGADQVRTAVAASD
GLGL1_SOLTU     ---AVILGGGEGTKLFPLTSRTATPAVPVGGYRLIDIPMSNCINSAINKIFVLTAPLNRHIARTYFGNGV
GLGC_NITMU      ---AMILAGGRGTRLRQLTDWRAKPAVPFGGKRIIDFPLSNCVNSGIRRIG-VATQYKAQSLISHIQQGW
GLMU_VIBC3      ----VILAAGKGTRMHS---NMPKVLHTLAGKPMVKHVIDTCNNLGAQNIHLVYGHGGDQMQQALVNES-
GLMU_SHEB9      ----VILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHKVGSDAIQLVYG-YGADKLKASLGEQQ
GLGC2_VIBVY     ----VILAGGMGSRLSPLTDDRAKPAVPFGGKRIIDFTLTNCLHSGLRKI-LVLTQYKSHSLQKHLRDGP
GLGC2_VIBVU     ----VILAGGMGSRLSPLTDDRAKPAVPFGGKRIIDFTLTNCLHSGLRKI-LVLTQYKSHSLQKHLRDGP
GLGC2_VIBCH     ---AVILAGGMGSRLSPLTDDRAKPAVPFGGKRIIDFTLTNCLHSGLRRI-LVLTQYKSHSLHKHLRNGP
GLMU_NITOC      ----IILAAGQGTRMHS---TLPKVLHQLAGRPLLSHVIATARQLNPAQI-IVVYGHGGETVPEAFRAAD
GLGC2_PSEA6     ---ALILAGGRGSRLHELTDWRAKPALYFGGKRIIDFPLSNCINSGIKRIGVVTQYKSHSLIRHLVRGWG
GLMU_SHEB2      ----VILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHKVGSDAIQLVYG-YGADKLQASLGEQQ
GLMU_RHOPS      ----IVLAAGEGTRMRS---SLPKVLHPVAGRXXXXXXXXXXXXXXDDKLAVVIGPDHADETKRIRPDAE
GLMU_NITEC      ----VILAAGMGKRMRS---TLPKVLHPLAGKPILFHVLDT-ARILSPTKICVIYGHGGELVRQTVGNDP
GLMU_HAEIG      ---AVILAAGKGTRMYS---DLPKVLHTIAGKPMVKHVIDTAHQLGAENIHLIYG-HGGDLMRSHLANEQ
GLGC_THICR      ---ALVLAGGEGSRLKDLTKWRAKPAVPFGGKRIIDFVLSNCVNSGIRKIGVLTQYKSHSLIRHVQRAWS
GLGC_MAGSA      ---ALILAGGRGSRLMDLTDWHAKPAIPFAGKRIVDFTLSNCINSGIRRIG-VLTQYKAHSLLQHIQRGW
GLGC_ANAD2      ---AMILAGGEGRRLDPLTRDRAKPAVPFGGRRIVDFVLSNMANSGILKMKVVVQ-YKSESLNTHVQRAW
GLMU_PECCP      ----VILAAGKGTRMYS---DLPKVLHKLAGKPMVQHVIDAAMTTGAQHVHLVYG-HGGDLLKH-----E
GLMU_NEIM0      ----VILAAGKGTRMYS---KMPKVLHRIGGKPMLGRVIDTAAALNPQNICVVVG-HGKEQVLDTVKRD-
GLGC_FRATW      ---ALVLAGGRGSRLYNLTDTRAKPAVYFGGKRIIDFALSNCLNSGIRRIGVVTQYKSHSLLRHLQGWGF
GLGC_CORA7      ---AIVLAGGEGKRLFPLTEDRAKPAVPFGGSRLIDFVLSNLVNAGFLKIA-VLTQYKSHSLDRHISQAW
GLGC_ANASK      ---AMILAGGEGRRLDPLTRDRAKPAVPFGGRRIVDFVLSNMANSGILKMKVVVQ-YKSESLNTHVQRAW
GMPPA_RAT       MLKAVILIGGKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVGMQEI-LLIGFYQPDETQFLEAAQQ
GLMU_NEIMF      ----VILAAGKGTRMYS---KMPKVLHRIGGKPMLGRVIDTAAALNPQNICVVIG-HGKDQVLNAVKRD-
GLMU_HAES1      ----VILAAGKGTRMYS---DLPKVLHKIAGKPMVKHVIDTAKKLSAAQIHLIYG-HGADLLKQHLADEP
GLGC_SHESA      ---ALILAGGRGSRLHELTDWRAKPALYFGGKRIIDFPLSNCINSGIRRVGVVTQYKSHSLIRHVMRGWG
GLGC_ROSDO      ---AFVLAGGRGSRLYELTDRRAKPAMYFGGKSIIDFPLSNAVNSGIRRIG-VATQYKAHSLIRHLQRGW
GLGC_HAEI8      ----LVLAGGRGSRLHELTDKRAKPALYFGNRRIIDFALSNCINSGLNRIG-VVTQYAAHSLLRHLQTGW
GLGC_DEIDV      ----MILAGGQGSRLAPLTQKRSKPSVPFGSKRIIDFAINNFMNSGVFSI-YVLTQYKAQSLTEHIQRGW
GMPAA_XENLA     MLKAVILIGGKGTRFRPLSFEVPKPLFPVAGVPMVQHHIEACSKVNLKEILLIGFYQPNEALNSLLKAQQ
GLMU_THICR      --KVIILAAGKGTRMRS---NLPKVLQPLAQKPLLSHVISTAQKLTNEPI-ITVIGHGAQRVVDVIGTD-
GLMU_RHILW      ---AVILAAGDSTRMKS---SKSKVLHPVAGRPMIAHVVEAVASAGISSVALVVG-RDAEE---VAKAAS
GLMU_HELMI      -RTAVVLAAGKGTRMKS---RQPKVLHEVAGQPMICHVLDALTDCGVAQ-PIVVIGHGGEAVR------Q
GLMU_GEOSL      ---AIILAAGKGTRMKS---GIVKVMHPLAGAPMVAWPVAVARQAGAGRIVAVVG-HQAERLREHFSNDA
GLMU_BUCAP      ----VILAAGKGTRMQS---SYPKVLHKLGGKTILEHVI-NIAKSVKPKKIILVYNNKEKEIKSKISDTS
GLGC_RHOP5      ---AYVLAGGRGSRLMELTDRRAKPAVYFGGKSIIDFALSNALNSGIRRIA-VATQYKAHSLIRHLQHGW
GMPPA_MOUSE     MLKAVILIGGKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVGMQEI-LLIGFYQPDETQFLEAAQQ
GLMU_SHEDO      ----VILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTANSLGSQAIQLVYG-YGADKLQASLGEQQ
GLMU_SHEB8      ----VILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHKVGSDAIQLVYG-YGADKLQASLGEQQ
GLMU_SHEB5      ----VILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHKVGSDAIQLVYG-YGADKLQASLGEQQ
GLMU_SALG2      ----VILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYG-HGGELLKQTLKDD-
GLMU_PROM2      MLSVAILAAGKGTRMES---SLPKVLHKISGKSLLQRVIDSCVELKPDQI-FVITGHKSKEVEKAIPNDK
GLMU_MANSM      MKKVVILAAGKGTRMYS---DLPKVLHKIAGKPMVKHVIDTAKQLSADQIHLIYG-HGADLLKSHLADEP
GLMU_HAES2      ----VILAAGKGTRMYS---DLPKVLHKIAGKPMVKHVIDTAKKLSAAQIHLIYG-HGADLLKQHLADEP
GLMU_CORA7      ---AIVLAAGAGTRMKS---STQKTLHEIGGRSXXXXXXXXXXXXNPEHLVVVVGHQRDQVSPAVDAISE
GLMU_ACTP7      ----VILAAGKGTRMYS---DLPKVLHTVAGKPMVQHVIDTAKQIDAKQIHLIYG-HGGELLQQRLSSEP
GLGC_METCA      ---ALILAGGRGSRLQKLTEWRAKPAVPFGGKRIIDFPLSNCVNSGIRQVG-VLTQYKADSLIRHIQQGW
GLGC_ANADE      ---AMILAGGEGRRLDPLTRDRAKPAVPFGGRRIVDFVLSNMANSGILKMKVVVQ-YKSESLNTHVQRAW
GMPPA_XENTR     MLKAVILIGGKGTRFRPLSFEVPKPLFPVAGVPMVQHHIEACSKVNLKEILLIGFYQPNEALSSLLKAQQ
GMPPA_PAPAN     MLKAVILIGGKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVGMQEI-LLIGFYQPDETQFLEAAQQ
GLMU_YERPY      ----VILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYG-HGGELLKKTLADPS
GLMU_YERPS      ----VILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYG-HGGELLKKTLADPS
GLMU_YERPP      ----VILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYG-HGGELLKKTLADPS
GLMU_YERPN      ----VILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYG-HGGELLKKTLADPS
GLMU_YERPE      ----VILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYG-HGGELLKKTLADPS
GLMU_YERPB      ----VILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYG-HGGELLKKTLADPS
GLMU_YERPA      ----VILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYG-HGGELLKKTLADPS
GLMU_YERP3      ----VILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYG-HGGELLKKTLADPS
GLMU_VIBFM      ---AVILAAGKGTRMYS---NKPKVLHTLAGKPMAKHVIDTCEGLGAQNIHLVYG-HGGDQMKAELGEE-
GLMU_VIBF1      ---AVILAAGKGTRMYS---NKPKVLHTLAGKPMAKHVIDTCEGLGAQNIHLVYG-HGGDQMKAELGEE-
GLMU_SALTI      ----VILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYG-HGGELLKQTLKDD-
GLMU_SALCH      ----VILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYG-HGGELLKQTLKDD-
GLGC_SHESR      ---ALILAGGRGSRLHELTDWRAKPALYFGGKRIIDFPLSNCINSGIRRVGVVTQYKSHSLIRHVMRGWG
GLGC_SHESM      ---ALILAGGRGSRLHELTDWRAKPALYFGGKRIIDFPLSNCINSGIRRVGVVTQYKSHSLIRHVMRGWG
GLGC_NOVAD      ---AYVLAGGRGSRLKELTDNRAKPAVYFGGKSIIDFALSNAINSGIRRIG-VATQYKAHSLIRHMQRAW
GLGC_CORDI      ---AIVLAGGEGKRLFPLTEDRAKPAVPFGGTRLIDFVLSNLVNAGYLKI-CVLTQYKSHSLDRHISQAW
GLMU_SILST      ----VILAAGKGTRMNS---DLPKVLHQIAHAPML----EHAMRAGDPERTVVVAGHEAEMVRAATA---
GLMU_SHEFN      ----VILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTANSLGSSAIQLVYG-YGADKLQAALGEQA
GLMU_SALTY      ----VILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYG-HGGELLKQTLKDD-
GLMU_SALPK      ----VILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYG-HGGELLKQTLKDD-
GLMU_SALPB      ----VILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYG-HGGELLKQTLKDD-
GLMU_SALPA      ----VILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYG-HGGELLKQTLKDD-
GLMU_SALNS      ----VILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYG-HGGELLKQTLKDD-
GLMU_SALHS      ----VILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYG-HGGELLKQTLKDD-
GLMU_SALEP      ----VILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYG-HGGELLKQTLKDD-
GLMU_SALDC      ----VILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYG-HGGELLKQTLKDD-
GLMU_SALA4      ----VILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYG-HGGELLKQTLKDD-
GLMU_RHIL3      ---AVILAAGDSTRMKS---SKSKVLHPVAGRPMIAHVVEAVASAGISSVALVV----GRDAEDVAKAAS
GLMU_HAEIN      ---AVILAAGKGTRMYS---DLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYG-HGGDLMRTHLANEQ
GLMU_ALTMD      ----VVLAAGKGTRMKS---SLPKVLHKVGGVPMVQRIINTVRSLGADNIHLVYG-HGGDQLKATV-VEE
GLGC_SHEON      ---ALILAGGRGSRLHELTDWRAKPALYFGGKRIIDFPLSNCINSGIRRVGVVTQYKSHSLIRHVMRGWG
GLGC_PASMU      ----LILAGGRGSRLYELTDKRAKPALYFGNRRIIDFALSNCLNSGLNRIG-VVTQYAAHSLLRHLQNGW
GMPPA_HUMAN     MLKAVILIGGKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVGMQEI-LLIGFYQPDETQFLEAAQQ
GLMU_RHIEC      ---AVILAAGDSTRMKS---SKSKVLHPVAGRPMIAHVVEAVASAGISSVALVVGRDAGEVAKSIDGVG-
GLMU_RHIE6      ---AVILAAGDSTRMKS---SKSKVLHPVAGRPMIAHVVEAVASAGISSVALVVG-RDAEE---VAKAAS
GLMU_HAEPS      ----VILAAGKGTRMYS---DLPKVLHPIAGKPMVKHVIDTAKQLSAKQIHLIYG-HGGDLLQQRLSAEP
GLMU_HAEIE      ---AVILAAGKGTRMYS---DLPKVLHTIAGKPMVKHVIDTAHQLGAENIHLIYG-HGGDVMRTHLANEQ
GLMU_ACTP2      ----VILAAGKGTRMYS---DLPKVLHTVAGKPMVQHVIDTAKQIDAKQIHLIYG-HGGELLQQRLSSEP
GLGC_RHOBA      ----VILAGGRGSRLEPLTRDRAKPAVPIGGARIIDFVLSNCLNSDMRRL-LLLTQYKAQSLDRHINVAN
EI2BE_CANAL     --QAIVLTDSFETRFMPLTAVHPRCLLPLANVPLIEYTLEFLANAGVNEVYLMCSAH-ADQIQEYIENGD
GLMU_SILPO      ----VILAAGKGTRMKS---DLPKVLHPIAHAPMLVHAMR--AGAVLEPARTVIXXXXXXXXXXXXXLDE
GLMU_SALSV      ----VILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYG-HGGELLKQTLKDD-
GLMU_NITHX      ----IVLAAGEGTRMRS---SLPKVLHPVAGQTLLAHVLTAAPSGPGTSLAAVVGPGH----EAVADEAR
GLMU_KOSOT      ---AIILAAGLGKRMKS---EIPKVVHSILGLPMINWVLRAVKKAGIENI-IVVTGYKAEIVEALLPED-
GLMU_CHRSD      ----VILAAGQGTRMRS---AKPKVLHALAGKPLVSHVLDTAEQLGATRTHVVIG-HGAEQVET-----E
GLMU_ALISL      ---AVILAAGKGTRMYS---NKPKVLHTLAGKPMAKHVIDTCEGLGAKNIHLVYG-HGGDQMQAELGQE-
GLGC_HAEIN      ----LVLAGGRGSRLHELTDKRAKPALYFGNRRIIDFALSNCINSDLNRIG-VVTQYAAHSLLLHLQTGW
GLGC_CORJK      ---SIVLAGGEGKRLYPFTADRAKPAVPFGNYRLIDFVLSNLVNAGYYKICVLTQYKSHSLDRHISQSWQ
GLMU_VIBVU      ---AVILAAGKGTRMYS---NMPKVLHTLAGKPMVKHVIDTCTGLGAQNIHLVYG-HGGDQMQAALAEEP
GLMU_PSEMY      ----VILAAGQGTRMRS---ALPKVLHPVANKPMLGHVIDTARSLQPQSIQVVIG-HGADTVRERLAADD
GLMU_PHOLL      -KSVVILAAGKGTRMYS---DLPKVLHLLAGKPMVQHVIDTAMALGAKNVHLVYG-HGGDLIEQTLS---
GLMU_PASMU      ----VILAAGKGTRMYS---DLPKVLHKIAGKPMVKHVIDTVKSIHAKNIHLVYG-HGGEVMQTRLQDEP
GLMU_GEOSF      ---AIVLAAGKGTRMKS---ELVKVMHPLSGMPMISWPVNVVREAGAAVITLVVG-HQSEKVREFFADQG
GLMU_ERWCT      ----VILAAGKGTRMYS---DLPKVLHKLAGKPMVQHVIDAAMTTGAQHVHLVYG-HGGDLLKH-----E
GLMU_EDWI9      ----VILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDSALTLGARQVHLVYG-HGGDLLKAHLS---
GLMU_ACIBL      -----ILAAGKGTRLKS---KHPKVLHEIAGKPLLDHXXXXXXXXXPPSQIFAIIGHEADRVREAMQASG
GLGC_SHEFN      ---ALILAGGRGSRLYELTDWRAKPALYFGGKRIIDFPLSNCINSGIRRVGVVTQYKSHSLIRHVTRGWG
GLGC_RHOSR      ----IVLAGGEGKRLYPLTADRAKPAVPFGGARLIDFVLSNLVNAGYLRLCVLTQYKSHSLDRHISQTWR
GLMU_VIBVY      ---AVILAAGKGTRMYS---NMPKVLHTLAGKPMVKHVIDTCTGLGAQNIHLVYG-HGGDQMQAALAEEP
GLMU_PROMS      MLSVAILAAGKGTRMES---SLPKVLHKISGKSLLQRVIDSCAELKPDKI-FVITGHKSKEVQKSIPKDK
GLMU_PARL1      ---AVILAAGKGTRMKS---RLPKVLHPIAGKPMLGHVLSAVSALGSERPVLVVGPGMDE--VATYARGL
GLMU_NEIG1      ----VILAAGKGTRMYS---QMPKVLHCIGGKPMVERVIDTAAALNPQNICVVVG-HGKEQVLDTVKRD-
GLMU_HELAH      MLSVIILAAGKGTRMHS---SLPKTLHTLCGEPMLFYILET-AFSISNDVHLILH-HQQERIKEAV--LE
GLMU_HAEI8      ---AVILAAGKGTRMYS---DLPKVLHTIAGKPMVKHVIDIAHQLGSENIHLIYG-HGGDLMRTHLANEQ
GLMU_COLP3      ----VILAAGKGTRMRS---SLPKVLHSVAEKPMVGHVIDSARQLGASNI-YVVYGFGGDVLKATL-TKD
GLGC_RHOOB      ----IVLAGGEGKRLYPLTADRAKPAVPFGGARLIDFVLSNLVNAGYLRLCVLTQYKSHSLDRHISQTWR
GLMU_VIBPA      ---AVILAAGKGTRMHS---NMPKVLHTLAGKPMVKHVIDTCTGLGAQNIHLVFG-HGGDQMQTTLADE-
GLMU_STRPZ      ---AIILAAGKGTR---MTSDLPKVLHKVSGLTMLEHGFRS-GKAISPEKSVTVIGHKSKMVRG------
GLMU_PSEFS      ----VILAAGQGTRMRS---ALPKVLHPVAGNSMLGHVIHSARQLDPQRIHVVIG-HGADVVRERLAADD
GLMU_PSEA7      ----VILAAGQGTRMRS---ALPKVLHPIAGKPMLGHVIDCARQLQPERIHVVIG-HGADLVRERMAADD
GLMU_OCHA4      ---SIVLAAGEGTRMKS---NLPKVLHQVAGLPLVSHVVTAVQGTGKSDIALVVG-RGADDVRAAV---E
GLMU_GEOLS      ---ALILAAGKGTRMKS---ALVKVLHELAGRPMLGWPLAAAREAGAGQI-VIVAGHQADQVQKRFGA--
GLMU_BRUSU      ---SIVLAAGEGTRMKS---NLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVG-RGAEDVRSAV---E
GLMU_BRUSI      ---SIVLAAGEGTRMKS---NLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVG-RGAEDVRSAV---E
GLMU_BRUME      ---SIVLAAGEGTRMKS---NLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVG-RGAEDVRSAV---E
GLMU_BRUMB      ---SIVLAAGEGTRMKS---NLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVG-RGAEDVRSAV---E
GLMU_BRUC2      ---SIVLAAGEGTRMKS---NLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVG-RGAEDVRSAV---E
GLGC_YERPY      ---ALILAGGRGSRLKDLTATRAKPAVHFGGKRIIDFALSNCLNSGVRRIGVITQYQSHTLVQHIQRGWS
GLGC_YERPS      ---ALILAGGRGSRLKDLTATRAKPAVHFGGKRIIDFALSNCLNSGVRRIGVITQYQSHTLVQHIQRGWS
GLGC_YERPP      ---ALILAGGRGSRLKDLTATRAKPAVHFGGKRIIDFALSNCLNSGVRRIGVITQYQSHTLVQHIQRGWS
GLGC_YERPN      ---ALILAGGRGSRLKDLTATRAKPAVHFGGKRIIDFALSNCLNSGVRRIGVITQYQSHTLVQHIQRGWS
GLGC_YERPE      ---ALILAGGRGSRLKDLTATRAKPAVHFGGKRIIDFALSNCLNSGVRRIGVITQYQSHTLVQHIQRGWS
GLGC_YERPB      ---ALILAGGRGSRLKDLTATRAKPAVHFGGKRIIDFALSNCLNSGVRRIGVITQYQSHTLVQHIQRGWS
GLGC_YERPA      ---ALILAGGRGSRLKDLTATRAKPAVHFGGKRIIDFALSNCLNSGVRRIGVITQYQSHTLVQHIQRGWS
GLGC_YERP3      ---ALILAGGRGSRLKDLTATRAKPAVHFGGKRIIDFALSNCLNSGVRRIGVITQYQSHTLVQHIQRGWS
GLGC_PROAC      ---SIVLAGGEGKRLMPLTMDRAKPAVPFGGTRLIDFVLSNLANSGLTQIAVLTQYKSHSLDRHISITWR
GLMU_PSEPF      ----VILAAGQGTRMRS---ALPKVLHPIAGDSMLGHVIHSARQLDPQRIHVVIG-HGADVVRERLAADD
GLMU_NITEU      ----VILAAGMGKRM---CSSLPKVLHPLAGKPILSHVLD-IARTLSPERICVVFGYGGELVRQVIGDHS
GLMU_MYCLE      ----LVLAAGPGSRMRS---DTPKVLHTIAGRSMLSHSLHAITKLAPQHLVVVLGHEHQRIAPLVAELAD
GLMU_MYCLB      ----LVLAAGPGSRMRS---DTPKVLHTIAGRSMLSHSLHAITKLAPQHLVVVLGHEHQRIAPLVAELAD
GLMU_CELJU      MLDILILAAGKGTRMRS---DLPKVLHPIGGKPLVQHVVDTARQVGGEQLLLIVG-HGAEQVEQRMAAPD
GLMU_ACTPJ      ----VILAAGKGTRMYS---DLPKVLHTVAGKPMVQHVIDTAKQIDAKQIHLIYG-HGGELLQQRLSSEP
GLMU_IDILO      --RVVILAAGKGTRMRS---ELPKVLHKVANKPMVEHVIDTARSLKPDAINLIYG-HGGDQLKQAIA---
GLGC_THEYD      ---AIVLAGGKGERLFPLTSFRSKPSVPFARYRIVDFVLSNLVNSQIYSIYLLVQEHIRQNFFSSVGS-D
GLGC_THECA      ----MILAGGQGSRLYPLTAKRAKPAVPFGAKRIIDFVLNNFVNSGIYAI-YVLTQYKAQSLTEHIQRYW
GLGC_BURXL      ---AIVLAGGRGTRLGPLTNKRVKPAVHFGGKRIIDFALSNCLNSGIRRIA-VVTQYKAHSLLRHLQRGW
GLMU_VIBHB      ---AVILAAGKGTRMYS---NMPKVLHTLAGKPMAKHVIDTCTGLGAQNIHLVYG-HGGDQMQQTLAEEP
GLMU_NEIGO      ----VILAAGKGTRMYS---QMPKVLHCIGGKPMVERVIDTAAALNPQNICVVVG-HGKEQVLDTVKRD-
GLMU_BARQU      ---SIVLAAGEGTRMKS---SLPKVLHKIAGLPLVCHVIKQIELAGASQLAVVVGA-GAQDVTHVV---Q
GLMU_BARBK      ---SIVLAAGEGTRMKPL----PKVLHKIAGLPLVCHVIKQIELAGSLQLAVVVG-SGAEDITKVV---Q
GLGC_MYCSS      ----IVLAGGEGKRLYPLTADRAKPAVPFGGARLIDFVLSNLVNARYLRICVLTQYKSHSLDRHISQNWR
GLGC_CORK4      ---SIVLAGGEGKRLFPFTADRAKPAVPFGGSRLIDFVLSNLVNAGYMKVCVLTQYKSHSLDRHISQSWQ
GLGC_ALTMD      ---ALILAGGKGSRLHELTTWRAKPALYFGGKRIIDFPLSNCVNSGIRRIGVVTQYKSHSLIRHLVRGWG
GLMU_THEP3      ----LILAAGLGKRMKS---KHPKVVHKVCGKPMIEWVVDAVEEIGSKEVIVVVG-------HXXXXXXX
GLMU_PSEAE      ----VILAAGQGTRMRS---ALPKVLHPIAGKPMLGHVIDCARQLQPERIHVVIG-HGADLVRERMAADD
GLMU_PSEAB      ----VILAAGQGTRMRS---ALPKVLHPIAGKPMLGHVIDCARQLQPERIHVVIG-HGADLVRERMAADD
GLMU_PSEA8      ----VILAAGQGTRMRS---ALPKVLHPIAGKPMLGHVIDCARQLQPERIHVVIG-HGADLVRERMAADD
GLMU_PHOPR      ---AVILAAGKGTRMYS---NVPKVLHTLAGKPMAKHVIDTCSDLGASHIHLVYG-HGGDTMQQVLADEP
GLMU_NITWN      ----IVLAAGEGTRMRS---SLPKVLHPVGGQTLLSHVLAAAPGGPGTSLTVVIGPGH----QAVADEAK
GLGC_THET2      ----MILAGGQGSRLYPLTAKRAKPAVPFGAKRIIDFVLNNFVNSGIYAI-YVLTQYKAQSLTEHIQRYW
GLGC_SHEB5      ---ALILAGGRGSRLHELTDWRAKPALYFGGKRIIDFPLSNCINSGIRRVGVVTQYKSHSLIRHVMRGWG
GLGC_RHILW      ---AYVLAGGRGSRLKELTDRRAKPAVYFGGKAIIDFALSNALNSGIRRIG-VATQYKAHSLIRHMQRGW
EI2BG_DICDI     --------ASGNSKLEPIDATIPHSLLPIANRPLISYQLEFLEKAGFEPVIIVVNETSQEKIKQYVSEIY
GLMU_SPHAL      ---AIVLAAGKGTRMKS---DLHKVLHPIAGRPMLLHLMASVDELSPAXXXXXXGDKADQLEAALSGTAE
GLMU_RHOPT      ----IVLAAGEGTRMRS---SLPKVLNPVAGRSLLAHVLSAAPHGERDRLAVVIGP----DHRAVGDEAK
GLMU_PSEU5      ----VILAAGQGTRMRS---ALPKVLHPVAGQSMLGHVIATARALQPRSIQVVIG-HGAEQVRQRLA---
GLMU_DESVH      ---ALILAAGKGTRMHS---DKPKVLQTILGEPMLRFVMDALAPVFGDRVWTVVGHRADMIYAAFAGEDA
GLMU_CORDI      ----IVLAAGAGTRMKS---AKQKTLHSIGGRXXXXXXXXXXXXXXPQRIVAVIGHRREQVRPEVEAVAA
GLGC_ACIAC      ---AIVMAGGEGSRLHPLTAERCKPAVPFNGKRIVDFVLSNLVNSEIYSIYLLVQEHIRQSWTMTRFIPQ
GLMU_RHOPA      ----IVLAAGEGTRMRS---SLPKVLNPVAGRSLLAHVLSAAPHGERDRLAVVIGP----DHQAVGDEAK
GLMU_LAWIP      ---ALILAAGKGTR---MCSNKPKVLHTLLGEPLLFHVISALRPLFGSNIWVVIG-HGSSLIQSICS---
GLMU_GEOMG      ---AIILAAGKGTRMKS---DLVKVMHPLAGAPMVAWPVEAARQAGTSRMVLVVG-HQADTIREHFAGTE
GLMU_BIFAA      LSAAIILAAGEGTRMRS---NKPKVLHTLAGKTFLNRVMDSVAALDPDTLAVVVH-YQAER---VAEAAR
GLGL3_ARATH     ---AIILGGGDGAKLFPLTKRAATPAVPVGGYRMIDIPMSNCINSCINKIFVLTQFNSASLNRHLAGNGI
GLGC_THET8      ----MILAGGQGSRLYPLTAKRAKPAVPFGAKRIIDFVLNNFVNSGIYAI-YVLTQYKAQSLTEHIQRYW
GLGC_RHORU      ---ALVLAGGRGSRLRDLTNRESKPAVPFGGKRIIDFPLSNCMNSGIRRM-CVITQYRAHTLIHHIQRGW
GLGC_RHORT      ---ALVLAGGRGSRLRDLTNRESKPAVPFGGKRIIDFPLSNCMNSGIRRM-CVITQYRAHTLIHHIQRGW
GLGC_BURP8      ---AIVLAGGRGTRLGPLTNKRVKPAVHFGGKRIIDFALSNCLNSGIRRIA-VVTQYKAHSLLRHVQRGW
GLGC1_PSEA6     ---ALVLAGGKGTRLKELTEHQSKPALHFGGKRVIDFTLSNCVNSGIRQIGIATQYKSHSLLRHLSQGWS
GLMU_YERE8      ----VILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGAQQVHLVYG-HGGELLQKTLTDP-
GLMU_PSEF5      ----VILAAGQGTRMRS---ALPKVLHPVAGNSMLGHVIHSARQLDPQRIHVVIG-HGADAVRERLDADD
GLMU_NEIMA      ----VILAAGKGTRMYS---KMPKVLHEIGGETMLGRVIDTAAALNPQNICVVVG-HGKEQVLDTVKRD-
GLMU_HELPJ      MLSVIILAAGKGTRMHS---SLPKTLHTICGEPMLFYILE-VAFSISNDVHLVLH-HQQERIKEAVSKRF
GLGL2_SOLTU     ---SVILGGGVGTRLFPLTSRRAKPAVPIGGYRLIDVPMSNCINSGIRKI-FILTQFNSFSLNRHLATXX
GLGC_SHEB8      ---ALILAGGRGSRLHELTDWRAKPALYFGGKRIIDFPLSNCINSGIRRVGVVTQYKSHSLIRHVMRGWG
GLGC_SHEB2      ---ALILAGGRGSRLHELTDWRAKPALYFGGKRIIDFPLSNCINSGIRRVGVVTQYKSHSLIRHVMRGWG
EI2BE_YEAST     --QAVVLTDSYETRFMPLTAVKPRCLLPLANVPLIEYTLEFLAKAGVHEVFLICSSH-------------
GLMU_THEFY      ----MVLAAGEGTRMKS---RRPKVLHEICGRSLLGHVLAAVAELEPQRTVVVVG-HAREQVTEHL---K
GLMU_HAHCH      ----IILAAGQGTRMKS---ELPKVMHCVAGKPLVQHVIDTARRLEPENITVVYG-HKGDVVQAGVS---
GLMU_DESVV      ---ALILAAGKGTRMHS---DKPKVLQTILGEPMLRFVMDALAPVFGDRVWTVVGHRADMIYAAFAGEDA
GLMU_BARHE      ---SIVLAAGEGTRMKS---SLPKVLHKIAGLPLICHVIKQIELAGVSQLAVVV----GFGAKDVVHVVE
GLMU_AGRVS      ---AVILAAGDSTRMKS---AMSKVLHPVAGLPMIAHVMQAIAASDIADVALVVG----RDADKVTKAAS
GLMU_ACIBS      ----IILAAGKGTRMRS---QLPKVLQPLAGRPLLGHVIKTAKQLLAENI-ITIYGHGGDHVKKTFAQ-E
GLMU_ACIBC      ----IILAAGKGTRMRS---QLPKVLQPLAGRPLLGHVIKTAKQLLAENI-ITIYGHGGDHVKKTFAQ-E
GLGC_RHOE4      ----IVLAGGEGKRLYPLTADRAKPAVPFGGARLIDFVLSNLVNAGYLRICVLTQYKSHSLDRHISQTWR
EI2BG_RAT       --QAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTT---------------
EI2BG_HUMAN     --QAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTT---------------
GLMU_PSESM      ----VILAAGQGTRMRS---ALPKVLHPVAGNSMLGHVIHSARQ--LSPVGIVVIGHGADAVREQLAADD
GLMU_PROMH      -KSVVILAAGKGTRMYS---QLPKVLHKLAGKSMVQHVIDTAKSLGAQQTHLVYG-HGGELMKETLGSQP
GLMU_NOVAD      ----IVLAAGKGTRMKS---DLHKVLHPIAGRPMLMHLMASAAELSPAR-QVVVAGHGREQLEKALGGSA
GLMU_ACIBY      ----IILAAGKGTRMRS---QLPKVLQPLAGRPLLGHVIKTAKQLLAENI-ITIYGHGGDHVKKTFAQ-E
GLGC_RHIL3      ---AYVLAGGRGSRLKELTDRRAKPAVYFGGKAIIDFALSNALNSGIRRIG-VATQYKAHSLIRHMQRGW
EI2BG_BOVIN     --QAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVITT---------------
GLMU_TOLAT      ----VILAAGKGTRMRS---SLPKVLHPVAGRPMVSHVIDTARSLNAEKIHLVYG-HGGEAMQARLNDAD
GLMU_THET8      MHAHVILAAGQGTRMRS---RLPKVLHPLLGKPMXXXXXXXXXXXKPERLXXXXXXXXXXXXXAL----E
GLMU_THET2      MHAHVILAAGQGTRMRS---RLPKVLHPLLGKPMXXXXXXXXXXXKPERLXXXXXXXXXXXXXAL----E
GLMU_RHIME      ---AIILAAGESTRMKS---AMSKVLHPVAGRPMIAHVVDALASASISDVALVVG----RXXXXXXXXXX
GLMU_KINRD      ---------GEGTRMRS---ATPKVLHPLGGRPLVGHALR-AARGTAPEHLVVVLRHQADRVREALA-GD
GLMU_BRAJA      ----IVLAAGEGTRMRS---HLPKVLHPVAHQTLLAHVLTAAPKGTGTSLAVVIGPDHADEARRIRPDAV
GLMU_BART1      ---SIVLSAGEGTRMKPL----PKVLHKIAGLPLICHVLKQIELAESSQVAVVVGCGGQE----VTHVVQ
GLMU_ACISJ      ----IIMAAGKGTRMKS---RIPKVLQRLAGRPLLHHVLGQAASLQARRV-VVVTGHGATEVEAAAGVGG
GLGL2_ARATH     ---SIILGGGAGTRLFPLTSKRAKPAVPIGGYRLIDIPMSNCINSGIRKIFILTQFNSFSLNRHLSRTXX
GLGC_SHEB9      ---ALILAGGRGSRLHELTDWRAKPALYFGGKRIIDFPLSNCINSGIRRVGVVTQYKSHSLIRHVMRGWG
GLGC_LEIXX      ----IVLAGGEGKRLMPLTTDRAKPAVPFGGQRLIDFALSNLINSQLRQIVVLTQYKSHSLDRHISQTWR
GLGC_COREF      ---AIVLAGGEGKRLFPLTEDRAKPAVPFGGTRLIDFVLSNLVNAGYLKIA-VLTQYKSHSLDRHISVSW
GLMU_SYNS3      MLAVAVLAAGKGTRMKS---ALPKVLQPLAGATLVERVLAS-ARNLAPERRLLIVGHQAERVEAQLSS--
GLMU_PSYIN      ----VILAAGKGTR---MCSELPKVLHKIADKPMVQHVIDTVKSIGADSIHLIYG-HGGQQLQEKISDGS
GLMU_PSE14      ----VILAAGQGTRMRS---ALPKVLHPVAGNSMLGHVIHSARQLSPNGIHVVIG-HGADAVREQLAADD
GLMU_HELPH      MLSVIILAAGKGTRMHS---SLPKTLHTICGEPMLFYILET-AFSISDDVHLVL--HHQQE---------
GLMU_GLUOX      ---AIILAAGLGTRMKS---RLPKALHRLGNQPMINH-LITTARQVFDDVVVVTGPDMPELEKAV-----
GLGL2_MAIZE     ---AVILGGGTGTQLFPLTSTRATPAVPIGGYRLIDIPMSNCFNSGINKIFVMTQFNSASLNRHILGGGI
GLGC_BURPP      ---AIVLAGGRGTRLGPLTNKRVKPAVHFGGKRIIDFALSNCLNSGIRRIA-VVTQYKAHSLLRHLQRGW
GLMU_THISH      ----LILAAGQGTRMRS---SLPKVLQPLAGRPLLSHVLDT-ARSLDPHRLVVVYGHGGDRVREAFPEDD
GLMU_NEIMB      ----VILAAGKGTRMYS---KMPKVLHRIGGKPMVGRVIDTAAALNPQNICVVIG-HGKEQVLDTVKRD-
GLMU_BRASO      ----IVLAAGEGTRMRS---SLPKVLHPIAGESMLAHVLXXXXXXXXXXXXVVIGPHDAVEKEA-----K
GLGL2_WHEAT     ---AVILGGGTGTQLFPLTSTRATPAVPIGGYRLIDIPMSNCFNSGINKIFVMTQFNSASLNRHILGGGI
GLGC_NOCFA      ----IVLAGGEGKRLFPLTADRAKPAVPFGGARLIDFVLSNLVNAGYLRLCVLTQYKSHSLDRHISQTWR
GLGC_MYCGI      ----IVLAGGEGKRLYPLTADRAKPAVPFGGYRLIDFVLSNLVNARFLRICVLTQYKSHSLDRHISQNWR
EI2BG_MACFA     --QAVVMAVGGGSRMTDLTSSIPKPLLPAGNKPLIWYPLNLLERVGFEEVIVVTT---------------
EI2BE_SCHPO     --QAIVLSDSYNYRFRPLTLDKPRCLLPLANTPLIEYTFEFLALAGVQEVYVFCCAHAGQIREYIEKSKW
GLMU_SYNP2      MVAVAILAAGKGTRMKS---DLPKVLHPLGGRSLVERVIESCALIKPERICTIVGYRAAEVKMALAHLPH
GLMU_SINMW      ---AIILAAGESTRMKS---AMSKVLHPVAGRAMISHVVDALASASISDVALXXXXXXXXXXXXXXXXXX
GLMU_PELPD      ---AIILAAGKGTRMKS---GLVKVLHPIAGRPMIDWPLE-XXXXXXXXXXXXXXXHQAEAVREFQGAGD
GLMU_FRATW      ----VILAAGKGSRMNS---NKPKVLQTLAAKTLIEHVVSSVEKLNPDNI-VVVTGHLKEQVEDALQ---
GLMU_FRATT      ----VILAAGKGSRMNS---NKPKVLQTLAAKTLIEHVVSSVEKLNPDNI-VVVTGHLKEQVEDALQ---
GLMU_FRATN      ----VILAAGKGSRMNS---NKPKVLQTLAAKTLIEHVVSSVEKLNPDNI-VVVTGHLKEQVEDALQ---
GLMU_FRATM      ----VILAAGKGSRMNS---NKPKVLQTLAAKTLIEHVVSSVEKLNPDNI-VVVTGHLKEQVEDALQ---
GLMU_FRATH      ----VILAAGKGSRMNS---NKPKVLQTLAAKTLIEHVVSSVEKLNPDNI-VVVTGHLKEQVEDALQ---
GLMU_FRATF      ----VILAAGKGSRMNS---NKPKVLQTLAAKTLIEHVVSSVEKLNPDNI-VVVTGHLKEQVEDALQ---
GLMU_FRAT1      ----VILAAGKGSRMNS---NKPKVLQTLAAKTLIEHVVSSVEKLNPDNI-VVVTGHLKEQVEDALQ---
GLMU_ECO81      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLGL1_HORVU     ---AVILGGGTGTQLFPLTSTRATPAVPIGGYRLIDIPMSNCFNSGINKIFVMTQFNSASLNRHILGGGI
GLGC_SERP5      ---ALILAGGRGSRLKDLTSTRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWS
GLMU_ROSDO      MKTALVLAAGKGTRMNS---DLPKVLHPLAGAPLLIHAMQSGASLGPSRT-VIVAGHGAELVQKAALSHD
GLMU_MYCVP      ----VILAAGAGTRMKS---DTPKVLHTLAGRSMLSHALHAVAGLEARHLVVVVGKDRERVAPAALEIGQ
GLMU_ENTS8      ----VILAAGKGTRMYS---DLPKVLHTLAGKPMVQHVIDAAKHVGAQHIHLVYG-HGGDLLQSTLKDAS
GLMU_AZOVD      ----VILAAGQGTRMRS---ALPKVLHPVAGNSMLGHVVATARQLQPQGIHVVIG-HGAERVRERLAADD
GLMU_PSEPG      ----VILAAGQGTRMRS---ALPKVLHPVAGNSMLGHVIHSARQLQPQGIHVVIG-HGAELVRERLAADD
GLMU_METCA      ---ALILAAGQGTRMRS---GLPKVLHRIGGLCLLEHVYRLAAALEVRET-VIVYGHGGEQALSALG---
GLMU_HELPY      MLSVIILAAGKGTRMRS---SLPKTLHTICGEPMLFYILET-AFSISDDVHLIL--HHQQE---------
GLMU_FRATO      ----VILAAGKGSRMNS---NKPKVLQTLAAKTLIEHVVSSVEKLNPDNI-VVVTGHLKEQVEDALQ---
GLMU_CAUCR      -RAAVILAAGQGTRMKS---PTPKVLHRLAGRTLLDHAIDAAEGLGCERIIVVVGAHSPQ-------VGE
GLMU_CAUCN      -RAAVILAAGQGTRMKS---PTPKVLHRLAGRTLLDHAIDAAEGLGCERIIVVVGAHSPQ-------VGE
GLGC_ARTAT      ---AIVLAGGEGNRLMPLTADRAKPAVPFAGYRLIDFALSNLVNSGYLKI-VVLTQYKSHSLDRHISETW
GLMU_ZYMMO      ---AVILAAGKGTRMRS---DTHKILHALAGRPLLGWVLDSLAPLSPDHT-VVVTGSGREQVENYL---K
GLMU_SHIB3      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_MICAN      MVAVAILAAGKGTRMKS---SLPKVLHPLGSRSLVERVL-NVSESLHPQRKLVIIGYQGQQVRNTLQHLD
GLMU_ECOL5      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_CHRVO      ----VILAAGKGKRMYS---SLPKVLHPIGGEPMLARVIRT-ARALNPSRLVVVYGHGGEQVRARIQDAD
GLMU_BAUCH      ----VILAAGKSTRMNS---DIPKVLHLLAGKPILQYVIDTAIKAKCKSTNIIVYGYKGELLQQKLAHKQ
GLMU_ECO8A      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_ECO5E      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_ECO27      ----VILAAGKGTRMYS---DLPKVLHTLAGKTMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKND-
GLGC_DEIRA      ----MILAGGQGSRLAPLTQKRSKPAVPFGSKRIIDFAINNFINSGMFSV-YVLTQYKAQSLTEHIQRGW
GLGC1_VIBVY     ----MILAGGEGSRLRPLTESRSKPAVPFGGSRLIDFALNNFVNADLMRI-YVLTQFKSQSLFHHMKKGW
GLGC1_VIBVU     ----MILAGGEGSRLRPLTESRSKPAVPFGGSRLIDFALNNFVNADLMRI-YVLTQFKSQSLFHHMKKGW
GLMU_SHISS      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_SHIFL      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_SHIF8      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_SHIBS      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_PSEP1      ----VILAAGQGTRMRS---ALPKVLHPVAGNSMLGHVIHSARQLQPQGIHVVIG-HGAELVRERLAADD
GLMU_ESCF3      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_ECOUT      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_ECOSM      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_ECOSE      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_ECOLU      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_ECOLI      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_ECOLC      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_ECOL6      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_ECOK1      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_ECOHS      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_ECODH      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_ECOBW      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_ECO7I      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_ECO57      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_ECO45      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_ECO24      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_DESVM      ---ALILAAGKGTRMHS---DKPKVLQSILGEPMLRFVYDALEPLFGGNLWTVIG-HKADMVREAF-KGE
GLGL3_WHEAT     ---AVILGGGTGTQLFPLTSTRATPAVPIGGYRLIDIPMSNCFNSGINKIFVMTQFNSASLNRHILGGGI
GLGL1_WHEAT     ----------------------------------------------------------------------
GLGC_BIFLO      ---SIVLAGGEGTRLMPLTRDRAKPAVPFGGYRLIDFPLSNLVNSGYRQV-VVLTQYKSHSLDRHISQVW
GLGC_BIFLD      ---SIVLAGGEGTRLMPLTRDRAKPAVPFGGYRLIDFPLSNLVNSGYRQV-VVLTQYKSHSLDRHISQVW
GLMU_SHIDS      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLMU_PSEPK      ----VILAAGQGTRMRS---ALPKVLHPVAGNSMLGHVIHSARQLQPQGIHVVIG-HGAELVRERLAADD
GLMU_PROMA      -----ILAAGKGTRMQSTLPKVLQELSGLTLLERVLTSCKDLT----PDRSLIIVGHESNKVKESV----
GLGC_VIBFM      ----MILAGGEGSRLRPLTESRTKPAVPFGGSRLIDFALNNFVNADLMRI-YVLTQFKSQSLFQHMKKGW
GLGC_VIBF1      ----MILAGGEGSRLRPLTESRTKPAVPFGGSRLIDFALNNFVNADLMRI-YVLTQFKSQSLFQHMKKGW
GLGC_THIDA      ---ALVLAGGEGSRLKDLTAWRAKPAVPIGGKRIIDFPLSNCVNSGIRRIGVLTQYKSHSLIRHLQRAWG
ISPD_CLOPE      ---SVILAGGKGKRMGA---EVSKQFIEINGKPIIYYTLKAFEECGIDEIILVLPKDEIDYFKREI--EP
ISPD_CLOP1      ---SVILAGGKGKRMGA---EVSKQFIEINGKPIIYYTLKAFEECGIDEIILVLPKDEIDYFKREI--EP
GLMU_SPHWW      ---ALILAAGKGTRMKS---DLHKVLHPIAGKPMLGHLIAAVDRLGAAR-KLVVTGAGREQVEAFVAP--
GLMU_SALAR      ----VILAAGKGTRMYS---DIPKVLHTLAGKAMVQHVIDAANELGASQVHLVYG-HGGDLLKQTLKNDN
GLMU_KLEP3      ----VILAAGKGTRMYS---DLPKVLHTLAGKPMVQHVIDAANDLGACAVHLVYG-HGGDLLRQTLHED-
GLMU_ACIAD      ----IILAAGKGTRMRS---HLPKVLQPLAGRPLLGHVIQTAKQLNANNI-ITIFGHGGAXXXXXXXXXX
GLGC_ARTCA      ---AIVLAGGEGNRLMPLTADRAKPAVPFAGSRLIDFAISNLVNSRYLQI-VVLTQYKSHSLDRHISEAW
GLGC1_VIBPA     ----MILAGGEGSRLRPLTESRSKPSVPFGGSRLIDFALNNFVNADLMRI-YVLTQFKSQSLFHHLKKGW
GLGC1_VIBCH     ----MILAGGEGSRLKPLTETRTKPAVPFGGSRLIDFALNNFVNADLMRI-YVLTQFKSQSLYIHMKKGW
GLMU_RHILO      ---SVILAAGEGTRMKS---ALPKVLHQIAGLP-MXXXXXXXXXXXXXXXXXXXXXHGAEEMRKAV---T
GLMU_ECO55      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYG-HGGDLLKQALKDD-
GLGC_RHOS5      ---AFVLAGGRGSRLKELTDRRAKPAVYFGGKAIIDFALSNAMNSGIRKMAI-ATQYKAHSLIRHIQRGW
GLGC_RHOS4      ---AFVLAGGRGSRLKELTDRRAKPAVYFGGKAIIDFALSNAMNSGIRKMAI-ATQYKAHSLIRHIQRGW
GLGC_RHOS1      ---AFVLAGGRGSRLKELTDRRAKPAVYFGGKAIIDFALSNAMNSGIRKMAI-ATQYKAHSLIRHIQRGW
GLGC_BIFLI      ---SIVLAGGEGTRLMPLTRDRAKPAVPFGGYRLIDFPLSNLVNSGYRQV-VVLTQYKSHSLDRHISQVW
GLGC_BIFAA      ---SIVLAGGEGTRLMPLTRDRAKPAVPFGGVRLIDFPLSNLVNSGYMQT-VVLTQYKSHSLDRHISTVW
GLMU_SODGM      ----VVLAAGKGSRMFS---TLPKVLHPLAGKAMVQHVIDTAMRLGASRIHLVYG-HGGELLRERLARQY
GLMU_OENOB      ----VILAAGKGSRMKD---DLSKPLHKVAGLPM----LEWICRA--------VRKFNPKNIIAVQGADE
GLGL4_ARATH     ---AIILGGGNGAKLFPLTMRAATPAVPVGGYRLIDIPMSNCINSCINKIFVLTQFNSASLNRHLARTXX
GLGC_ARTS2      ---AIVLAGGEGNRLMPLTADRAKPGVPFAGSRLIDFALSNLVNSRYLQI-VVLTQYKSHSLDRHISETW
EI2BG_CAEEL     --QGILLCSGGGTRMPVLTRHVQKCLLPVVGVPMFLYPLSSLLRTGITDIKIFV----------------
GLMU_MYCTU      ----LVLAAGPGTRMRS---DTPKVLHTLAGRSMLSHVLHAIAKLAPQRL-IVVLGHDHQRIAPLVGEAD
GLMU_MYCTA      ----LVLAAGPGTRMRS---DTPKVLHTLAGRSMLSHVLHAIAKLAPQRL-IVVLGHDHQRIAPLVGEAD
GLMU_MYCBT      ----LVLAAGPGTRMRS---DTPKVLHTLAGRSMLSHVLHAIAKLAPQRL-IVVLGHDHQRIAPLVGEAD
GLMU_MYCBP      ----LVLAAGPGTRMRS---DTPKVLHTLAGRSMLSHVLHAIAKLAPQRL-IVVLGHDHQRIAPLVGEAD
GLMU_MYCBO      ----LVLAAGPGTRMRS---DTPKVLHTLAGRSMLSHVLHAIAKLAPQRL-IVVLGHDHQRIAPLVGEAD
GLMU_METPP      MLDIVIMAAGKGTRMKS---SRPKVLHTLAGRALLQHVLATAAGLGAQRL-ITITGHGAEQVEAAMRSAF
GLMU_DESDG      ---AVILAAGKGTRMYS---DKPKVLQPLLGEPMLRFVYRALDPLFSKAVWTVIG-HGADMVRKAFCHED
GLMU_SULNB      ----VILAAGQGTRMKS---STPKVLHTISGKPMLFHAID--AAKEISDDITVILHHQEERIKEVEAEYE
GLMU_PSEE4      ----VILAAGQGTRMRS---ALPKVLHPVAGNSMLGHVIHSARQLQPQGIHVVIG-HGAEQVRERLAAED
GLMU_PROMM      MLAVAILAAGKGTRMKS---CLPKVLQPLAGSTLVERVLTSC--SGLQQRRLLIVGHQAQEVQQQLTDWQ
GLMU_KLEP7      ----VILAAGKGTRMYS---DLPKVLHTLAGKPMVQHVIDAANDLGACAVHLVYG-HGGDLLRQTLHED-
GLMU_JANMA      ----VILAAGMGKRMQS---ALPKVLHPLAGKPLLSHVIDTARQLSPSRLCVIYG-HGGEQVPQLLQAKD
GLGC_MYXXD      ---AMILAGGAGTRLEPLTRERAKPAVPFGGRRIIDFVLSNFANSGVYRMK-VLTQYKSDSLNNHLSRAW
GLGC_BIFA0      ---SIVLAGGEGTRLMPLTRDRAKPAVPFGGYRLIDFPLSNLVNSGYSQV-IVLTQYKSHSLDRHISQLW
GLMU_PSYWF      ----IILAAGKGTRMQS---AKPKVLQILADKPLLAHVLDTCQSISVDKT-IVVYGFGGDQVQQAM----
GLMU_PSEU2      ----VILAAGQGTRMRS---ALPKVLHPVAGNSMLIHSARQLSPSGIH----VVIGHGADAVREQLSADD
GLMU_MYCPA      ----LVLAAGPGTRMRS---DTPKVLHPLGGRSMLSHLLHAIAKVAPQHLAVVLGHDHERIAPLIADWAD
GLMU_MAGSA      ----IVLAAGMGTRMKS---SLPKVMHPLAGRPMVSHLLDTVSGLSPDRMVVVVGPDMELVGKTVA----
GLMU_ENT38      ----VILAAGKGTRMYS---DLPKVLHTLAGKPMVQHVIDAANELGASNVHLVYGHGGXXXXXXXXXXXX
GLMU_ANAMM      ----VILAAGCGSRM---CSTTPKILHKLGNAPIIKHVLQLADELRPKRAVIVT---NAAVNGPVAALAG
GLMU_ANAMF      ----VILAAGCGSRM---CSTTPKILHKLGNAPIIKHVLQLADELRPKRAVIVT---NAAVNGPVAALAG
GLGC_ACIC1      ----IVLAGGQGRRLLPLTADRAKPAVPFGGYRLIDFVLSNLANAGFLKIVVLTQYKNHSLDRHITTTWR
GLMU_HELP2      MLSVIILAAGKGTRMHS---SLPKTLHTICGEPMLFYILET-AFSISDDVHLILH-HQQERIKEAV-LKR
GLGC_ERWCT      ---ALILAGGRGTRLKGLTALRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITSFLNAEEFVDLLPAQQ
ISPD_CLOPS      ---SVILAGGKGKRMGA---EVSKQFIEINGKPIIYYTLKAFEECDIDEIILVLPKDEIDYFKREI--EP
GLMU_PSEHT      ----VILAAGKGTRMRS---ALPKVLHKVAGKTMVQHVIDNAKALGATTTNLVYG-HGGE-----XXXXX
GLGC_DEIGD      ----MILAGGQGSRLAPLTLKRSKPAVPFGGKRIIDFAINNFINSGVFSI-YVLTQYKAQSLTEHIQRGW
RFBF_SALTY      --KAVILAGGLGTRLSEETIVKPKPMVEIGGKPILWHIMKMYSVHGIKDFGYVIKEYFANYFLHMSDVTF
GLMU_HERAR      ----VILAAGMGKRMQS---ALPKVLHPLAGKPLLSHVIDTARQLSPSTLCIIYG-HGGEQVPQLLQSKD
GLGC_MYCVP      ----IVLAGGEGKRLYPLTADRAKPAVPFGGYRLIDFVLSNLVNARFLRICVLTQYKSHSLDRHISQNWR
ISPDF_DESVV     ----LLLAAGSGTRLATAGLPDAKQFLPLHGAPLYWASARTMAHAGIEGIVFVFPPHRVEE---------
ISPDF_DESVH     ----LLLAAGSGTRLATAGLPDAKQFLPLHGAPLYWASARTMAHAGIEGIVFVFPPHRVEE---------
GLMU_POLNA      ----VIMAAGKGTRMKS---SLPKVLHRLGGRALLAHVLDCAAQLSARQ-AVVITGHGAMEVEAACATGA
GLMU_HYPNA      -RAAVILAAGKGTRMKPL----PKVMHAVGGRPMMDWSIALARQVGAERIVAVVHP---SQDVLIAHLGK
GLMU_ACIAC      ----IIMAAGKGTRMKS---RIPKVLQRLAGRPLLGHVLDQ-ARGLQARRAVVVTGHGAAEVEPFIARAA
GLGC_PECCP      ---ALILAGGRGTRLKGLTALRAKPAVHFGGKRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWS
GLMU_WOLSU      ----VILAAGAGTRMKS---KTPKVLHTLCGREMLYYVIKE-AKKLSDDVSVVLF-HESEMVKKSI---E
GLMU_GRABC      ---AVILAAGLGTRMKS---TRPKVLHPIAGRSMLRHLIA-ACQPVFSHIVVVIGP----DMDSVAREAA
GLMU_CORGB      -----------------------KTLHSIGGRSLISHSLHAAAGLNPEHIVAVIGHGRDQVGPAVAQVAE
GLMU_CITK8      ----VILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGASQVHLVYG------HGGXXXXXX
GLGC_MYCUA      ----IVLAGGEGKRLYPLTADRAKPAVPFGGARLIDFVLSNLVNARYLRICVLTQYKSHSLDRHISQNWR
GLGC_MYCMM      ----IVLAGGEGKRLYPLTADRAKPAVPFGGARLIDFVLSNLVNARYLRICVLTQYKSHSLDRHISQNWR
EI2BE_HUMAN     ----------------------------------------------------------------------
GLMU_THIDA      ----LILAAGKGTRMRS---DLPKVLHQLAGRPLLGHVVATAQALGAART-CVVYGFGGEAVPQAMAEA-
GLMU_DIAST      ----IIMAAGKGTRMKS---RIPKVLQRLAGRPLLHHVLGQAASLQARRV-VVVTGHGATEVEXXXXXXX
GLMU_COREF      -----------GTRMKS---DLQKTLHSIGGRSLISHSLH--AAAGLNPTHIVVIGHGRDQVPAVEDVAT
GLGL1_MAIZE     ---AIILGGGTGSQLFPLTSTRATPAVPVGGYRLIDIPMSNCFNSGINKI-FVMSQFNSTSLRTYLEGGI
GLGC_ACIBL      ----VLLAGGAGERLYPLTRDRAKPAVNFGGYRIIDITLSNCINSGLRRVYILLNRHIREGWSGIVGNGE
GLMU_JANSC      ----IVLAAGAGTRMNS---DLPKPLHTLGSAPLVAHTIA--AGASLEPARLVVTGHGADEVEAVL---Q
GLMU_BACME      ---AVILAAGQGTRMKSSLY---KVLHPVCGKPMVQHVIDQLSRLDLTNL-ITVVGHGAEKVKSHVG---
GLMU_MYCA1      ----LVLAAGPGTRMRS---DTPKVLHTLGGRSMLSHLLHAIAKVAPQHLAVVLGHDHERIAPLIADWAD
GLMU_HALHL      ----VILAAGKGTRMRS---AQPKVLQPLAGRPLLAHVLDTALALGPEQVHVVYG-HGGDQV-----AAA
GLMU_CAMLR      ----LILAAGLGTRMKS---QNPKVLQKICSKAMILHILKQAYKIS-DDVCVVLS-HQKEKVEQVIL--E
GLMU_ANADF      ---AIVLAAGKGTRMKS---QKAKVLHEVGGRPLAWFPTRRALEIGANPVVAVVGHQXXXXXXXXXXXXX
GLGC_FRASN      ----------------PLTADRAKPAVPFGGYRLVDFVLSNLVNGGYLRIAVLTQYKSHSLDRHITTTWR
GLGC_CORGB      ---AIVLAGGEGKRLFPLTEDRAKPAVPFGGTRLIDFVLSNLVNSGFLKIA-VLTQYKSHSLDRHISLSW
ISPD_CLOTE      ---AIIVAAGKGSRMG---FDINKVFIEIGEKPIIQYSLECFSHPDIDEIVLVAKLNEIEKFQHII----
GLMU_RHOP2      ----IVLAAGEGTRMRS---SLPKVLHPVAGRXXXXXXXXXXXXGEGDKLAVVIGP----DHQAVADEAR
GLMU_HAMD5      ----VILAAGKGTR---MCSNLPKVLHLLAGKPMVQHVINTANQLDCTRIHLVYGHGGA------XXXXX
GLMU_CORGL      -----------------------KTLHSIGGRSLISHSLHAAAGLNPEHIVAVIGHGRDQVGPAVAQVAE
GLMU_PSYA2      ----IILAAGKGTRMQS---AKPKVLQTLAGKSLLGHVLDTCHQLTVDDT-IIVHGFGGEQVQAHIAE-Q
GLGC_PHOPR      ----MILAGGEGSRLRPLTDSRTKPAVPFGGSRLIDFALNNFVNADFLKI-YVLTQFKSQSLYVHMKKGW
GLGC_CORGL      ---AIVLAGGEGKRLFPLTEDRAKPAVPFGGTRLIDFVLSNLVNSGFLKIA-VLTQYKSHSLDRHISLSW
EI2BE_MOUSE     ----------------------------------------------------------------------
EI2BE_DICDI     --QAVVLGDSFDRKFAPITLEKPRTLLPLVNIPLLDYTLEFLAASGVQQIFVFCCAHASQ----------
YAIX_ECOLI      ----------------------------------------------------------------------
YAIX_ECOL5      ----------------------------------------------------------------------
GLMU_POLSJ      ----VIMAAGKGTRMKS---ALPKVLHQLGGRALLAHVIDCAARLSARQ-AVVIAGHGAADVEAAAAGDA
GLMU_MARMM      -RSAIILAAGQGTRMKS---KTVKVLHKVAGRPMLDWAVALAGDCGASDIVTVWGAHS----PAVRDAAE
GLGC_MYCA9      ----IVLAGGEGKRLYPLTADRAKPAVPFGGARLIDFVLSNLVNARFLRICVLTQYKSHSLDRHISQNWR
EI2BE_RAT       ----------------------------------------------------------------------
ISPD_BIFLO      ---AVVLAAGFGTRFDP---DNPKQLVSVGGKPIVCWSIDAFEHCDVSDIVVVVNPKVRGEVETLVG---
ISPD_BIFLI      ---AVVLAAGFGTRFDP---DNPKQLVSVGGKPIVCWSIDAFEHCDVSDIVVVVNPKVRGEVETLVG---
ISPD_BIFLD      ---AVVLAAGFGTRFDP---DNPKQLVSVGGKPIVCWSIDAFEHCDVSDIVVVVNPKVRGEVETLVG---
GLMU_METFK      ----VILAAGKGTRMNS---SKPKVLHALAGKPVLQHVLDTARRLNPSSI-IVVYGFGGEIVPQALPADD
GLGC_STRAW      ----IVLAGGEGKRLMPLTADRAKPAVTFGGTRLVDFVLSNLVNADILRICVLTQYKSHSLDRHITTTWR
GLGC_MYCTU      ----IVLAGGEGKRLYPLTADRAKPAVPFGGARLIDFVLSNLVNARYLRICVLTQYKSHSLDRHISQNWR
GLGC_MYCTA      ----IVLAGGEGKRLYPLTADRAKPAVPFGGARLIDFVLSNLVNARYLRICVLTQYKSHSLDRHISQNWR
GLGC_MYCBT      ----IVLAGGEGKRLYPLTADRAKPAVPFGGARLIDFVLSNLVNARYLRICVLTQYKSHSLDRHISQNWR
GLGC_MYCBP      ----IVLAGGEGKRLYPLTADRAKPAVPFGGARLIDFVLSNLVNARYLRICVLTQYKSHSLDRHISQNWR
GLGC_MYCBO      ----IVLAGGEGKRLYPLTADRAKPAVPFGGARLIDFVLSNLVNARYLRICVLTQYKSHSLDRHISQNWR
EI2BE_RABIT     ----------------------------------------------------------------------
LPXA_AQUAE      ----------------------------------------------------------------------
GLMU_RHORT      ---AVILAAGQGTRMKS---ALPKVLHPLAGRPMVAHLIHALGAVAPSRTVVVIGP-GMESVADRVAP--
ISPD_IDILO      ---AVIPAAGSGSRMQA---NIPKQFLMVANRTLLEYSIEAVLKARVEQVFVAVSDSNAEELKKSLPTKV
GLMU_CAMFF      ----IILAAGNGTRMKS---NKSKVLHTLCGEPMISHILKKSYEIS-NDVRIVLS-YQFEEVKNSV-LSE
GLGC_MYCPA      ----IVLAGGEGKRLYPLTADRAKPAVPFGGARLIDFVLSNLVNARYLRICVLTQYKSHSLDRHISQNWR
GLGC_AZOSE      ---AFVMAGGEGSRLHPLTAERSKPSVPFNGRRIVDFVLSNLVNSEIYSIYLLVQEHTRRAWVMSPLLPH
Y304_METJA      ----------------------------------------------------------------------
MOBA_PYRKO      -----VLAGGRGRR-----FGGDKLLFRISGKPLLLYTIERLEQAKIDEIVLVASKENAEKLR-------
ISPD_CLOBL      ----IIVAAGKGKRMNS---SISKQFLQIKNKPILYYTLSKFAHESIDEIVLVTLEDKIEVCSDII----
GLMU_PSYCK      ----IILAAGKGTRMQS---AKPKVLQTLAGKSLLGHVLDTCHQLTVDDT-IIVHGFGGEQVQDHIDQ-Q
LICC_HAEIN      ---AIILAAGLGSRFKDITQSTHKSLLDIHGTPNLERTLTFLRQANIDNI-VIVTGYLHEQFE-------
ISPD_CORDI      ---ALVAAAGKGTRLGA---DLPKAYVPLRDIPLVVRSVRMITSAVVDEVIVIISPQMQDYAAALLLRWG
ISPD_CLOB8      MVSAIVLAGGRGKRMGNIQ---SKQYIDLNGAPILYYTLKQFIENDLIDKIILVVPEDEKDYREVL---N
GLMU_COXB2      ----IILAAGQGKRMAS---STPKILHPLGGIPLL-ERVVNTAR--------LLNPHTIQV---VYGNGG
GLMU_ANADE      ---AIVLAAGKGTRMKS---NKAKVLHEVAGRPLAYYPVKRAVELGASPXXXXXXXXXXXXXXXXXXXXX
GLMU_AGRT5      ---AVILAAGDSTRMKS---SKSKVLHPVAGRPMIXXXXXXXXXXXXXXXXXXXX----RDADNVAAAAS


                         .         .         *         .         .         .         .:140
query           NFGLRISYIIQEEPKGLAHAVWVSREFLGDEDFMMYLGDNLILEDLGKFVKDFENSDYAASILLSPVKDP
STRD_STRGR      RFGLKVSYIPQSKPLGLAHCVLISRDFLGEDDFIMYLGDNFVVGVVEDSVREFRAARPDAHLMLTRVPEP
RMLA_STRMU      EFGIKLSYAEQPSPDGLAQAFIIGEEFIGDDHVALILGDNIYYPGLSRMLQKAASKESGATVFGYQVKDP
RMLA1_ECOLI     QWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYHDLPKLMEAAVNKESGATVFAYHVNDP
RMLA_SALAN      QWGLNLQYKVQPSPDGLAQAFIIGEEFIGNDDCALVLGDNIFYHDLPKLMEAAVNKESGATVFAYHVNDP
RMLA1_SHIFL     QWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYHDLPKLMDTAVNRESGATVFAYHVNDP
RMLA_SALTY      QWGLNLQYKVQPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYHDLPKLMEAAVNKESGATVFAYHVNDP
SPSI_BACSU      ELGVTITYQVQPAASGISDGLSYAKRFTKKESFILLLGDNIFEDSLKPYTERFEQQGKGAKVLLKEVDDP
RMLA3_ECOLX     QWGLNLQYKVQPSPDGLAQAFIIGEDFIGGDDCALVLGDNIFYHDLPKLMEAAVNKESGATVFAYHVNDP
RMLA_NEIMB      DFGISISYAVQPSPDGLAQAFIIGEEFIGNDNVCLVLGDNIFYQSFTQTLKQAAAQTHGATVFAYQVKNP
GLMU_METM7      ----KIEYILQEKQLGTGHAVLTAKNFIKD-DFLVLNGD-IIFEDSIDEILVYENA-----VALSKVGHP
GLMU_METM5      N--PKIEYILQEKQLGTGHAVLTAKNFIKD-DFLVLNGD-VIFEDSIDEILDYEN-----AVALSKVDNP
RMLA_NEIMA      DFGISISYAVQPSPDGLAQAFIIGEEFIGNDNVCLVLGDNIFYQSFTQTLKQAAAQTHGATVFAYQVKNP
GLMU_METJA      NHP-KIKFLEQGEIDGTGQAVLTAKDYVDDE-FLVINGDIIFEDDLEEFLXXXXXXXXXXXX------NP
GLMU_META3      KNNDKIKFIEQTDIDGTGYAVLMAKNHISG-DFLVINGDIIFDDDLTNIVND----DVKNIITLNEVDNP
RMLA_NEIGO      DFGIRLQYAVQPSPDGLAQAFIIGEEFIGNGNVCLILGDNIFYQSFTQTLKQAAAKTHGATVFGYRVKDP
RMLA2_SHIFL     EFGIQLEYAEQPSPDGLAQAFIIGETFLNGEPSCLVLGDNIFFQGFSPKLRHVAARTEGATVFGYQVMDP
RMLA2_ECOLI     EFGIQLEYAEQPSPDGLAQAFIIGETFLNGEPSCLVLGDNIFFQGFSPKLRHVAARTEGATVFGYQVMDP
RMLA_YEREN      QFGIRLQYAKQPSPDGLAQAFIIGEEFIAGERCALVLGDNIYFQSFGKQLREVASRNDGATVFGYQVVDA
RMLA_RHISN      QWGISLRYAVQPSPNGLAQAYVIGADFVAGSPSCLILGDNIYFHXXXXXXXXXXXXXXXXTIFAYHVNDP
GLMU_METVS      ----KIEFIVQEKQLGTGHAVLMAKNYI-KGDFLVLNGDVIFESDILEFL------NYENAVGLSKVDNP
RMLA_XANCP      QWGVNIQYAVQPSPDGLAQAYLIGRDFVGGKPSCLVLGDNIFHHGLTDTLRRADAREQGATVFGYWVNDP
RMLA_XANCB      QWGVNIQYAVQPSPDGLAQAYLIGRDFVGGKPSCLVLGDNIFHHGLTDTLRRADAREQGATVFGYWVNDP
GLMU_METMP      N--PKIEYILQEKQLGTGHAVLTAKNFIKG-DFLVLNGD-VIFEDSIDEILNYENA-----VSLSNVDNP
ACBA_ACTS5      QWGLRLEFAVQQRPGGIAEAFLIGEEFLAGGPVALMLGDNLLHGVDFRPCVQRARETAGGHVFGVAVADP
MPG1_SULAC      NLQKNIVSVIEESRLGDAGPLFINSKYNLSDDVIVVYGDIYAEIDFNKLLEYHQSKGCNATLTATQVEDP
GMPPB_CAEBR     RLGVKLIFSLEEEPLGTAGPLALARKHLEDDDPFFVLNSDVICDFPFKQMVEFKQHGKEGTIAVTKVEEP
GMPPB_CAEEL     RLGVKLIFSLEEEPLGTAGPLALARKHLGDAPFFVLNSDVICDFPFKQMVEFHKNHGKEGTIAVTKVEEP
GMPPB_MOUSE     RLGIRISMSHEEEPLGTAGPLALARDLLSEDPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEP
GMPPB_DANRE     RLGIKISLSHEKEPLGTAGPLALARELLTDEPFFVLNSDVICDFPFDDMLKFHQQHGREGTIVVTKVEEP
GMPPB_HUMAN     RLGIRISMSHEEEPLGTAGPLALARDLLSEDPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEP
GMPPB_PIG       RLGIRISMSHEEEPLGTAGPLALARDLLSEEPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEP
GTAB2_STAS1     KTDLNIFYVRQKEQKGLGHAIYSARQFIGDEPFAVLLGDDIVYEETGKSVIGVQEVDEAQTHRYGIIDPL
GMPPB_BOVIN     KLGIRISMSHEEEPLGTAGPLALARDLLCEDPFFVLNSDVICDFPFEAMVQFHRHHGQEGSILVTKVEEP
GLGC_CLOBB      DGGVSILPPYQEEKKGTANAIYQNIEFVDDPEYVLILGDHIYKMNYTKMLEFHKNADATIGVIEVPVNEA
GLGC_CLOBA      DGGVSILPPYQEEKKGTANAIYQNIEFVDDPEYVLILGDHIYKMNYTKMLEFHKNADATIGVIEVPVNEA
GMPPB_DROPS     KLGVELIFSHETEPLGTAGPLALAKSILSPEPFFVLNSDVICDFPFKQLVQFHRNHGKEGTIVVTKVEEP
MPG1_CRYNE      EFGINIHFSVETEPLGTAGPLALAREILGKDDFFVLNSDVTCVYPFEAF-RDFHIAHKCGSIMVTKVAEP
GTAB_BACSU      NXXXXIHYIRQKEPKGLGHAVWCARNFIGDEPFAVLLGDDIVQAELRQLMDEYEKTSSIIGVQQVPEEET
GTAB1_STAS1     KSDLNMFYVRQKEQKGLGHAIWTARQFIGNEPFAVLLGDDIVQADT-PAIKQLMNQYETTGKSIIGVQET
GMPPB_DICDI     KLGIKISYSHETVPLGTAGPLALARDLLNDGEPFFVLNSDIICDDLLAFHKSHGGE---GTIMVTKVEEP
Y1334_METJA     RLG-NIFYVRQKEQKGLGDAILYGEEFVGEEYFIAMVGDTIYSKNI---VKDLAHEKYGCSVIAVPKEDV
GTAB_STAHJ      KDDLNIFYVRQKEQKGLGHAIHTARQFIGNEPFAVLLGDDIVESEIKQLMNVYEETGHSVGVQEVPESVT
MPG11_CANGA     EYGVSITFSVETEPLGTAGPLKLAEKVLKDNSPFFVLNSDVICEYPFKELADFHKAHGGGTIVATKVDEP
GMPBB_XENLA     RLGIRISMSHEKEPLGTAGPLALARELLNSEPFFVLNSDVICDFPFEDMVRFHKHHGKEGTIVVTKVEEP
GALU_PSEAE      LIDCTFAYTRQVEMKGLGHAILTGRPLIGDEPFAVVLADDLVLKQMVKLYNQFRCS--IVAIQEVPPEET
GLGC_BACAH      AWDLRVSGGVTVLPPGTASAIYQNLNYLSEPDYVLILGDHIYKMDYSKML-DYKEADVSISVIEVPWDEA
GTAB_STAES      NKGANIFYVRQKEQKGLGHAIHTAKQFIGNEPFAVLLGDDIVESDIKQLMDVYEETGHSVGVQEVPESDT
GTAB_STAEQ      NKGANIFYVRQKEQKGLGHAIHTAKQFIGNEPFAVLLGDDIVESDIKQLMDVYEETGHSVGVQEVPESDT
GMPBA_XENLA     RLGIRISMSHEKEPLGTAGPLALARELLNSEPFFVLNSDVICDFPFEDMVRFHKHHGKEGTIVVTKVEEP
GMPPB_XENTR     RLGIRISMSHEKEPLGTAGPLALARELLNSDPFFVLNSDVICDFPFEEMVRFHKHHGKEGTIVVTKVEEP
CAP3C_STRPN     STDIKVHFVRQSSPRGLGDAVLQAKSFVGDDPFVVMLGDDLMAVPLTRQLMDDYNATQASTIAVMPVRDV
MPG1_YEAST      EYGVNITFSVETEPLGTAGPLKLAEDVLKDNSPFFVLNSDVICEYPFKELADFHKAHGGGTIVATKVDEP
GLGC_BACHK      AWDLRVSGGVTVLPPGTASAIYQNLNYLSQEYVLILSGDHIYKMDYSKML-DYKEADVSISVIEVPWDEA
GLGC_BACCZ      AWDLRVSGGVTVLPPGTASAIYQNLNYLSQEYVLILSGDHIYKMDYSKML-DYKEADVSISVIEVPWDEA
GLGC_BACAN      AWDLRVSGGVTVLPPGTASAIYQNLNYLSQEYVLILSGDHIYKMDYSKML-DYKEADVSISVIEVPWDEA
MPG12_CANGA     EYGVNITFSVETEPLGTAGPLKLAEKILKDNSPFFVLNSDVICEYPFKELAEFHKSHGGGTIVATKVDEP
GLGC_BACCR      AWDLRVSGGVTVLPPGTASAIYQNLNYLSQEYVLILSGDHIYKMDYSKML-DYKESDVSISVIEVPWDEA
GMPPB_DROME     KLGVELIFSHETEPLGTAGPLALAKTILSSEPFFVLNSDVICDFPFKQLVQFHCNHGKEGTIVVTKVEEP
GLGC_BACCQ      AWDLRVSGGVTVLPPGTASAIYQNLNYLSQEYVLILSGDHIYKMDYSKML-DYKEADVSISVIEVPWDEA
MPG1_GIBZE      KFGINIEFSVETEPLDTAGPLKLAERILAKDDSPFFVLNSDVIEDLLAFHKSHGNE---GTIVVTKVEEP
GLGC_CLONN      PWDLDVSILPPHMRNGTADAIYQNIMFIDDPEYILVLGDHIYKMDYSKMLQFHKNSDATIAVIDVPIEEA
GLGC_CLOB8      AWGVHVLPPYQEEKKGTANAIYQNIEFVDDPEYILILGDHIYKMDYTKML-DFHKEKQAEAVIEVPMDEA
GLGC_BACC1      AWDLRVSGGVTVLPPGTASAIYQNLNYLSQEYVLILSGDHIYKMDYSKML-DYKEADVSISVIEVPWDEA
MPG1_ASHGO      QYGVSITFSVETEPLGTAGPLKLAEKVLKDNSPFFVLNSDVICEYPFKELAAFHRAHGGGTIVATKVDEP
GALU_MYCPN      L--AHIYFVRQKHQHGLGDAILHAKSFVGNEDFAVLLGDDVVFGELAQCIQAYEQTDQVIGVQEVPHDQV
GLGC_CLOPS      TWGVSILPPYQKEKKGTANAIYQNIEFIEDPEYVLILGDHIYKMDYDKMLEMHKQKEADATIAVIPMHEA
GALU2_PSEAE     EVGIRFSYTRQTQMKGLGHAILTGRPLIGDEPFAVVLADDLCVNVLTQMVKLYQK--YRCTIVAVMEVNP
YTDA_BACSU      AFDIRIHYVRQPYAKGLGDAISFGKQFAGGEPFAVVLPDDLIFSALGQLIEAY--TKYQSSVILKETKTE
GTAB_STAAB      XXXXNIFYVRQKEQKGLGHAISSARQFIGNEPFVVLLGDDIVESEVKQLIDVYEETGHSVGVQEVPEADT
GTAB_STAAR      XXXXNIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIVESEVKQLIDVYEETGHSVGVQEVPEADT
GTAB_STAAW      XXXXNIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIVESEVKQLIDVYEETGHSVGVQEVPEADT
GTAB_STAAS      XXXXNIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIVESEVKQLIDVYEETGHSVGVQEVPEADT
GTAB_STAAN      XXXXNIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIVESEVKQLIDVYEETGHSVGVQEVPEADT
GTAB_STAAM      XXXXNIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIVESEVKQLIDVYEETGHSVGVQEVPEADT
GTAB_STAAC      XXXXNIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIVESEVKQLIDVYEETGHSVGVQEVPEADT
GTAB_STAA8      XXXXNIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIVESEVKQLIDVYEETGHSVGVQEVPEADT
GTAB_STAA3      XXXXNIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIVESEVKQLIDVYEETGHSVGVQEVPEADT
GLGC_STRA3      SWGLDDSGVTVLQPQGTSHAIYQNIDYINPEYVLILSGDHIYKMDYDDMLQTHKDNSLTVAVLDVPLKEA
GLGC_CLOPE      TWGVSILPPYQKEKKGTANAIYQNIEFIEDPEYVLILGDHIYKMDYDKMLEMHKQKEADATIAVIPMHEA
GLGC_STRSV      SWGLDQPYSASEGNRGTSHAIYQNIDYIDSEYVLILSGDHIYKMDYDDMLQSHKNASLTVAVLDVPLKEA
GLGC_BACCN      AWDLRVNGGVTVLPPGTASAIYQNMNFLNPEYVLILSGDHIYKMDYSKML-DYKEADVSISVIEVPWDEA
MPG1_KLULA      EFGVSITFSVETEPLGTAGPLKLAESVLKDNSPFFVLNSDVICDYPFKELADFHQAHGGGTIVATKVDEP
HASC_STRPY      NTAINLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMAKPLTKQLMEDYDKTHASTIAVMPHEDV
HASC1_STRP8     NTAINLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMAKPLTKQLMEDYDKTHASTIAVMPHEDV
GLGC_MYCMO      PFDLNLSPYVKESEAGTAHAIFENIDFMNEYDALILSGDHIYKMDYSKML-DFKNANVTIATINVSFEEA
HASC2_STRP8     TTSINLHFIRQSHPRGLGDAVLQAKTFVGNEPFVVMLGDDLMVKPLTKLIDDYEETHAATAVMRVPHEDV
HASC2_STRP6     NTAINLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMAKPLTKQLMEDYDKTHASTIAVMPHEDV
HASC2_STRP3     TTSINLHFIRQSHPRGLGDAVLQAKTFVGNEPFVVMLGDDLMVKPLTKLIDDYEETHAATAVMRVPHEDV
HASC2_STRP1     TTSINLHFIRQSHPRGLGDAVLQAKTFVGNEPFVVMLGDDLMVKPLTKLIDDYEETHAATAVMRVPHEDV
HASC1_STRP6     TTSINLHFIRQSHPRGLGDAVLQAKTFVGNEPFVVMLGDDLMVKPLTKLIDDYEETHAATAVMRVPHEDV
HASC1_STRP3     NTAINLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMAKPLTKQLMEDYDKTHASTIAVMPHEDV
CAP4C_STRPN     TTDMRLHFIRQTHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMAVPLTKQLMDDYERTHASTIAVMPVDEV
GLGC_STRU0      SWGLRGVTILQPFSEGTSHAIYQNIDYIDSEYVLILSGDHIYKMDYEEMLQVHKDNSLTVAVLDVPLKEA
GLGC_STRA5      SWGLDDSGVTVLQPQGTSHAIYQNIDYINPEYVLILSGDHIYKMNYDDMLQTHKDNSLTVAVLDVPLKEA
GLGC_STRA1      SWGLDDSGVTVLQPQGTSHAIYQNIDYINPEYVLILSGDHIYKMNYDDMLQTHKDNSLTVAVLDVPLKEA
GALU_SHIFL      MLEKRVKRQLLDEAKGLGHAVLCAHPVVGDEPVAVILPDDLSQDNLAEMIRRFDETGHS-QIMVEPVADV
GALU_ECOLI      MLEKRVKRQLLDEAKGLGHAVLCAHPVVGDEPVAVILPDDLSQDNLAEMIRRFDETGHS-QIMVEPVADV
GALU_ECOL6      MLEKRVKRQLLDEAKGLGHAVLCAHPVVGDEPVAVILPDDLSQDNLAEMIRRFDETGHS-QIMVEPVADV
GALU_ECO57      MLEKRVKRQLLDEAKGLGHAVLCAHPVVGDEPVAVILPDDLSQDNLAEMIRRFDETGHS-QIMVEPVADV
HASC1_STRP1     NTAINLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMAKPLTKQLMEDYDKTHASTIAVMPHEDV
GLGC_LACCB      SWGLNERYASSEGEKGTAHAIYQNIAYIDSYNLLILSGDHIYKMDYQAMLDYHKAKKASLTVAVMPVEEA
GLGC_LACC3      SWGLNERYASSEGEKGTAHAIYQNIAYIDSYNLLILSGDHIYKMDYQAMLDYHKAKKASLTVAVMPVEEA
MPG1_PICAN      EYGVSITFSVEEEPLGTAGPLKLAEKILKKDNTPIFLNSDVICEYPLRDLLEFHTAHGGATIVATKVDEP
GLGC_STRP4      SWGLDQPYSASEGNRGTSHAIYQNIDYIDSEYVLILSGDHIYKMDYDDMLQSHKNASLTVAVLDVPLKEA
GLGC_DESHY      NGGIHILPPFVGEAKGTANAIYQNMDFINPEYILILSGDHIYQMDYYEMLSYHKHAEVTLSAIAVPWEEA
GLGC_STRGC      SWGLDQPYSASEGNRGTSHAIFQNIDYIDSEYVLILSGDHIYKMDYDDMLQSHKNASLTVAVLDVPLKEA
GLGC_BACWK      AWDLRVNGGVTVLPPGTASAIYQNLNYLSQEYVLILSGDHIYKMDYSKML-DYKEADVSISVIEVPWDEA
MPG1_NEUCR      QFGINITISIESEPLGTAGPLKLAEDVLRKDDTPFFLNSDVTCEYPFKELAAFHKAGDEGTIVVTKVEEP
GLMU_ENTFA      HLGERSQYALQAEQLGTGHAVMQAQELLGGKQTLVITGDTPLLETLKNLFDYHQGKNASATILTAHAEDP
GLGC_STRZT      SWGLDQPYSASEGNRGTSHAIYQNIDYIDSEYVLILSGDHIYKMDYDDMLQSHKNASLTVAVLDVPLKEA
GLGC_STRZP      SWGLDQPYSASEGNRGTSHAIYQNIDYIDSEYVLILSGDHIYKMDYDDMLQSHKNASLTVAVLDVPLKEA
GLGC_STRZJ      SWGLDQPYSASEGNRGTSHAIYQNIDYIDSEYVLILSGDHIYKMDYDDMLQSHKNASLTVAVLDVPLKEA
GLGC_STRPN      SWGLDQPYSASEGNRGTSHAIYQNIDYIDSEYVLILSGDHIYKMDYDDMLQSHKNASLTVAVLDVPLKEA
GLGC_STRPJ      SWGLDQPYSASEGNRGTSHAIYQNIDYIDSEYVLILSGDHIYKMDYDDMLQSHKNASLTVAVLDVPLKEA
GLGC_STRPI      SWGLDQPYSASEGNRGTSHAIYQNIDYIDSEYVLILSGDHIYKMDYDDMLQSHKNASLTVAVLDVPLKEA
GLGC_STRR6      SWGLDQPYSASEGNRGTSHAIYQNIDYIDNEYVLILSGDHIYKMDYDDMLQSHKNASLTVAVLDVPLKEA
GLGC_STRPS      SWGLDQPYSASEGNRGTSHAIYQNIDYIDSEYVLILSGDHIYKMDYDDMLQSHKNASLTVAVLDVPLKEA
GLGC_STRP7      SWGLDQPYSASEGNRGTSHAIYQNIDYIDSEYVLILSGDHIYKMDYDDMLQSHKNASLTVAVLDVPLKEA
GLGC_STRP2      SWGLDQPYSASEGNRGTSHAIYQNIDYIDNEYVLILSGDHIYKMDYDDMLQSHKNASLTVAVLDVPLKEA
GLGC_DESHD      NGGIHILPPFVGEAKGTANAIYQNMDFINPEYILILSGDHIYQMDYYEMLSCHKHAEVTLSAIAVPWEEA
GLGC_BACLD      PWDLDRNYAEASEVKGTASAIYENRHFLKEEHVLILSGDHIYKMDYGKMLEYHAEKQADATIAVIEVSEA
GLGC_STRMU      SWGLSGATILQPYSQGTSHAIYQNIDYIDSEYVLILSGDHIYKMDYDDMLQTHKDNSLTVAVIDVPLKEA
GALU_MYCGE      L--AHIFFVRQKNQDGLGDAILFAESFVGNEDFAVLLGDDVVFSK-EPALKQCLEAYYETNCQTIGVQDP
GALU_HAEDU      --DVTLMHVRQGQAKGLGHAVLCGKAVVGKEPFAVVLPDVILTENLAAMIKRFSETQ-CSQIMVAPVEDV
GALU_HAEIN      --NVTIMHVRQGNAKGLGHAVLCGRPLVGNESFAVMLPDVLLAENLAAMIQRF-NETGASQIMVTPVENV
GLMU_AQUAE      NENLK--FFIQENPKGTADAVLAAKDFFSSEGYVLIIGDSPLMQQFIHMVRTYEGIKLGGVVLTTHLPDP
GLGC_STRS7      SWGLSGATILQPYSQGTSHAIYQNIDYIDSEYVLILSGDHIYKMDYDDMLQTHKANSLTVAVIDVPLKEA
GLMU_CLOTH      KMGDKVLYAFQEKQLGTGHALMQAQEYLKDKDVVVLYGDTPLIKTISDTINYHREQANSATIITAVLNNP
GLMU_BACSK      ----KIEFVMQPEQLGTGHAVKCAEHLLASQKTVVLCGDTPLITTIKKLMDTHEANGAKATVLTAHAPDP
GLGC_THEAB      PWGVTILQPYYTEKKGVADAVYRNIEFVDDEYVVILSGDHIYSMDYNELLDYHKAKSALATVACMPLSEA
GLGC_FERNB      PWDLDRKYSTLTESKGTADAVYQNIEFVDEEYIVVLSGDHIYSMDYSEFVYYHISKGALATIACMPITEA
GLGC_CLOAB      PWDLRTSGGVSVLPKGTANAIYQNRHFIEDPEYVVILSGDHIYKMNYLEMLDFKNADATIAVFEVPLNEA
GLGC_LACLM      PWGLNQPYFSQEGSKGTSHAVYQNISYIDQQNVLILSGDHIYKMDYEAMLESHKEREASVSVMEVPLEEA
GLMU_BACLD      QLGEKSEYALQAEQLGTAHAVKQAKSILGSEKTIVICGDTPLLETMEAMLTEHQKKAAKVTILTAVAEDP
GLGC_LACPL      SWGFDSPYSSSEGEKGTAHAIYQNIEYIDQQDLLVLSGDHIYKMDYDAMLKYHQEKKASLTVGVIHVEEA
GLGC_EUBE2      PWDLDVSVLPPYEKSGTANAIYQNLEYMEQEYVLILSGDHIYKMDY-KIMLDYHNADITIAAMPVPMEEA
GLMU_STAES      ----QSLYSFQDKQLGTAHAVKMAHEHLADKETLVVCGDTPLIQTLQSLIEHHESTQSHVTVLSASTINP
GLMU_STAEQ      ----QSLYSFQDKQLGTAHAVKMAHEHLADKETLVVCGDTPLIQTLQSLIEHHESTQSHVTVLSASTINP
GLMU_STAEP      ----QSLYSFQDKQLGTAHAVKMAHEHLADKETLVVCGDTPLIQTLQSLIEHHESTQSHVTVLSASTINP
GLGC_THENN      PWGVEIPYVGRNESKGTANAVYQNLEFLEENDAELVLGDHVYAMNYNDLIDYLKGADGTIACMEVPLEEA
GLMU_LACSS      ----RSQYALQAEQLGTGHAVLQAEDLLKDQDTIVVSGDTPLL-TAGTFEKLFHDKGAKATILTATAPDP
GLGC_THELT      DLDRKKGGVTILPPRGTANAVYQNIEYVADPDFVLILGDHVYAMDYNDII-DFKGAEGTIACIEVPPEET
GLMU_LACAC      GDVEKVKFVFQEKQLGTGDAVMTAKEVLGDKDTLVVTGDTPLFDTFNELFKYHTEKGNAATVLTAEAPNP
GLMU_GEOSW      ----QSEYAFQQEQLGTAHAVMQAAPYLQEKDTLVVCGDTLITAETMQALLDHHLATNAKATILTAVADP
GLGC_FUSNN      PWDLRMDTVLQPHTKGTANAIYQNIKFIEEYDVLILSGDHIYKMNYDKMLQFHKDADATIGVFKVPLVDA
GLGC_LACAC      SWGLASATILQPYTEGTAHAIYQNIDYIDSKDVLILSGDHIYKMDYESMLEEHNGASLTVAVIDVPMKEA
GLMU_CLOB6      TKDRNVTYSMQEEQLGTGHAVICAEEFLKDKKVAIFTGDALITNETIQELFEFHNSGYAATLISSTVQDP
GLMU_BACHD      ----RVSYALQEEQLGTGHAVLQAESALGGRRTIVLCGDTPLLETIDHVMSYHEEEQAKATVLTAELADP
GLMU_BACA2      QLGQKSDYALQAEQLGTAHAVKQAKPFLHGEKTIVICGDTPLLETMEAMLNEHTDKGAKATVLTAVADDP
GLGC_THEP1      PWGVEIPYVGRHESKGTANAVYQNLEFLEENDAELVLGDHVYAMNYNDLIDYLKEADGTIACMEVPIEEA
GLMU_STAAW      HLGERSLYSFQEEQLGTAHAVQMAKSHLEDKETIVVCGDTPLIETLETLIAHHEDANAQATVLSASIQQP
GLMU_STAAS      HLGERSLYSFQEEQLGTAHAVQMAKSHLEDKETIVVCGDTPLIETLETLIAHHEDANAQATVLSASIQQP
GLMU_STAAR      HLGERSLYSFQEEQLGTAHAVQMAKSHLEDKETIVVCGDTPLIETLETLIAHHEDANAQATVLSASIQQP
GLMU_STAAC      HLGERSLYSFQEEQLGTAHAVQMAKSHLEDKETIVVCGDTPLIETLETLIAHHEDANAQATVLSASIQQP
GLMU_STAA3      HLGERSLYSFQEEQLGTAHAVQMAKSHLEDKETIVVCGDTPLIETLETLIAHHEDANAQATVLSASIQQP
GLMU_LISMH      HLAGKSEFVKQEEQLGTAHAVLQAKAELAGKDTLVVCGDTPLIETMEALLKYHHEKRAKATILTTVIEDP
GLMU_BACSU      ----KSEYRVQAKQLGTAHAVKQAQPFLADEKTIVICGDTPLLETMEQMLKEHTQREAKRTILTAVAEDP
GLGC_LACLS      PWGLNQPYSSQEGSKGTSHAVYQNISYIDQQNVLILSGDHIYKMDYEAMLESHKEREASVSVMEVPLEEA
GLMU_STAA8      HLGERSLYSFQEEQLGTAHAVQMAKSHLEDKETIVVCGDTPLIETLVTLIAHHEDANAQATVLSASIQQP
GLMU_LISMC      HLAGKSEFVKQEEQLGTAHAVLQAKAELAGKDTLVVCGDTPLIETMEALLKYHHEKRAKATILTTVIEDP
GLMU_EXIS2      -----VEYALQSEQLGTGHAVQMAEPVLGQESTLVVCGDTPXXXXXXXXXXXXHHAETGATVLTAHADDA
GLMU_CLOK5      T-----SYSFQDKQLGTGHAVLCASDFLKNKRGIVFTGDSLIKENTIKNMLDFEAGGYGATILTSIVQNP
GLMU_CLOK1      T-----SYSFQDKQLGTGHAVLCASDFLKNKRGIVFTGDSLIKENTIKNMLDFEAGGYGATILTSIVQNP
GLGC_THESQ      PWGVEIPYVGRHESKGTANAVYQNLEFLEENDAELVLGDHVYAMNYNDLIDYLKEADGTIACMEVPIEEA
GLGC_LACLA      PWGLNQPYSSQEGSKGTSHAVYQNISYIDQQNVLILSGDHIYKMDYEAMLESHKEREASVSVMEVPLEEA
GLMU_LISW6      HLAGKSEFVKQEEQLGTAHAVLQAKPELAGKDTLVVCGDTPLIETMEALLKYHHEKRAKATILTTVIEDP
GLMU_LISMF      HLAGKSEFVKQEEQLGTAHAVLQAKAELAGKDTLVVCGDTPLIETMEALLKYHHEKRAKATILTTVIEDP
GLMU_CLOBB      K---KVTYSLQSEQLGTGHAVQCASEFLKGKKVAVFAGDTPLIKE--STIKNLFNTHIAATILTAIVDDP
GLMU_BREBN      -----VTYALQEEQLGTAHAVSQAAPFLQDKEFLLY-GDXXXXXXXXXXXXYHEEQQAAATVLTAVLPDA
GLGC_EXIS2      NGGLTILPPYQAQNEGTANAIYRNMSYINDPDYVLVLGDHIYKMDYEKMIEEHRQADVTISVREVPWEEA
MPG1_CANAL      EYGVSITFSVEEEPLGTAGPLKLAEEVLKKDDSPFFLNSDVICDYPFKELADFHKAHGAATIVATKVDEP
GLMU_STAAN      HLGERSLYSFQEKQLGTAHAVQMAKSHLEDKETIVVCGDTPLIETLETLIAHHEDANAQATVLSASIQQP
GLMU_STAAM      HLGERSLYSFQEKQLGTAHAVQMAKSHLEDKETIVVCGDTPLIETLETLIAHHEDANAQATVLSASIQQP
GLMU_LISMO      HLAGKSEFVKQDEQLGTAHAVLQAKAELAGKDTLVVCGDTPLIETMEALLKYHHEKRAKATILTTVIEDP
GLMU_DESAP      ---LGGEVVVQEPQLGTAHAVLQAEEKLADHQVLVVCGDTPLLETLSKLAVRHREADAAATVLTAFLDDP
GLMU_STAAB      HLGERSLYSFQEEQLGTAHAVQMAKSHLEDKTTIVVCGDTPLIETLETLIAHHEDANAQATVLSASIQQP
GLMU_LACJO      EFAF------QEKQLGTGDAVLAANDLLENLETLVATGDTPLFETFNNLFKKHEESGNSATVLTAKAPNP
GLMU_GEOKA      QLGSQCEYALQEEQLGTAHAVMQAAPHLRGLETIVVCGDTPLIETMEMLIEHHMAAKAKATVLTAIADDP
MPG1_EMENI      QYNVKIEFSVETEPLGTAGPLKLAESILAKDDSPFFVLNSDVIQQLAEFHKRHGDE---GTIVVTKVDEP
GLMU_STAHJ      TLGNQSLYSYQEEQLGTAHAVKMANEHLKEVETLVVCGDTPLIHTLQKLIEHHESTHAQATVLSATAQIP
GLMU_LISIN      HLAGKSEFVKQDEQLGTAHAVLQAKSELAGKDTLVVCGDTPLIETMEALLKYHHEKRAKATILTTVIEDP
GLGC_THEMA      PWGVEIPYVGRHESKGTANAVYQNLEFLEENDAELVLGDHVYAMNYNDLIDYLKEADGTIACMEVPIEEA
GLGC_BACSU      NGGVTVLPPYAESSKGTASSIYENLNYLNDPEYVLILGDHIYKMDYGKML-DYKKADVTISVIEVGWEEA
GLMU_BACHK      EFAL------QAEQLGTAHAVDQAAGVLANEETLVICGDTPLIETMEALLQQHKEAGAMATVLTAYIEEP
GLMU_CLOBM      TRDRNVTYSMQEEQLGTGHAVICAEEFLKDKKVAIFTGDALITNETIQELFEFHNSGYAATLISSTVQDP
GLMU_CLOBA      K---NVTYSLQSEQLGTGHAVQCASEFLKGKKVAVFAGDTPLIKESNLFNTHIENKN-AATILTAIVDDP
GLMU_BACCN      EFAL------QAEQLGTAHAVDRAADILANEETLVICGDTPLIETMEALLKHHEEAGAKATVLTAYIEEP
GLGC_THEM4      PWGVTILQPYSTEKKGTADAVYSNIEFVDSPDYVVILGDHIYSMDYNELV-DYHVAKSALGTVACPLSEA
GLGC_LACS1      SWGLDDPYSNNEGSKGTAHAIYQNIGYIDDPEYILILGDHIYKMDYEAMLDQHKETGASLTVAVIPWDEA
GLGC_DESRM      HWDLDVKEMGGEWYKGTANAIYQNIEFVDQKYILILSGDHIYKMDYSLML-DFKQADATIAVIEVPWQEA
GLMU_LACS1      ----RTKYALQAEQLGTGHAVLQAEKLLGDKDGMTLIGDTPLFEELFEYHK---SKGAVATVLTAHAENP
GLMU_LACGA      DFAF------QEQQLGTGDAVLAASDLLENLDTLVATGDTPLFETFNNLFKKHEESGNSATVLTAKAPNP
GLMU_BACWK      EFAL------QAEQLGTAHAVDQAASVLANEETLVICGDTPLIETMEALLQQHEEAGAMATVLTAYIEEP
GLMU_CLOBK      TRDRNVTYSMQEEQLGTGHAVICAEEFLKDKKVAIFTGDALITNETIQELFEFHNSGYAATLISSTVQDP
GLMU_BACCR      EFAL------QAEQLGTAHAVDQAASVLANEETLVICGDTPLIETMEALLQQHKEAGAMATVLTAYIEEP
GLMU_BACCQ      EFAL------QAEQLGTAHAVDQAASVLANEETLVICGDTPLIETMEALLQQHKEAGAMATVLTAYIEEP
GLMU_BACC7      EFAL------QAEQLGTAHAVDQAASVLANEETLVICGDTPLIETMEALLQQHKEAGAMATVLTAYIEEP
GLMU_BACC4      EFAL------QAEQLGTAHAVDQAASVLANEETLVICGDTPLIETMEALLQQHKEAGAMATVLTAYIEEP
GLMU_BACC2      EFAL------QAEQLGTAHAVDQAASVLANEETLVICGDTPLIETMEALLQQHKEAGAMATVLTAYIEEP
GLMU_BACC1      EFAL------QAEQLGTAHAVDQAASVLANEETLVICGDTPLIETMEALLQQHKEAGAMATVLTAYIEEP
GLGC_GEOTN      NGGVTVPYSVSSGVKGTANAVYQNINYIENPDYVLVLSGDHIYKMDYQHMLDYKQADVTISVIEVPWEEA
GLGC_CLOK5      PWGVYVLPPYQEESKGTADAIYQNISFVDNEYVIILSGDHIYYANMLKFHKE-KKADVTIAVIEVPIEET
GLMU_LACBA      ----RTQYALQAEQLGTGHAVLQTEPMLKDETTLIVSGDTPLFEDLFAY---HEAKHAAATILTSMAPDP
MPG1_SCHPO      EYNVNITFSVENEPLGTAGPLALARDILADHSPFFVLNSDVICEDLAAFHK---AHGAEGTIVVTKVEEP
GLMU_THESQ      -----VDVFVQEEQLGTAHAVMCAKDFIGDDVLILYGDVPLISENTLKRMIEEHRKGADVTILVADLEDP
GLMU_THEP1      -----VDVFVQEEQLGTAHAVMCAKDFIGDDVLILYGDVPLISENTLKRMIEEHRKGADVTILVADLEDP
GLMU_CLOBH      TKDRNVTYSMQEEQLGTGHAVICAEEFLKDKKVAIFTGDALITNETIQQLFEFHNSGYAATLISSTVQDP
GLMU_CLOB1      TKDRNVTYSMQEEQLGTGHAVICAEEFLKDKKVAIFTGDALITNETIQQLFEFHNSGYAATLISSTVQDP
GLMU_BACCZ      EFAL------QAEQLGTAHAVDQAAGVLANEETLVICGDTPLIETMEALLQQHKEAGAMATVLTAYIEEP
GLMU_BACC3      EFAL------QAEQLGTAHAVDQAAGVLANEETLVICGDTPLIETMEALLQQHKEAGAMATVLTAYIEEP
GLMU_BACC0      EFAL------QAEQLGTAHAVDQAAGVLANEETLVICGDTPLIETMEALLQQHKEAGAMATVLTAYIEEP
GLMU_BACAN      EFAL------QAEQLGTAHAVDQAAGVLANEETLVICGDTPLIETMEALLQQHKEAGAMATVLTAYIEEP
GLMU_BACAH      EFAL------QAEQLGTAHAVDQAAGVLANEETLVICGDTPLIETMEALLQQHKEAGAMATVLTAYIEEP
GLMU_BACAC      EFAL------QAEQLGTAHAVDQAAGVLANEETLVICGDTPLIETMEALLQQHKEAGAMATVLTAYIEEP
GLMU_BACAA      EFAL------QAEQLGTAHAVDQAAGVLANEETLVICGDTPLIETMEALLQQHKEAGAMATVLTAYIEEP
GLMU_CLOBJ      DRNL--TYSMQEEQLGTGHAVICAEEFLKDKKVAIFTGDALITNETIQQLFEFHNSGYAATLISSTVQDP
GLGC_CLOTH      NGGVTIPYLIGEWYKGTANAVFQNIHYVSPKYVIILSGDHVYKMNYSQML-DFHNADATISVINVPWEEA
GLGC_BACST      NGGVTVPYSVSSGVKGTANAVYQNINYIENPDYVLVLSGDHIYKMDYQHMLDYKQADVTISVIEVPWEEA
GLMU_PEDPA      ----RTEYAIQEQQLGTGHAVLQAEKILGDKDGMTMIGDTPLFT-----AKTFENKGAAATILTARTENP
GLMU_GEOTN      QLGAQCEYALQEKQLGTAHAVMQAAPHLQNLETIVVCGDTPLIETMEALLEHHMTAGAKATVLTAIADDP
GLMU_CLOPE      N----VSYSLQAEQLGTGHAVKCAKDFLEGKTGVVFTGDAPLIETVKNLVDTHINEKNSATLLTSVIENP
EXON_RHIME      SAQISVSFTRQQAPLGLGHAVWCARDLIGDEPFALLLPDMVSFGARGAGLMDLEVGGNVVGVEQCAPEEA
GLGC_THERP      PWDLRNGGVVILQPRGTADAVYHNLFYITRRDVLILAGDHVYAMDYRPMIAQHRERCADVTIAVQPVREA
GLMU_STRU0      EF------VLQTEQLGTGHAVMMAEEKLADGNTLVIAGDTPLIESLKNLIDFHVNHKNVATILTAKAEDP
GLMU_THEYD      KYNIKI--VFQDEPKGTAHALLSALPYLSSDKILILNGDTPLLETLDSFIELFNKNGLDMALLSFYPQRE
GLMU_LACLA      QF------VKQVEQLGTGHAVRIAADLLANEDTLVIAGDTLITGQTLEALFDYHFAQNAATILTAIAPNP
GLMU_CLOBL      TKDRNVTYSMQEEQLGTGHAVICAEEFLKDKKVAIFTGDALITNETIQQLFEFHNSGYAATLISSTVQDP
MPG1_YARLI      KYGVNITFSVETEPLGTAGPLKLAEEILCKDDTPFFVLNSDVICDFAELAEFHKKNNAEATIVATKVEEP
GLMU_LACRJ      QLGHRTKYALQEQQLGTGHAVMQTKDLLANEDTIIVSGDTPLFETFEKLFEYHEQRHAAATILTSIAPDP
GLMU_LACRD      QLGHRTKYALQEQQLGTGHAVMQTKDLLANEDTIIVSGDTPLFETFEKLFEYHEQRHAAATILTSIAPDP
GLMU_CLOPS      N----VSYSLQAEQLGTGHAVKCAKDFLEGKTGVVFTGDAPLIETVKNLVDTHINEKNSATLLTSVIENP
GLMU_CLOP1      N----VSYSLQAEQLGTGHAVKCAKDFLEGKTGVVFTGDAPLIETVKNLVDTHINEKNSATLLTSVIENP
GLMU_CLONN      ---THVLYSIQEEQLGTGHALMCAREFLEGKDVAVFTGDPLITSETVKDCIEFHNGEYKATILTAIVGNP
GLMU_LACLM      QF------VKQVEQLGTGHAVRIAADLLANEETLVIAGDTPLIETLGALFDYHFAQKATATILTAIAPNP
GLMU_CLOD6      KLAEEIIIAMQTEQLGTGHAVKMAKEYINDEDTIVVLGDTPLIETLKRLFEYHIENKYHATVLTTRVGNP
GLMU_STRA5      EF------VMQTEQLGTGHAVMMAEEELATSKTLVIAGDTPLIESLKNLIDFHVNHKNVATILTADAANP
GLMU_STRA1      EF------VMQTEQLGTGHAVMMAEEELATSKTLVIAGDTPLIESLKNLIDFHVNHKNVATILTADAANP
GLMU_LACH4      S-----DFAFQEKQVGTGDAVMTAKEALGDKETLVVTGDTPLFDTFNELFKYHAEKGNAATVLTAEAPNP
GLMU_STRA3      EF------VMQTEQLGTGHAVMMAEEELATSKTLVIAGDTPLIESLKNLIGFHVNHKNVATILTADAANP
GLMU_THEMA      -----VDVFVQGEQLGTAHAVMCAKDFIGDDVLILYGDVPLISENTLKRMIEEHRKGADVTILVADLEDP
GLMU_LACDB      EF------VMQEEQLGTGHAVMQAEGQLAEGATLVVTGDTPLFETFEKLFAYHEEEGNAATVLTAEAPDP
GLGC_OCEIH      PWDMNHQHILPPYTSGTADAIYQNMNFIHQEYVLIISGDHIYQMDYQQMLEQHKNADVTISVIEVPWAEA
GLGC_BACCL      AWDLRNGGVTVLPPEGTANAIYQNMNYIEDPDYVLVLGDHIYKMDYQQML-DYKQADATISVIEVPWEEA
GLMU_STAS1      TLGDTSLYSFQEEQLGTAHAVKMASEHLSESQTLVVCGDTPLIATLKSLVEHHENNQAHATVLSATAENP
GLMU_LACLS      QF------VKQVEQLGTGHAVRIAADLLANEETLVIAGDTPLIETLGALFDYHFAQKATATILTAIAPNP
GLGC_CLOD6      HWDLRINYVLQPFMNGTAHAIYQNMDFVNPEYVLILSGDHIYKMDYSKMLKFHKEKGSKATIAVIPWDEA
GALF_KLEPN      AIGVTIMNVRQAQPLGLGHSILCARPVVGDNPFVVVLPD-IILDNLAAMIARFNETGRSQVLAKRMPGDL
MPG1_DEBHA      EYGVTITFSVEEEPLGTAGPLKLAEKVLKKDDTPIFLNSDVICDYPFQELADFKTSGGKATIVATKVDEP
GLMU_EXISA      ----RVEYAVQEEQLGTGHAVQMAEAELAGKSTLVVCGDTXXXXXXXXXXXXXXXXXXKVTVLTAIADDA
GLGC_ANAVT      FSGFSEGFVAQQTPQGTADAVWMLQEWDVDE-FLILSGDHLYRMDYRLFIQRHRETNADITLSVIPIDDR
GLMU_CLOB8      TLDRNVSYSMQAEQLGTGHAVKCAEEFLKDKKGVVFTGDTPLIKQIERLFNEHIEAKNSATILTAIVNDP
CELA_ACEXY      LKALEATRVISVPPAGTAHAIWCAREFIGNDPFAILLPDDVVQSKIGQLVEVYKTGGNVLAVTEVPREQT
GLGC_DECAR      SFDGRFDEFIQLLPQGTADAVYQNLHFLQPDHILVVAGDHIYKMDYGRMLAHHHHADMTVACIDVPLDEA
GLMU_LACDA      EF------VMQEEQLGTGHAVMQAEGQLAEGATLVVTGDTPLFETFEKLFAYHEEEGNAATVLTAEAPDP
GLMU_HYDS0      N----VSFFEQANPKGTADALLSAKAFFGMDDYILVTNGDLVKPDTIKMVEEYEKIKVGALVLSSFLPDP
GLGC_SYNY3      NFGFQEGFVTKDNPQGTADAVWLFREWDVDE-YLILSGDHLYRMDYAQFVKRHRETNADITLSVVPVDDR
GLGC_CLOCE      PWDMDLSPYLKAEMKGTANAVYQNIQYIDKYSVIILSGDHIYKMDYSKML-DFHKENHAISVINVPYEEA
GLGC_ANASP      FSGFSEGFVAQQTPQGTADAVWMLQEWDVDE-FLILSGDHLYRMDYRLFIQRHRETNADITLSVIPIDDR
GLMU_STRSZ      ----QLLTVVQEEQLGTGHAVMMAEEELSEGQTLVIAGDTPLIESLKALLDYHIREKNVATILTANAKDP
GLGC_BACHD      PWDLDRRHYIEKQGKGTADAIYQNRYYIEDPEYVLILGDHIYKMDYDRMISHHKKADATISVIEVPWEEA
GLMU_PSEA6      -----LNWCLQAEQLGTGHAVQQAVPHISDEDVLILVGDAPLIKTLHNLLQVKNNADVA--LLTVNVADP
GALF_ECOLI      SIGVTIMNVRQGEPLGLGHSILCARPAIGDNPFVVVLPDVVIDDNLAAMIARFNETGRSQVLAKRMPGDL
GALF_ECO57      SIGVTIMNVRQGEPLGLGHSILCARPAIGDNPFVVVLPDVVIDDNLAAMIARFNETGRSQVLAKRMPGDL
GLMU_THETN      ----EVKYAYQKVQLGTGHAVMMAEEFLPLEGMVLILGDTPLIDTLRKLVEYHISEGNDVTILSSIFDDP
GLMU_DESPS      -----CTFVVQEEQLGTAHAVLTAKEAIADEDVMILCGDTPLIQSLEEMYDRHRTNSATVTLMTTQLGDP
GLGS1_VICFA     NEGFVEVLAAQQSPQGTADAVWLFEEH-NVLEYLILAGDHLYRMDYEKFIQAHRESDADITVAALPMKRA
GLMU_ALKMQ      -----VKTVLQAEQLGTGHAVMVAEEHIETQGTVLVLGDGPLIETLNALMTYHQEGKYSATVLTAELENP
GALF_SHIFL      SIGVIIMNVRQGEPLGLGHSILCARPAIGDNPFVVVLPDVVIDDNLAAMIARFNETGRSQVLAKRMPGDL
MPG1_ASPOR      QYNVKIEFSVESEPLGTAGPLKLAEKILGKDDSPFFLNSDVICDYPFKELAEFKKHGDEGTIVVTKVDEP
GLMU_SHESH      -----LNWVLQAEQLGTGHAVAQANDNIGDDDTVLILGDVPLIQASTLEALLAAREDNGLAILTVNLANP
MPG1_ASPFU      QYNVRIEFSVESEPLGTAGPLKLAEKILGKDDSPFFLNSDIICDYPFKQLAEFKKHGDEGTIVVTKVDEP
GLMU_STRSY      EFAL------QSEQLGTGHAVMMAEPALAEGQTLVIAGDTPLIESLKNLINFHVSHKNVATILTAQADNP
GLMU_STRS2      EFAL------QSEQLGTGHAVMMAEPALAEGQTLVIAGDTPLIESLKNLINFHVSHKNVATILTAQADNP
GLMU_FERNB      -----VKTYLQEPQLGTGHAVMCARDFISEEDLLVLYGDVPLLETINKLKKEHEEQKNQVTVLTFVTDNP
GLMU_STACT      AYGF------QEEQLGTAHAVKMAADELKDRETLVVCGDTPLIDTLNALVKHHEDNQADATVLSATAPNP
GLMU_LACF3      ----QVRYALQKQQLGTGHAVMQTEDLLGEGQTLVVSGDTPLFATFNHLFQYHEQRHAAVTILTSKAPDP
GLGS_ORYSJ      NEGFVEVLAAQQSPQGTADAVWLFEEH-NVMEFLILAGDHLYRMDYEKFIQAHRETDSDITVAALPMKRA
GLGS_HORVU      NEGFVEVLAAQQSPQGTADAVWLFEEH-NVMEYLILAGDHLYRMDYEKFIQAHRETDADITVAALPMDEA
GLGS_BRANA      NEGFVEVLAAQQSPQGTADAVWLFEEH-NVLEFLVLAGDHLYRMDYEKFIQAHRETDADITVAALPMKRA
GLMU_THELT      N----VEVVHQSQQLGTGHAVMSARNFIDPADNLLILGDMPLITEIQKIINSHNLSNCDATVVSVEMNDP
GLMU_STRSV      DF------VRQTEQLGTGHAVMMAEPVLENGQTLVIAGDTPLIESLKNLIDFHINHKNVATILTAEADNP
GLMU_DESHD      ----RTEVVVQEEQCGTGHAIMQAIPHCHEVDHIIVLGDQPLIETLRNLVRIHIEHNAAATLLTACFENP
GLMU_SYMTH      YLGDRVRYAVQSEQLGTGHAVLQAAGLIDETEVLVMYGDNPFIELIERLIRAHVEADAAASLLTAELADP
MPG1_TRIRE      KYNINIEFSVESEPLDTAGPLKLAERILGKDDSPFFLNSDVICDYPFKELLEFHKAGDEGTIVVTKVEEP
GLMU_STRT2      S-----AFTMQTEQLGTGHAVMMAEEELAEGQTLVIAGDTPLIESLKNLIDFHVNHKNVATILTATADNP
GLMU_DESHY      ----RTEVVVQEEQCGTGHAIMQAIPHCHEVDHIIVLGDQPLIETLRNLIRIHIEHNAAATLLTACFENP
GLGS_WHEAT      NEGFVEVLAAQQSPQGTADAVWLFEEH-NVMEYLILAGDHLYRMDYEKFIQAHRETDADITVAALPMDEA
GLGS_BETVU      NEGFVEVLAAQQSPQGTADAVWLFEEH-NVLEYLILAGDHLYRMDYERFVQAHRETDADITVAALPMKRA
GLGS2_VICFA     NEGFVEVLAAQQSPQGTADAVWLFEEH-NVLEYLVLAGDHLYRMDYERFIQAHRESDADITVAALPMDEA
GALF_SALTY      SIGVTIMNVRQAQPLGLGHSILCARPVVGDNPFIVVLPXDPLRYNLAAMVARFNETGRSQVLAKRMKGDL
GALF_SALTI      SIGVTIMNVRQAQPLGLGHSILCARPVVGDNPFIVVLPXDPLRYNLAAMVARFNETGRSQVLAKRMKGDL
GLMU_OCEIH      EFA------FQKEQLGTGHAVLQAEDLLKDEKTVVACGDTPLIETFEELIQYHKKTGAKASILTTKVENP
GLGS_SOLTU      NEGFVEVLAAQQSPQGTADAVWLFEEHTVLE-YLILAGDHLYRMDYEKFIQAHRETDADITVAALPMKRA
GLGS_SOLLC      NEGFVEVLAAQQSPQGTADAVWLFEEH-NVLEYLILAGDHLYRMDYEKFIQAHRETDADITVAALPMKRA
GLGC_SYNP6      GFEVLAAQITPENPQGTADAVWLIKEWDVDE-YLILSGDHLYRMDYSQFIQRHRNADITLSVLPIDEKRA
GLGC_SYNP2      FTGFTEGFTTKENPQGTADAVWLLEDWDVDE-YIILSGDHLYRMDYREFIQ--RHRDTGADITLSVVKVA
GLGC_SYNE7      GFEVLAAQITPENPQGTADAVWLIKEWDVDE-YLILSGDHLYRMDYSQFIQRHRNADITLSVLPIDEKRA
GLGC_GEOLS      -FCVAISPETSSDSKGTADAILQYLRFVADADYVVFGGDHIYKMDVTQMIQRMNRADLTIASLEVPKEEA
GLGC_CYAA5      FTGFHDGFVTTENPQGTADAVWLFDEWDVDE-YLILSGDHLYRMDYSDFVKRHRGADITLSVVPIDEKRA
GLMU_STRTD      S-----AFTMQTEQLGTGHAVMMAEEELAEGQTLVIAGDTPLIESLKNLIDFHVNHKNVATILTATADNP
GLMU_STRT1      S-----AFTMQTEQLGTGHAVMMAEEELAEGQTLVIAGDTPLIESLKNLIDFHVNHKNVATILTATADNP
GLGC_NOSP7      NEGFVEVLAAQQTPQGTADAVWLMEEW-DVEEYLILSGDHLYRMDYRQFIQ--RHRDTGADITLSVIPID
GLMU_STRGC      EF------VRQTEQLGTGHAVMMAEPVLENGQTLVIAGDTPLIESLKNLIDFHINHKNVATILTAEADNP
GLMU_LACPL      ----RTEYAVQTEQLGTGHAVLQAESLLKDADGMTLIGDTPLFETFEELFEYHQAKGAAGTILTSKAPNP
GLGC_CYAP7      FTGFNDEFVTAENPQGTADAVWLMEEWDVDE-YLILSGDHLYRMDYREYIQRHRETKADITLSVVPIDEK
GLMU_STRZT      T-----EFVTQSEQLGTGHAVMMTEPILESGHTLVIAGDTPLIESLKNLIDFHINHKNVATILTAETDNP
GLMU_STRR6      EF------VTQSEQLGTGHAVMMTEPILESGHTLVIAGDTPLIESLKNLIDFHINHKNVATILTAETDNP
GLMU_STRP2      EF------VTQSEQLGTGHAVMMTEPILESGHTLVIAGDTPLIESLKNLIDFHINHKNVATILTAETDNP
GLGC_CYAP4      FSGFSDGFVAQQTPQGTADAVRQYLWLLSDWEVDYYLGDHLYRMDYRLFVNRHRDTNADITLSVLPVEEQ
GLMU_SHEPA      -----LNWVLQAEQLGTGHAVAQASANIADDDTVLILGDVPLIQASTLEALLAAREENGLAILTVNLPNP
GLMU_SHELP      -----LNWVLQAEQLGTGHAVAQANDNIGDDDTVLILYGDVPLIQVSTLEALLAARDNGLAILTVNLHDP
GLMU_MYXXD      DAPLR--FALQREQRGTADAVRSAEEALGYSGRVLILYGDVPXXXXXXXXXXXXXHDQAGAMVTTTLEDP
GLMU_STRP4      T-----EFVTQSEQLGTGHAVMMTEPILESGHTLVIAGDTPLIESLKNLIDFHINHKNVATILTAETDNP
GLMU_SHEHH      -----LNWVLQAEQLGTGHAVAQANDNISDDDTVLILGDVPLIQASTLEALLAAREDNGLAILTVNLPNP
GLGC_METFK      GFLLPAQQRIQEEYKGTADAVFQNLDILRQEFVLILAGDHVYKMDYGQMLAAHNKADMTVACINVPLKEA
GLMU_SHEWM      -----LNWVLQAEQLGTGHAVAQANSNIADDDTVLILGDVPLIQASTLEALLAAREENGLAILTVNLPNP
GLMU_ALKOO      SLTPDVKTVLQKEQLGTGHALMMAEPYIDDGTILVLCGDGPLIETLNRTVAYHREGNFKATVLTTDLANP
GLMU_STRPI      EF------VTQSEQLGTGHAVMMTEPILESGHTLVIAGDTPLIESLKNLIDFHINHKNVATILTAETDNP
GLMU_STRP7      EF------VTQSEQLGTGHAVMMTEPILESGHTLVIAGDTPLIESLKNLIDFHINHKNVATILTAETDNP
GLMU_STRZJ      EF------VTQSEQLGTGHAVMMTEPILESGHTLVIAGDTPLIESLKNLIDFHINHKNVATILTAETDNP
GLMU_FUSNN      -----VSYVVQEEQLGTGHAVKQAIPKIKDYD-----GDVLIIQTLIDFYNLYKNENADGIILSAIFENP
GLMU_SULDN      RYFNDINFVTQDAINFPGTGGAMKGVNIKNERVLVLNGDMPLVESLDGFLE--AQGDVVMSIF--NLQNP
GLMU_STRPN      EF------VTQSEQLGTGHAVMMTEPILESGHTLVIAGDTPLIESLKNLIDFHINHKNVATILTAETDNP
GLMU_SHESM      -----LNWMLQAEQLGTGHAVAQAIPNIDDNDTVLILGDVPLIQASTLEALLAARPDHGVAILTVNLVNP
GLMU_CLOTE      TESRSVSFSFQEQQLGTGHAVKCAKEFLGKENVAIFTGDAPLIKTIKTLMEYHETNGFHGTILTSIIDNP
GLMU_PELCD      -----VSFALQSEQLGTGHALLCARQALQEFSLLLLCGDVPLLRDLERLIAEHEKTRAAVTVLTAELSQP
GLMU_CALS8      N----VRFAYQEKQLGTAHAVMCAMSEISDDSFVLYGDVPFIKADTLKKLSQKRKEEAAALCLLTAIENP
GLGC_SYNPW      GFEVLAAQQTPESPEGTADAVWLFQEWDVDE-YLILSGDQLYRMDYSLFINHHRSTGADLTVAALPVKQA
GLGC_RHIME      NFFLPASQRVSETQEGTADAVYQNIDIIEDHEYMVILGDHVYKMDYELMLQQHVDSDVTVGCLEVPRMEA
GLMU_DESRM      ----KARVVLQREQLGTAHALLQAEGELTDGHLLVVCGDTPLLETLAKLADYHCESGAVATLLTAEMADP
GLMU_DEIGD      RFAR------QAQQLGTGNAFLVGAEALGDADILVLYGDTPLLETLRALLADHRAHNSALTILTAELPDA
GLMU_STRMU      EF------VLQSEQLGTGHAVMMAESSLAELETLVIAGDTPLIESLKNLLHYHKSHKNVATILTAEADDP
GLMU_SHESA      -----LNWMLQAEQLGTGHAVAQAIPNIDDNDTVLILGDVPLIQASTLEALLAARPDNGVAILTVNLSNP
GLMU_CLOAB      -----ISYSLQSEQLGTGHAVKCAEDFLRGKDVAIFTGDPLITEDTVKNLIDFEKGGYKATIITALIDNP
GLMU_BIFLI      SYDEQVTIVNQDDIPGTGRAVQCAMAQLTDGPVLIAASDMPLLETLHRLVEFHTASGNGATVLTTILDDP
GLGC_RHISN      NFFLPASQRVSETQEGTADAVFQNIDIIEDHEYMVILGDHIYKMDYELMLQQHVDSDVTIGCLEVPRMEA
GLGC_CYAP8      FTGFSDGFVTAENPKGTADAVWAFQEWDIDE-YLILSGDHLYRMDYRDFIQRHRETGADITLSVVPIDEE
GLGC2_ALHEH     DFGEFVEILPAQQRRGTADAVYQSLDIMHDPDYVLILGDHVYKMDYGPMLARHTGADVTVGCLEVPVEEA
GLMU_SYNWW      ----KIRFVLQEQQLGTGHALMQAEAVVAPEDTILVLAGDIPLTSLQQLMESHRQKQATATVLSVNMQNP
GLMU_SHEON      ----KLNWILQAEQLGTGHAVAQAIPNIDDNDTVLILGDVPLIQASTLEALLAARPEYGVAILTVNLANP
GLMU_PROM9      ----KIHFVIQEPQSGTGHAIQICREVKKNEGKLLVLNGDVPLETLKNLLNLHDSKNADVSLITTKKKNP
GLMU_PROM5      N----IHFIVQKPQKGTGHAVQVLSQKVKKHDLIVLNGDVPLIETLKKLIHYHDSQKADVSLITTKKKNP
GLMU_SHESW      -----LNWVLQAEQLGTGHAVAQASPYIADNDTVLILGDVPLIQASTLEALLAARPENGVAILTVNLANP
GLMU_SHEPC      -----LNWVLQAEQLGTGHAVAQASPYIADNDTVLILGDVPLIQASTLEALLAARPENGVAILTVNLANP
GLGC_SALDC      LFSEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVVCMPVKEA
GLMU_STRP6      ----QSAFVHQTEQLGTGHAVMMAETQLEEGHTLVIAGDTPLIESLKSLIDFHVNHKNVATILTATAQDP
GLGC_RHILO      NFILPASQRVSETQEGTADAVYQNIDIIGPEYMVILAGDHIYKMDYEMMLRQHANADVTVGCLEVPRMEA
GLMU_MYCGI      HLGRTVDIAVQEEQRGTGHAVECGLAAL-PADFVVTAGDVPLLDTLAQLIATHDAESADVTLLTTTMADP
GLGC_SALTY      LFSEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVKEA
GLGC_SALTI      LFSEEMNEFVDLLPRGTADAVTQNLDIIRAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVKEA
GLGC_SALSV      LFSEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVKEA
GLGC_SALPK      LFSEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVKEA
GLGC_SALPA      LFSEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVKEA
GLGC_SALNS      LFSEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVKEA
GLGC_SALHS      LFSEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVKEA
GLGC_SALEP      LFSEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVKEA
GLMU_STRPM      ----QSAFVHQTEQLGTGHAVMMAETQLEEGHTLVIAGDTPLIESLKSLIDFHVNHKNVATILTATAQDP
GLMU_SHESR      -----LNWMLQAEQLGTGHAVAQAIPNIDDNDTVLILGDVPLIQASTLEALLAARPDQGVAILTVNLSNP
GLMU_SHEAM      -----LNFVLQAEQLGTGHAVAQAIDHINDEDTVLVLYGDVPLETLEALLAARQPDGVA--VLTVHLDNP
GLMU_BDEBA      PMG--VACYVQDEQLGTAHAVRCAKPETIEGVVVIMNGDHPLIEDIKDFVRIFRDEKCDLAVVTAVLKNP
GLMU_AERHH      -----LNWVLQAQQLGTGHAVAQAIPFWQDEDDVLVLGDTPLIETLQRLLA--AKASDGMALLTVVLDNP
GMPPA_DICDI     QLNVAIRYINEEKVLGTAGGLYHFRDIIGPSEIFVLHSDICCAFPLNDLLQFHKQHGRSCTIMGTEIESA
GLMU_STRPF      ----QSAFVHQTEQLGTGHAVMMAETQLEEGHTLVIAGDTPLIESLKSLIDFHVNHKNVATILTATAQDP
GLMU_THEM4      -----VEIYLQNQQLGTAHAVMSAIEFVSPNDNLLILGDVPFIETLKRLEKEHVKSNSDVTILTSILENP
GLMU_STRP1      ----QSAFVHQTEQLGTGHAVMMAETQLEEGHTLVIAGDTPLIESLKSLIDFHVNHKNVATILTATAQDP
GLMU_PROMP      N----IHFIVQNPQKGTGHAIQVSQEVKKHEGNLMVLNGDVPLETLRDLINFHDSKTADVSLITSRKKNP
GLMU_NAUPA      NYPVNIVKQDLEKFPGTGGAL---KEVPIKGDKVLILNGDMPLIKAEE-LKKFEELD--ADIVMSVMKNP
GLGS_ARATH      NEGFVEVLAAQQSPEGTADAVWLFEEH-NVLEYLILAGDHLYRMDYEKFIQAHRETDADITVAALPMDEQ
GLGC_SALPC      LFSEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVKEA
GLGC_SALPB      LFSEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVKEA
GLGC_SALCH      LFSEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVKEA
GLGC_SALA4      LFSEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVKEA
GLMU_STRPG      ----QSAFVHQTEQLGTGHAVMMAETQLEEGHTLVIAGDTPLIESLKSLIDFHVNHKNVATILTATAQDP
GLMU_STRP3      ----QSAFVHQTEQLGTGHAVMMAETQLEEGHTLVIAGDTPLIESLKSLIDFHVNHKNVATILTATAPDP
GLMU_ALCBS      ----QVAWAEQAEQLGTGHAVAQAMPYVKEDMVLVLYGDVPLIETLKDFVATVDDSTLA--LMTLTLDDP
GLMU_ACTSZ      -----VNWVFQAEQLGTGHAMQQAAPFFDDENIVMLYGDAPLIETLERLVA--AKPENGIALLTVELENP
GLGC_GEMAT      NFMLPASQRVSETQDGTADAVYQNGDIIADEYMVILAGDHVYKMDYELMLQQHQNADVTVGVLEVPQREA
GLMU_STRPC      ----QSAFVHQTEQLGTGHAVMMAETQLEEGHTLVIAGDTPLIESLKSLIDFHVNHKNVATILTATAQDP
GLMU_STRPB      ----QSAFVHQTEQLGTGHAVMMAETQLEEGHTLVIAGDTPLIESLKSLIDFHVNHKNVATILTATAQDP
GLMU_RUTMC      -----INWVEQTEQLGTGHAVAQAMPHIEDNSISLILYGDVPLIKKSTLADLIHKAQQSGLSLLSVILDP
GLGC_SHISS      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_SHIFL      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_SHIF8      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_SHIDS      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_SHIBS      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_SHIB3      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_KLEP7      FFSEEMNEFVDLLPRGTADAVTQNLDIISAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECOUT      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECOSM      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECOSE      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECOLU      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECOLI      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECOLC      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECOL6      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECOL5      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECOHS      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECODH      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECOBW      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECO8A      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECO81      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECO7I      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECO5E      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECO57      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECO55      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECO45      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_ECO24      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GLGC_KLEP3      FFSEEMNEFVDLLPRGTADAVTQNLDIIKAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVEEA
GMPAA_DANRE     DFKISIRYLQEYAALGTGGGIYHFRDQIGGPDAFFVMNADVCSEFPLPEMLDFEHGDTYSFVILGTTKQS
GLMU_RHOFD      SAGFDINFVRQEPQLGTGHAVQQAVPLLRDDGMVVVLSGDLIQAATLRHLIAAAGTDKLA-LLTIDFADP
GLMU_NITSB      FDGIR--FVLQDHKNYPGTGGALRNIYFSNEKILVLNGDMPLIQ--AKTLKNFISID--ADIVLSVIRDP
GLGC_SALAR      LFSEEMNEFVDLLPRGTADAVTQNLDIIKAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVKEA
GLGC_RHOPT      NFFLPASQRVSEEMRGTADAVFQNIDIIESYDIVLLAGDHVYKMDYEKMLQQHQGADVTVGCLEVPRAEA
GLGC_RHIE6      NFFLPASQRVSETQEGTADAVYQNIDIIEDEYMVILAGDHVYKMDYEWMLQQHVDSDVTIGCLEVPRMEA
GLGC_ENTS8      FFSEEMNEFVDLLPRGTADAVTQNLDIIKAEYVVILAGDHIYKQDYSRMLIDHKGARCTVACLPVPVAEA
GLMU_CARHZ      ----RAVIAVQEEQLGTGHAALVAMPYVEDENVIIVPGDTPLLKTLQALIKKHLETGAYATVLTCFLSNP
GLMU_BURXL      -----VQFAVQEQQLGTGHAVQQALPLLDPSAPTLVLYGDVPLTRAGTLQALTDRAGQGGGVLTVTLADP
GLGL1_ARATH     GFGLAATQTPGESGKGTADAVWLFEDARSKEDVLILSGDHLYRMDYMDFIQDHRQSGADISISCIPIDDR
GLGC_RHITR      NFFLPASQRVSETQEGTADAVYQNIDIIGPEYMVILAGDHIYKMDYEWMLQQHVDSDVTIGCLEVPRMEA
GLGC_MANSM      SFGEFVDMLPARQQRGTADSVYIIRGHYKPKYVLILAGDHIYKMDYSQMLLDHVSSGAKCTVIEVPREEA
GLGC_GEOMG      FFSPETSSESEEWFKGTADAINHYLRFISDADYVIFGGDHIYRMDVSQMIHRRNRADITIAALEVPVEEA
GLGC_ENT38      FFSEEMNEFVDLLPRGTADAVTQNLDIIGAEYIVILAGDHIYKQDYSHMLIDHKGARCTVACLPVPVAEA
GLGC_ECO27      FFNEEMNEFVDLLPRGTADAVTQNLDIIRREYVVILAGDHIYKQDYSHMLIDHVEKGARCTVACMPVEEA
YBB2_SCHPO      HFPSRIKYLREYNCLGTGGGLYHFRDQITSNVFVMH-ADVCCSFPLQELLNVHHEKKALVTLMATKVEDA
GLMU_RUBXD      -----AEPVLQPEQRGTGDAVRVALEAIPEEEGVLLVGDGPLISDLGELLERHRSAGVGATVLVAELPDP
GLMU_PROAC      P---DVTTAVQAEQKGTGHAVACGLEGLDEGEVVVTYGDVPMLETLQRMVEVHRERRNLVTVLTAEVEDP
GLMU_GEOUR      D----VRFAVQEEQLGTGHAVACALPLLGFSGMVLILGDVPLISTLKAMVKQHRSRHAVITVLTADFAQP
GLMU_ERWT9      -----LNWVLQAEQLGTGHAMQQAAPFADDEDILMLYGDVPLIT--GETLRRLQKPDGGIGLLTVNLANP
GLMU_AGRRK      --GIEVEAYLQKERLGTGHAVLAAREAIGYDDIIVAYGDVPLLTDVPLRAARKGLADGNDIVVIGHTENP
GLGL3_SOLTU     NFGNGVTFAATQTPQGTAHAVWLFEDARSKEDVLILSGDHLYRMDYLHFVQSHRQSGADITISSLPIDDS
GLGC_RHOPA      NFFLPASQRVSEEMRGTADAVFQNIDIIESYDIVLLAGDHVYKMDYEKMLQQHQGADVTVGCLEVPRAEA
GLGC_HAES2      QIDDSTWY------RGTADAVYQNMAIIRDHYRPKYIGDHIYKQDYSQMLLDHVSSNAKCTVIEVPREQA
GLGC_HAES1      QIDDSTWY------RGTADAVYQNMAIIRDHYRPKYIGDHIYKQDYSQMLLDHVSSNAKCTVIEVPREQA
GLGC_FRAP2      LRGELNEFIVDEESRGTADAVYQNIDILGPEYVIVLAGDHIYKMDYSVMLRDHAQSGYKCTVGCVEIAEE
GLMU_SHEPW      -----LNWVLQAEQLGTGHAVAQANDNISDDDTVLILGDVPLIQASTLESLLAVRDENGLAILTVNLPNP
GLMU_SACD2      --GRDVNFVEQTEQLGTGHAVLQVLPHLNPEDTLILYGDVPLTKTDTLAELRAKVSDSSMGLLTVNLADP
GLMU_ACHLI      ----RAKYVYQEEQLGTGHAAMMAAPVLSKLDGNTFIGDVPLIKSIDRMFAVHEDNGNDFTIVTAHYEDP
GLGC_RHIEC      NFFLPASQRVSETQEGTADAVYQNIDIIEDEYMVILAGDHVYKMDYEYMLQQHVDSDVTIGCLEVPRMEA
GLGC_ANADF      RLTALLDQYVEIVPEGSADAIYQNLNIITDEEFTFIFGDHVYRMDVRQMLQFHQDADLTVAAIPVPVEEA
GLMU_STRP8      ----QSAFVHQTEQLGTGHAVMMAETQLEEGHTLVIAGDTPLIESLKSLIDFHVNHKNVATILTATAPDP
GLGC_ESCF3      FFNEEMNEFVDLLPRGTADAVTQNLDIIKAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVQEA
GLGC_AGRRK      NFFLPASQRVSETQEGTADAVYQNIDIIGPEYMVILAGDHIYKMDYEWMLQQHVDSGAEVTILEVPRMEA
GLGC2_VIBPA     SFNPELGEYITAVPEGTADAIYHNLWLLSRNDVVVLSGDHIYRMDYAAMLE--EHKEKGAKLTVAPVKDA
GLMU_OLICO      KLRPEAQMFVQSERKGTAHAVLAAREAIGADDLLVVFGDTLVTAETFARLQAALTGDVAIVVLGFRAKDP
GLMU_HAEDU      -----LNWVLQAEQLGTGHAMQQAATFFADENILMLYGDTPLIQTLTRLIAAKPANGIA--LLTVELADP
GLMU_BIFLO      SYDEQVTIVNQDDIPGTGRAVQCAMAQLTDGPVLIAASDMPLLETLHRLVEFHTASGNGATVLTTILDDP
GLMU_ARCB4      KYFSNINFVIQDHKNGTGGAVMITPKY---EKVLVLNGDMPLIQ-----ANELEKFEINATIVMSELESA
GLGC_FRATN      LRGELNEFIVDEEHRGTADAVYQNIDILGPEYVIVLAGDHIYKMDYSIMLRDHAQSGYKCTVGCVEIAKE
GLMU_SERP5      -----LNWVLQAEQLGTGHAMQAAPHFADDEDVLMLYGDVPLIDTLQRLMA--AKPQGGIGLLTVKLADP
GLMU_BURCH      -----VQFAVQAEQLGTGHAVRQALPLLDPAQPTLVLYGDVPLSTLQRLVDAARDGRYG--ILTVTLDDP
GLMU_BURCA      -----VQFAVQAEQLGTGHAVRQALPLLDPAQPTLVLYGDVPLSTLQRLVDAARDGRYG--ILTVTLDDP
GLGC_RHIRD      DFFLPASQRVSETQEGTADAVYQNIDIIAPEYMVILAGDHIYKMDYEYMLQQHVDSDVTIGCLEVPRMEA
GLGC_NITOC      GFMMPASQRIEDSYAGTADAVYQNLDIVNPEYVLILAGDHVYKMDYGDMLAYHREADMTVGCIHVPLKEA
GLGC_FRATO      LRGELNEFIVDEEHRGTADAVYQNIDILGPEYVIVLAGDHIYKMDYSIMLRDHAQSGYKCTVGCVEIAKE
GLGC_FRATH      LRGELNEFIVDEEHRGTADAVYQNIDILGPEYVIVLAGDHIYKMDYSIMLRDHAQSGYKCTVGCVEIAKE
GLGC_FRATF      LRGELNEFIVDEEHRGTADAVYQNIDILGPEYVIVLAGDHIYKMDYSIMLRDHAQSGYKCTVGCVEIAKE
GMPAB_XENLA     EFKVAIRYLQEYSALGTGGGIYHFRDQIGPQAFFVMNADEFPLVPMLDFHKQHGGSQ--SYVILGTTANR
GLMU_BURPP      -----VQFAVQEQQLGTGHAVQQALPLLDPSAPTLVLYGDVPLTRAGTLQALTERAGQGGGVLTVTLADP
GLMU_BIFLD      SYDEQVTIVNQDDIPGTGRAVQCAMAQLTDGPVLIAASDMPLLETLHRLVEFHTASGNGATVLTTILDDP
GLGC_NITEU      SFDGRFQEFIELLPQGTADAVFQNLDILRTHNYVLILGDHIYKMDYGRILAEHRQADLTIACLEVPVEDA
GLGC_FRATM      LRGELNEFIVDEEHRGTADAVYQNIDILGPEYVIVLAGDHIYKMDYSIMLRDHAQSGYKCTVGCVEIAKG
GLGC_AGRT5      DFFLPASQRVSETQEGTADAVYQNIDIIAPEYMVILAGDHIYKMDYEYMLQQHVDSDVTIGCLEVPRMEA
GLMU_VIBCM      N----VNWVLQAQQLGTGHAVQASPHFQDDEKILVLYGDPLISEDTIESLLEAQPTD-GIALLTVVLEDP
GLMU_VIBCH      N----VNWVLQAQQLGTGHAVQASPHFQDDEKILVLYGDPLISEDTIESLLEAQPTD-GIALLTVVLEDP
GLMU_PROM0      ----KIHIVIQEPQSGTGHAIQICREVKKHEGKLLVLNGDVPLSTLKRYLHDSKNAD--VSLITTKKRNP
GLMU_CORJK      QLGRSIDTAIQEQQNGTGHAVQCAMEQLGFEGTVVVTNADVPLLSPETLQELTATHDGASVTVLSVNQDP
GMPAB_DANRE     EFKIPIRYLQEFAALGTGGGIYHFRDQIGPAAFFLMNADEFPLLEMLQFHR--QHGENHCGVLLGTTANR
GLMU_BURP8      -----VQFALQEQQLGTGHAVQQALPLLDPSAPTLVLYGDVPLTKASKRLTDAAGHD-GYGVLTVTLDDP
GLGL1_SOLTU     SFGDGVEVLAATQTPGEAGKKWFQRKFINIENIVVLSGDHLYRMDYMELVQNHIDRNADITLSCAPAEDA
GLGC_NITMU      GFDGRFQEFIELLPQGTADAVYQNIDILHNPDYVLILGDHVYKMDYAKLLADHKSAEMTIACIDLPLEEA
GLMU_VIBC3      -----VNWVLQAQQLGTGHAVQASPHFQDDEKILVLYGDPLISEDTIESLLEAQPTD-GIALLTVVLEDP
GLMU_SHEB9      -----LNWVLQAEQLGTGHAVAQASPHIADNDTVLILGDVPLIQQSTLEALLAARPENGVAILTVNLANP
GLGC2_VIBVY     ELGEYITSVPPQMRKGIYHNLWLLER--SEAKYVMVLGDHIYRMDYAPMLEEHIANNAALTVACMDVKEA
GLGC2_VIBVU     ELGEYITSVPPQMRKGIYHNLWLLER--SEAKYVMVLGDHIYRMDYAPMLEEHIANNAALTVACMDVKEA
GLGC2_VIBCH     ELGEFITVVPPQMRKGLFHNMWLLAR--SDAKYVVVLGDHIYRMDYAAMLEEHKNATLTIACMQVPRHEA
GLMU_NITOC      -----ITWVRQELQLGTGHAALQTLPYIKPDTMLLILSGDVPLVKIETLKRLLAMVDQGGVGLLTELANP
GLGC2_PSEA6     HFRKELGESVEILPEGTADAVFQNIDIIRDEKYVMILGDHIYSMDYANILAHHVESGAKMTVSCMPVEAA
GLMU_SHEB2      -----LNWVLQAEQLGTGHAVAQASPHIADNDTVLILGDVPLIQQSTLEALLAARPENGVAILTVNLANP
GLMU_RHOPS      TF-------VQSERLGTAHAVLAAKQAIGADELLIAFGDTPLIETFARLREPLRNGS-ALVVLGFRAADP
GLMU_NITEC      N----LIWVKQTQQLGTGHAVKQALPCLGKNGITLVLGDPLVKSNTLKSLIDKACED-SLALLTVELNDP
GLMU_HAEIG      -----VNWVLQTEQLGTAHAVQQSAPFFKDENIVVLYGDAPLIETLEKLIE--AKPENGIALLTVNLDNP
GLGC_THICR      FMRYEVGEFVELLPKGTADALYQNLDIMHTPDYVLVLGDHIYSMDYSKML--YEHAESGADVTIGCIEVP
GLGC_MAGSA      GF-LRFNEFIELLPKGTADAVFQNLDIIRPEHVLVLAGDHVYKMHYGKMLAHHAGADVTVACIEVPLETA
GLGC_ANAD2      RLTSLLNQYVELVPEGSADAIYQNLNIITDEDFTFVFGADHVYRMDARQMLEFRKAELTVAAVPIPVQEA
GLMU_PECCP      LTDPALNWVLQAEQLGTGHAMQQAAPFADDEDILMLYGDVPLIQTLGRLRQTKPQG--GIGLLTVKLDDP
GLMU_NEIM0      -----VVWVEQTEQLGTGHAVKTALPHLAAEGRTLVLYGDVPLIDVETLKTLLEAAGDKVGLLTDVPTDP
GLGC_FRATW      LRGELNEFIVDEEHRGTADAVYQNIDILGPEYVIVLAGDHIYKMDYSIMLRDHAQSGYKCTVGCVEIAKE
GLGC_CORA7      NLSGPTPQYIASVPNGSADAILQSLNLIYDEDYVIVFGDHVYRMDPAQMVEEHTGLDCSVAGIRVPRSEA
GLGC_ANASK      RLTSLLNQYVELVPEGSADAIYQNLNIITDEDFTFVFGADHVYRMDARQMLEFRKAELTVAAVPIPVQEA
GMPPA_RAT       EFNLPVRYLQEFTPLGTGGGLYHFRDLAGAPEAFFVLNADVCSDFPLSAMLDAHRLQRHPFLLLGTTANR
GLMU_NEIMF      -----VVWVEQTEQLGTGHAVKTALPHLSAEGRTLVLYGDVPLIDVKTLKTLLEAAGNEVGLLTDVPADP
GLMU_HAES1      -----VNWVFQSEQLGTGHAMQQAAPFFDDENIVMLYGDVPLISKETLECLISQKPENGIALLTVNLDNP
GLGC_SHESA      HFKKELGESVEILPQGTADAVFQNIDIIRHEKYVMVLGDHVYRMDYAGLLAAHAESDMTVSCLEVPVAEA
GLGC_ROSDO      SFFLPASQQMNDENKGTADAVAQNKDIIGPKYIIILAGDHIYKQDYAEMIRHHVESDVTVGCIEVPRMEA
GLGC_HAEI8      SFGEFVDMLPARQQRGTADAVYQNMAIIKNHYRPKYIGDHIYKQDYSVMLMDHVNSGAKCTIIEVPRSEA
GLGC_DEIDV      RFGTFLSYFITLVPRGTADAVYQNMHLIDDADYVIFSGDHIYKMNVEHMLEKHSRADVTIAAYPMPRSQA
GMPAA_XENLA     EFKVAIRYLQEYSALGTGGGIYHFRDQIGPQAFFVMNADEFPLVSMLDFHKQHGGSQ--SYVILGTTANR
GLMU_THICR      ----GIQYAEQLEQLGTGHAVVQGNPHYNDDDTVLILGDPXXXXXXXXXXXXXXXXIHPLALLTITLDNP
GLMU_RHILW      IAGVGIEACLQKERLGTGHAVLAAREAIGYDDILVTYGDVPLQTDGPLKAARQGLADGSDIVVIGFHTDP
GLMU_HELMI      RLGDRACYAWQQEQLGTGHAVMMARXXXXXXXXXXLCGDTPLLATLSALWETHEQSGAMGTVLTAVIDDP
GLMU_GEOSL      D----ITLAVQEEQLGTGHAVACAAGDLSSGKVLILCGDVPLIETLRAMVTAHEATGAVLTVLTARQENP
GLMU_BUCAP      -----IDWVIQKEQKGTGDAILASKKFSDKDDIVVLYGDMISIESIKKLFTSKKQSDI--SLLTAYVKNP
GLGC_RHOP5      NFFLPASQRVSEELLGTADAVYQNLDIIESYDIVLLAGDHIYKMDYEKMLQQHQGAHVTVGCLEVPRKEA
GMPPA_MOUSE     EFNLPVRYLQEFAPLGTGGGLYHFRDLAGAPEAFFVLNADVCSDFPLSAMLEAHRRQRHPFLLLGTTANR
GLMU_SHEDO      -----VNWVLQAEQLGTGHAVAQANANINDDDTVLILGDPLIQQSTLNALLDARTHD-GMAILTVDLPNP
GLMU_SHEB8      -----LNWVLQAEQLGTGHAVAQASPHIADNDTVLILGDVPLIQQSTLEALLAALPENGVAILTVNLADP
GLMU_SHEB5      -----LNWVLQAEQLGTGHAVAQASPHIADSDTVLILGDVPLIQQSTLEALLAARPENGVAILTVNLGNP
GLMU_SALG2      ----KLNWVLQAEQLGTGHAMQKAAPFFSDEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
GLMU_PROM2      KFHV----VVQEPQSGTGHAIQVCREVKKHQGKLLVLNGDVPLSTLKRLLNLHDSKNADVSLITTKKTHP
GLMU_MANSM      -----VNWVFQAEQLGTGHAMQQAAPFFADENILMLYGDSPLIETLEKLIA--AKPENGIALLTVNLDNP
GLMU_HAES2      -----VNWVFQSEQLGTGHAMQQAVPFFDDENIVMLYGDVPLISKETLECLISQKPENGIALLTVNLDNP
GLMU_CORA7      ELDCAVSQAVQEEQNGTGHAVQCGLSALPEFDGTVIVGDVPLLETLRQLHEAHTGEANAVTVLSMTLEDP
GLMU_ACTP7      -----VNWVLQAEQLGTGHAMQQAAPFFADENILMLYGDAPLIETLERLIA--AKPENGIALLTVELENP
GLGC_METCA      GF-LRLGEFIDIMPAGTADAVYQNLDIIRDPEFIMILGDHVYKMDYGLMLAYHRKADLTIGCMEVPLADA
GLGC_ANADE      RLTSLLNQYVELVPEGSADAIYQNLNIITDEDFTFVFGDHVYRMDARQMLAFHQDADLTVAAVPIPVGEA
GMPPA_XENTR     EFKVAIRYLQEYSALGTGGGIYHFRDQIGPQAFFVMNADVCSAFPLVPML-DFQHGGSQSYVILGTTANR
GMPPA_PAPAN     EFNLPVRYLQEFAPLGTGGGLYHFRDLAGSPEAFFVLNADVCSDFPLSAMLEAHRRQRHPFLLLGTTANR
GLMU_YERPY      -----LNWVLQAEQLGTGHAMQAAPHFADDEDILMLYGDLISVDTLQRLLA--AKPEGGIGLLTVKLDNP
GLMU_YERPS      -----LNWVLQAEQLGTGHAMQAAPHFADDEDILMLYGDLISVDTLQRLLA--AKPEGGIGLLTVKLDNP
GLMU_YERPP      -----LNWVLQAEQLGTGHAMQAAPHFADDEDILMLYGDLISVDTLQRLLA--AKPEGGIGLLTVKLDNP
GLMU_YERPN      -----LNWVLQAEQLGTGHAMQAAPHFADDEDILMLYGDLISVDTLQRLLA--AKPEGGIGLLTVKLDNP
GLMU_YERPE      -----LNWVLQAEQLGTGHAMQAAPHFADDEDILMLYGDLISVDTLQRLLA--AKPEGGIGLLTVKLDNP
GLMU_YERPB      -----LNWVLQAEQLGTGHAMQAAPHFADDEDILMLYGDLISVDTLQRLLA--AKPEGGIGLLTVKLDNP
GLMU_YERPA      -----LNWVLQAEQLGTGHAMQAAPHFADDEDILMLYGDLISVDTLQRLLA--AKPEGGIGLLTVKLDNP
GLMU_YERP3      -----LNWVLQAEQLGTGHAMQAAPHFADDEDILMLYGDLISVDTLQRLLA--AKPEGGIGLLTVKLDNP
GLMU_VIBFM      ----RVQWVLQAEQLGTGHAVQAAPEFADDEKVLVLYGDVPLIS--AETVENLLDAQPTGGIALLTVDNP
GLMU_VIBF1      ----RVQWVLQAEQLGTGHAVQAAPEFADDEKVLVLYGDVPLIS--AETVENLLDAQPTGGIALLTVDNP
GLMU_SALTI      ----KLNWVLQAEQLGTGHAMQQAAPFFSDEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
GLMU_SALCH      ----KLNWVLQAEQLGTGHAMQQAAPFFSDEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
GLGC_SHESR      HFKKELGESVEILPQGTADAVFQNIDIIRHEKYVMVLGDHVYRMDYAGLLAAHAESDMTVSCLEVPVAEA
GLGC_SHESM      HFKKELGESVEILPQGTADAVFQNIDIIRHEKYVMVLGDHVYRMDYAGLLAAHAESDMTVSCLEVPVAEA
GLGC_NOVAD      NFMLPASQRVSEHQEGTADAVYQNLDIIASPKYMVILGDHIYKMDYELMLRQHVESDVTIGCLVVPRIEA
GLGC_CORDI      QFSGPTSQYIASVPMGSADAILQSLNLVYDEDYVLVFGDHVYRMDPEQMVADHIASGKAVTVIRVPRSEA
GLMU_SILST      EIAPEATVVLQEEQLGTGHAVLQARAALEGGDVVVLYGDTPFVETLERMIEARSRADLV--ILGFEAADP
GLMU_SHEFN      -----LNWVLQAEQLGTGHAVAQANPNINDDDTVLILGDVPLIQQSTLEALLAVRPTNGLAILTVNLPNP
GLMU_SALTY      ----KLNWVLQAEQLGTGHAMQQAAPFFSDEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
GLMU_SALPK      ----KLNWVLQAEQLGTGHAMQQAAPFFSDEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
GLMU_SALPB      ----KLNWVLQAEQLGTGHAMQQAAPFFSDEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
GLMU_SALPA      ----KLNWVLQAEQLGTGHAMQQAAPFFSDEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
GLMU_SALNS      ----KLNWVLQAEQLGTGHAMQQAAPFFSDEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
GLMU_SALHS      ----KLNWVLQAEQLGTGHAMQQAAPFFSDEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
GLMU_SALEP      ----KLNWVLQAEQLGTGHAMQQAAPFFSDEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
GLMU_SALDC      ----KLNWVLQAEQLGTGHAMQQAAPFFSDEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
GLMU_SALA4      ----KLNWVLQAEQLGTGHAMQQAAPFFSDEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
GLMU_RHIL3      IAGVDIESFLQKERLGTGHAVLAAREAIGYDDILVTYGDVPLQTDGPLKAARQGLADGSDVVVIGFHTDP
GLMU_HAEIN      -----VNWVLQTEQLGTAHAVQQAAPFFKDENIVVLYGDAPLIETLEKLIE--AKPENGIALLTVNLDNP
GLMU_ALTMD      N----LNWCLQAEQLGTGHAVQQAAPHINDEDVLILVGDALIREDTLSALKAVKESCDLALLTVN-LDDP
GLGC_SHEON      HFKKELGESVEILPQGTADAVFQNIDIIRHEKYVMVLGDHVYRMDYAGLLAAHAESDMTVSCLEVPVAEA
GLGC_PASMU      SFGEFIDMLPARQQRGTADAVYQNMAIIRDHYCPKYIGDHIYKQDYSQMLLDHIHSGAKCTVGCIEVEKA
GMPPA_HUMAN     EFNLPVRYLQEFAPLGTGGGLYHFRDLAGSPEAFFVLNADVCSDFPLSAMLEAHRRQRHPFLLLGTTANR
GLMU_RHIEC      -----IEAYLQQQRLGTGHAVLAAREAIGYDDILVTYGD-VPLQTNGPLKAARQGLAEGSDVVVFHTDRP
GLMU_RHIE6      IDGVGIESYLQKDRLGTGHAVLAARDAIGYDDILVTYGDVPLQTDAPLKAARQGLADGSDIVVIGFHSDP
GLMU_HAEPS      -----VNWVLQAEQLGTGHAMQQAAPFFADENILMLYGDAPLITTLEKLIA--AKPENGIALLTVVLDNP
GLMU_HAEIE      -----VNWVLQTEQLGTAHAVQQAAPFFKDENIVVLYGDAPLIETLEKLID--AKPENGIALLTVNLDNP
GLMU_ACTP2      -----VNWVLQAEQLGTGHAMQQAAPFFADENILMLYGDAPLIETLERLIAAKPANGIA--LLTVELENP
GLGC_RHOBA      YFCRELGEFIDVVPQGTADAVYIERE--APEYVVILAGDHLYKMNYESMVNHRKGADVTVGALRVSREEA
EI2BE_CANAL     NSPFSVTTIMSIESRSVGDTMRLDNRGLIAGDFLLVSGDVVTNMDFSKALKKAQDKDHIATMVLN-----
GLMU_SILPO      DEGATV--VLQEEQLGTAHAVDQARAALEEGDVVVLYGDTPFLQPLERMLAARKTHDLV--ILGFEAADP
GLMU_SALSV      ----KLNWVLQAEQLGTGHAMQQAAPFFSDEDILMLYGDPLISVETLQRLRDAKPQG-GIGLLTVKLDDP
GLMU_NITHX      HVRPDVMTFVQHERLG