[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tmar0:AAD36098.1

[Show Plain Result]


## Summary of Sequence Search
    1::422
   59::491     3e-19  29%  526 aa  SPNS1_XENTR RecName: Full=Protein spinster homolog 1;
   10::260     2e-17  24%  422 aa  EXUT_BACSU RecName: Full=Hexuronate transporter;
   61::248     2e-17  32%  526 aa  SPNS1_XENLA RecName: Full=Protein spinster homolog 1;
   91::250     4e-17  26%  563 aa  YIM0_YEAST RecName: Full=Uncharacterized transporter YIL120W;
  117::299     6e-17  31%  605 aa  SPIN_DROME RecName: Full=Protein spinster;AltName: Full=Protein
   99::268     3e-16  31%  520 aa  YOU1_CAEEL RecName: Full=Putative transporter ZK637.1;
   49::247     3e-16  28%  498 aa  SPNS3_DANRE RecName: Full=Protein spinster homolog 3;AltName:
   37::222     3e-16  35%  457 aa  PCAK_ACIAD RecName: Full=4-hydroxybenzoate transporter;
    9::182     6e-16  30%  395 aa  MDTL_SALTY RecName: Full=Multidrug resistance protein mdtL;
    9::182     6e-16  30%  395 aa  MDTL_SALPB RecName: Full=Multidrug resistance protein mdtL;
    9::182     6e-16  30%  395 aa  MDTL_SALNS RecName: Full=Multidrug resistance protein mdtL;
    9::182     6e-16  30%  395 aa  MDTL_SALHS RecName: Full=Multidrug resistance protein mdtL;
    9::182     6e-16  30%  395 aa  MDTL_SALA4 RecName: Full=Multidrug resistance protein mdtL;
   31::194     8e-16  27%  413 aa  MUCK_ACIAD RecName: Full=Cis,cis-muconate transport protein;
    9::182     8e-16  30%  395 aa  MDTL_SALEP RecName: Full=Multidrug resistance protein mdtL;
    9::182     8e-16  30%  395 aa  MDTL_SALDC RecName: Full=Multidrug resistance protein mdtL;
    9::182     8e-16  30%  395 aa  MDTL_SALAR RecName: Full=Multidrug resistance protein mdtL;
   10::182     1e-15  29%  422 aa  YITG_BACSU RecName: Full=Uncharacterized MFS-type transporter yitG;
    9::182     2e-15  29%  395 aa  MDTL_SALTI RecName: Full=Multidrug resistance protein mdtL;
    9::182     2e-15  30%  395 aa  MDTL_SALSV RecName: Full=Multidrug resistance protein mdtL;
    9::182     2e-15  29%  395 aa  MDTL_SALPK RecName: Full=Multidrug resistance protein mdtL;
    9::182     2e-15  29%  395 aa  MDTL_SALPA RecName: Full=Multidrug resistance protein mdtL;
    9::182     3e-15  28%  395 aa  MDTL_SALPC RecName: Full=Multidrug resistance protein mdtL;
    9::182     3e-15  28%  395 aa  MDTL_SALCH RecName: Full=Multidrug resistance protein mdtL;
   32::192     5e-15  28%  404 aa  YYBF_BACSU RecName: Full=Uncharacterized MFS-type transporter yybF;
   49::236     2e-14  30%  506 aa  SPNS1_DANRE RecName: Full=Protein spinster homolog 1;AltName:
   14::184     2e-14  26%  512 aa  BMR3_BACSU RecName: Full=Multidrug resistance protein 3;AltName:
  100::278     2e-14  32%  548 aa  SVOP_PONAB RecName: Full=Synaptic vesicle 2-related protein;       
  100::278     2e-14  32%  548 aa  SVOP_HUMAN RecName: Full=Synaptic vesicle 2-related protein;       
  100::278     2e-14  32%  548 aa  SVOP_BOVIN RecName: Full=Synaptic vesicle 2-related protein;       
    9::182     3e-14  25%  392 aa  MDTL_KLEP3 RecName: Full=Multidrug resistance protein mdtL;
    9::182     6e-14  25%  392 aa  MDTL_KLEP7 RecName: Full=Multidrug resistance protein mdtL;
  102::506     1e-13  25%  512 aa  ANTR3_ARATH RecName: Full=Probable anion transporter 3,
   49::199     2e-13  31%  510 aa  NANT_YERPY RecName: Full=Putative sialic acid transporter;AltName:
    9::180     2e-13  23%  396 aa  MDTL_VIBPA RecName: Full=Multidrug resistance protein mdtL;
   49::199     2e-13  31%  510 aa  NANT_YERPS RecName: Full=Putative sialic acid transporter;AltName:
   49::199     2e-13  31%  510 aa  NANT_YERPP RecName: Full=Putative sialic acid transporter;AltName:
   49::199     2e-13  31%  510 aa  NANT_YERPG RecName: Full=Putative sialic acid transporter;AltName:
   49::199     2e-13  31%  510 aa  NANT_YERPB RecName: Full=Putative sialic acid transporter;AltName:
   49::199     2e-13  31%  510 aa  NANT_YERP3 RecName: Full=Putative sialic acid transporter;AltName:
   21::291     2e-13  25%  455 aa  GUDP_BACSU RecName: Full=Probable glucarate transporter;AltName:
   54::238     3e-13  30%  514 aa  SPNS3_MOUSE RecName: Full=Protein spinster homolog 3;
   72::233     4e-13  32%  512 aa  SPNS3_HUMAN RecName: Full=Protein spinster homolog 3;
    9::185     4e-13  26%  391 aa  MDTL_ECOSE RecName: Full=Multidrug resistance protein mdtL;
    9::185     4e-13  26%  391 aa  MDTL_ECOLI RecName: Full=Multidrug resistance protein mdtL;
    9::185     4e-13  26%  391 aa  MDTL_ECODH RecName: Full=Multidrug resistance protein mdtL;
    9::185     4e-13  26%  391 aa  MDTL_ECOBW RecName: Full=Multidrug resistance protein mdtL;
    9::185     4e-13  26%  391 aa  MDTL_ECO55 RecName: Full=Multidrug resistance protein mdtL;
  153::345     5e-13  27%  727 aa  SV2C_HUMAN RecName: Full=Synaptic vesicle glycoprotein 2C;
    9::185     5e-13  26%  391 aa  MDTL_ESCF3 RecName: Full=Multidrug resistance protein mdtL;
    9::182     6e-13  25%  391 aa  MDTL_SHISS RecName: Full=Multidrug resistance protein mdtL;
    9::182     6e-13  25%  391 aa  MDTL_SHIFL RecName: Full=Multidrug resistance protein mdtL;
    9::185     6e-13  25%  391 aa  MDTL_SHIDS RecName: Full=Multidrug resistance protein mdtL;
    9::182     6e-13  25%  391 aa  MDTL_SHIBS RecName: Full=Multidrug resistance protein mdtL;
    9::182     6e-13  25%  391 aa  MDTL_SHIB3 RecName: Full=Multidrug resistance protein mdtL;
    9::185     6e-13  25%  391 aa  MDTL_ECOUT RecName: Full=Multidrug resistance protein mdtL;
    9::182     6e-13  25%  391 aa  MDTL_ECOLC RecName: Full=Multidrug resistance protein mdtL;
    9::185     6e-13  25%  391 aa  MDTL_ECOK1 RecName: Full=Multidrug resistance protein mdtL;
    9::182     6e-13  25%  391 aa  MDTL_ECOHS RecName: Full=Multidrug resistance protein mdtL;
    9::185     6e-13  25%  391 aa  MDTL_ECO5E RecName: Full=Multidrug resistance protein mdtL;
    9::185     6e-13  25%  391 aa  MDTL_ECO57 RecName: Full=Multidrug resistance protein mdtL;
    9::185     6e-13  25%  391 aa  MDTL_ECO45 RecName: Full=Multidrug resistance protein mdtL;
   82::225     8e-13  32%  493 aa  VACHT_DANRE RecName: Full=Probable vesicular acetylcholine
   16::194     8e-13  25%  458 aa  TCRB_BACSU RecName: Full=Tetracycline resistance protein;
   74::252     8e-13  29%  513 aa  SPNS2_XENTR RecName: Full=Protein spinster homolog 2;
   28::215     8e-13  24%  473 aa  PHDK_NOCSK RecName: Full=Probable 1-hydroxy-2-naphthoate
    9::185     8e-13  25%  391 aa  MDTL_ECOL5 RecName: Full=Multidrug resistance protein mdtL;
    9::185     8e-13  25%  391 aa  MDTL_ECO27 RecName: Full=Multidrug resistance protein mdtL;
  135::315     8e-13  28%  541 aa  ANTR2_ARATH RecName: Full=Probable anion transporter 2,
  106::259     1e-12  28%  519 aa  PHT43_ORYSJ RecName: Full=Probable anion transporter 3,
    9::185     1e-12  25%  391 aa  MDTL_ECO7I RecName: Full=Multidrug resistance protein mdtL;
   83::255     1e-12  23%  542 aa  YIM1_YEAST RecName: Full=Uncharacterized transporter YIL121W;
  100::343     1e-12  26%  548 aa  SVOP_XENLA RecName: Full=Synaptic vesicle 2-related protein;       
   13::175     1e-12  25%  396 aa  SOTB_SHISS RecName: Full=Probable sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_SHIFL RecName: Full=Probable sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_SHIF8 RecName: Full=Probable sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_SHIBS RecName: Full=Probable sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_SHIB3 RecName: Full=Probable sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_ECOSM RecName: Full=Probable sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_ECOSE RecName: Full=Probable sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_ECOLU RecName: Full=Probable sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_ECOLI RecName: Full=Sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_ECOLC RecName: Full=Probable sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_ECOHS RecName: Full=Probable sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_ECODH RecName: Full=Probable sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_ECOBW RecName: Full=Probable sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_ECO8A RecName: Full=Probable sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_ECO7I RecName: Full=Probable sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_ECO5E RecName: Full=Probable sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_ECO57 RecName: Full=Probable sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_ECO55 RecName: Full=Probable sugar efflux transporter;
   13::175     1e-12  25%  396 aa  SOTB_ECO24 RecName: Full=Probable sugar efflux transporter;
    9::185     1e-12  25%  391 aa  MDTL_ECOSM RecName: Full=Multidrug resistance protein mdtL;
    9::185     1e-12  25%  391 aa  MDTL_ECOLU RecName: Full=Multidrug resistance protein mdtL;
  183::332     2e-12  29%  622 aa  TPO3_YEAST RecName: Full=Polyamine transporter 3;
    9::185     2e-12  24%  391 aa  MDTL_ECOL6 RecName: Full=Multidrug resistance protein mdtL;
    9::182     2e-12  25%  391 aa  MDTL_ECO8A RecName: Full=Multidrug resistance protein mdtL;
    9::185     2e-12  24%  391 aa  MDTL_ECO81 RecName: Full=Multidrug resistance protein mdtL;
    9::182     2e-12  25%  391 aa  MDTL_ECO24 RecName: Full=Multidrug resistance protein mdtL;
   19::291     2e-12  24%  444 aa  GARP_ECOLI RecName: Full=Probable galactarate transporter;AltName:
   19::291     2e-12  24%  444 aa  GARP_ECO57 RecName: Full=Probable galactarate transporter;AltName:
  153::345     2e-12  26%  727 aa  SV2C_RAT RecName: Full=Synaptic vesicle glycoprotein 2C;       
  110::263     2e-12  26%  683 aa  SV2B_HUMAN RecName: Full=Synaptic vesicle glycoprotein 2B;
    9::182     2e-12  25%  390 aa  MDTL_CITK8 RecName: Full=Multidrug resistance protein mdtL;
   53::191     3e-12  28%  582 aa  VBA5_YEAST RecName: Full=Vacuolar basic amino acid transporter 5;
  153::345     3e-12  26%  727 aa  SV2C_MOUSE RecName: Full=Synaptic vesicle glycoprotein 2C;       
  121::290     3e-12  27%  529 aa  PHT41_ORYSJ RecName: Full=Probable anion transporter 1,
   49::199     3e-12  30%  510 aa  NANT_YERPE RecName: Full=Putative sialic acid transporter;AltName:
   49::199     3e-12  30%  510 aa  NANT_YERPA RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-12  26%  496 aa  NANT_SALTY RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-12  26%  496 aa  NANT_SALTI RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-12  26%  496 aa  NANT_SALSV RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-12  26%  496 aa  NANT_SALPK RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-12  26%  496 aa  NANT_SALPC RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-12  26%  496 aa  NANT_SALPB RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-12  26%  496 aa  NANT_SALPA RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-12  26%  496 aa  NANT_SALNS RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-12  26%  496 aa  NANT_SALHS RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-12  26%  496 aa  NANT_SALG2 RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-12  26%  496 aa  NANT_SALEP RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-12  26%  496 aa  NANT_SALDC RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-12  26%  496 aa  NANT_SALCH RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-12  26%  496 aa  NANT_SALAR RecName: Full=Putative sialic acid transporter;AltName:
  106::269     3e-12  27%  512 aa  ANTR1_ARATH RecName: Full=Sodium-dependent phosphate transport
  121::264     4e-12  31%  530 aa  VACHT_RAT RecName: Full=Vesicular acetylcholine transporter;       
  174::323     4e-12  29%  614 aa  TPO2_YEAST RecName: Full=Polyamine transporter 2;
   61::248     4e-12  30%  528 aa  SPNS1_HUMAN RecName: Full=Protein spinster homolog 1;AltName:
   31::196     4e-12  29%  410 aa  MDTM_ECO57 RecName: Full=Multidrug resistance protein mdtM;
    9::182     4e-12  25%  391 aa  MDTL_SHIF8 RecName: Full=Multidrug resistance protein mdtL;
  122::281     4e-12  23%  586 aa  AQR1_YEAST RecName: Full=Probable transporter AQR1;
   61::251     5e-12  29%  528 aa  SPNS1_RAT RecName: Full=Protein spinster homolog 1;
   61::251     5e-12  29%  528 aa  SPNS1_MOUSE RecName: Full=Protein spinster homolog 1;
   13::175     5e-12  24%  396 aa  SOTB_ECOUT RecName: Full=Probable sugar efflux transporter;
   13::175     5e-12  24%  396 aa  SOTB_ECOL6 RecName: Full=Probable sugar efflux transporter;
   13::175     5e-12  24%  396 aa  SOTB_ECOL5 RecName: Full=Probable sugar efflux transporter;
   13::175     5e-12  24%  396 aa  SOTB_ECOK1 RecName: Full=Probable sugar efflux transporter;
   13::175     5e-12  24%  396 aa  SOTB_ECO81 RecName: Full=Probable sugar efflux transporter;
   13::175     5e-12  24%  396 aa  SOTB_ECO45 RecName: Full=Probable sugar efflux transporter;
   13::175     5e-12  24%  396 aa  SOTB_ECO27 RecName: Full=Probable sugar efflux transporter;
   27::196     7e-12  27%  452 aa  YWOD_BACSU RecName: Full=Uncharacterized MFS-type transporter ywoD;
   13::175     7e-12  25%  396 aa  SOTB_SALTY RecName: Full=Probable sugar efflux transporter;
   13::175     7e-12  25%  396 aa  SOTB_SALNS RecName: Full=Probable sugar efflux transporter;
  121::264     9e-12  30%  532 aa  VACHT_HUMAN RecName: Full=Vesicular acetylcholine transporter;     
   36::186     9e-12  26%  496 aa  NANT_CITK8 RecName: Full=Putative sialic acid transporter;AltName:
   31::196     9e-12  28%  410 aa  MDTM_ECOLI RecName: Full=Multidrug resistance protein mdtM;
  121::264     1e-11  30%  530 aa  VACHT_MOUSE RecName: Full=Vesicular acetylcholine transporter;     
   16::204     1e-11  25%  458 aa  TCR_STRPN RecName: Full=Tetracycline resistance protein;
   16::204     1e-11  25%  458 aa  TCR_BACSU RecName: Full=Tetracycline resistance protein;
   16::204     1e-11  25%  458 aa  TCR_BACST RecName: Full=Tetracycline resistance protein;
   16::204     1e-11  25%  458 aa  TCR_BACCE RecName: Full=Tetracycline resistance protein;
  113::249     1e-11  33%  549 aa  SPNS2_MOUSE RecName: Full=Protein spinster homolog 2;
  113::249     1e-11  33%  549 aa  SPNS2_HUMAN RecName: Full=Protein spinster homolog 2;
   36::186     1e-11  26%  496 aa  NANT_ESCF3 RecName: Full=Putative sialic acid transporter;AltName:
   24::189     1e-11  22%  466 aa  BENK_ACIAD RecName: Full=Benzoate transport protein;
   26::165     2e-11  24%  400 aa  YCEI_BACSU RecName: Full=Putative metabolite transport protein
   16::412     2e-11  23%  458 aa  TCR_STRAG RecName: Full=Tetracycline resistance protein;
   66::188     2e-11  31%  399 aa  PMRA_STRR6 RecName: Full=Multi-drug resistance efflux pump pmrA;
   66::188     2e-11  31%  399 aa  PMRA_STRPN RecName: Full=Multi-drug resistance efflux pump pmrA;
   45::439     2e-11  28%  451 aa  YYAJ_BACSU RecName: Full=Putative metabolite transport protein
   13::188     2e-11  26%  397 aa  SOTB_CITK8 RecName: Full=Probable sugar efflux transporter;
   16::202     2e-11  24%  430 aa  DGOT_ECOLI RecName: Full=D-galactonate transporter;
   16::202     2e-11  24%  430 aa  DGOT_ECOL6 RecName: Full=D-galactonate transporter;
   26::198     3e-11  26%  493 aa  PLT6_ARATH RecName: Full=Probable polyol transporter 6;
    9::186     3e-11  22%  398 aa  BCR_HAEIN RecName: Full=Bicyclomycin resistance protein homolog;
   83::221     3e-11  25%  613 aa  AZR1_YEAST RecName: Full=Azole resistance protein 1;
   48::230     3e-11  25%  539 aa  PLT5_ARATH RecName: Full=Polyol transporter 5;AltName:
   36::186     3e-11  26%  496 aa  NANT_SHIFL RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_SHIF8 RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_SHIB3 RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_ECOSM RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_ECOSE RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_ECOLI RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_ECOLC RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_ECOL5 RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_ECOHS RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_ECODH RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_ECOBW RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_ECO8A RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_ECO7I RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_ECO5E RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_ECO57 RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_ECO55 RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_ECO45 RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_ECO27 RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT_ECO24 RecName: Full=Putative sialic acid transporter;AltName:
   36::186     3e-11  26%  496 aa  NANT1_ECOL6 RecName: Full=Putative sialic acid transporter
   88::240     5e-11  25%  544 aa  YRT3_CAEEL RecName: Full=Potential vesicular glutamate transporter
   16::168     5e-11  24%  458 aa  TCR_STAHY RecName: Full=Tetracycline resistance protein;
  100::238     5e-11  27%  548 aa  SVOP_MOUSE RecName: Full=Synaptic vesicle 2-related protein;       
   13::175     5e-11  27%  396 aa  SOTB_SALTI RecName: Full=Probable sugar efflux transporter;
   13::175     5e-11  27%  396 aa  SOTB_SALSV RecName: Full=Probable sugar efflux transporter;
   13::175     5e-11  27%  396 aa  SOTB_SALPK RecName: Full=Probable sugar efflux transporter;
   13::175     5e-11  27%  396 aa  SOTB_SALPC RecName: Full=Probable sugar efflux transporter;
   13::175     5e-11  27%  396 aa  SOTB_SALPB RecName: Full=Probable sugar efflux transporter;
   13::175     5e-11  27%  396 aa  SOTB_SALPA RecName: Full=Probable sugar efflux transporter;
   13::175     5e-11  27%  396 aa  SOTB_SALHS RecName: Full=Probable sugar efflux transporter;
   13::175     5e-11  27%  396 aa  SOTB_SALG2 RecName: Full=Probable sugar efflux transporter;
   13::175     5e-11  27%  396 aa  SOTB_SALEP RecName: Full=Probable sugar efflux transporter;
   13::175     5e-11  27%  396 aa  SOTB_SALDC RecName: Full=Probable sugar efflux transporter;
   13::175     5e-11  27%  396 aa  SOTB_SALCH RecName: Full=Probable sugar efflux transporter;
   13::175     5e-11  27%  396 aa  SOTB_SALAR RecName: Full=Probable sugar efflux transporter;
   13::175     5e-11  27%  396 aa  SOTB_SALA4 RecName: Full=Probable sugar efflux transporter;
  196::355     8e-11  28%  591 aa  PHT44_ORYSJ RecName: Full=Probable anion transporter 4,
   48::192     1e-10  27%  410 aa  YQJV_BACSU RecName: Full=Uncharacterized MFS-type transporter yqjV;
   54::176     1e-10  29%  512 aa  EMRB_ECOLI RecName: Full=Multidrug resistance protein B;
   54::176     1e-10  29%  512 aa  EMRB_ECO57 RecName: Full=Multidrug resistance protein B;
  100::238     1e-10  27%  548 aa  SVOP_RAT RecName: Full=Synaptic vesicle 2-related protein;       
   61::248     1e-10  29%  528 aa  SPNS1_BOVIN RecName: Full=Protein spinster homolog 1;
   64::224     2e-10  23%  491 aa  YJA1_SCHPO RecName: Full=Uncharacterized transporter C1529.01;
   48::368     2e-10  26%  396 aa  YTBD_BACSU RecName: Full=Uncharacterized MFS-type transporter ytbD;
  105::261     3e-10  26%  577 aa  YHX6_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   45::211     3e-10  28%  543 aa  SGE1_YEAST RecName: Full=Protein SGE1;AltName: Full=Crystal violet
   31::195     3e-10  25%  508 aa  PLT3_ARATH RecName: Full=Probable polyol transporter 3;
   19::162     4e-10  30%  457 aa  YWTG_BACSU RecName: Full=Putative metabolite transport protein
   20::190     4e-10  20%  472 aa  YCNB_BACSU RecName: Full=Uncharacterized MFS-type transporter ycnB;
   66::249     4e-10  26%  504 aa  SPNS2_DANRE RecName: Full=Protein spinster homolog 2;AltName:
  129::289     4e-10  32%  548 aa  S22A7_HUMAN RecName: Full=Solute carrier family 22 member
   92::251     4e-10  30%  546 aa  HXT10_YEAST RecName: Full=Hexose transporter HXT10;
   70::233     5e-10  30%  492 aa  SVOPL_HUMAN RecName: Full=Putative transporter SVOPL;AltName:
   64::244     5e-10  29%  514 aa  QACA_STAAU RecName: Full=Antiseptic resistance protein;
   64::244     5e-10  29%  514 aa  QACA_STAAM RecName: Full=Antiseptic resistance protein;
   55::215     7e-10  23%  417 aa  YNFM_ECOLI RecName: Full=Inner membrane transport protein ynfM;
   72::204     9e-10  27%  443 aa  YAAU_ECOLI RecName: Full=Putative metabolite transport protein
  129::289     9e-10  32%  548 aa  S22A7_PONAB RecName: Full=Solute carrier family 22 member
   22::206     9e-10  23%  450 aa  GUDP_ECOLI RecName: Full=Probable glucarate transporter;AltName:
   32::175     1e-09  24%  412 aa  YWFA_BACSU RecName: Full=Uncharacterized MFS-type transporter ywfA;
  134::275     1e-09  28%  538 aa  YN43_SCHPO RecName: Full=Uncharacterized transporter C36.03c;
   43::211     1e-09  24%  453 aa  YJJL_ECOLI RecName: Full=Inner membrane transport protein yjjL;
   53::204     1e-09  21%  410 aa  Y588_BUCAI RecName: Full=Uncharacterized transporter BU588;
   48::261     1e-09  26%  396 aa  NEPI_SHISS RecName: Full=Purine ribonucleoside efflux pump nepI;
   13::167     1e-09  26%  394 aa  YGAY_ECOLI RecName: Full=Putative uncharacterized transporter ygaY;
   13::167     1e-09  26%  394 aa  YGAY_ECO57 RecName: Full=Uncharacterized transporter ygaY;
   45::150     1e-09  33%  403 aa  MHPT_ECOLI RecName: Full=Putative 3-hydroxyphenylpropionic acid
   27::185     1e-09  25%  389 aa  BMR1_BACSU RecName: Full=Multidrug resistance protein 1;AltName:
   72::252     1e-09  26%  542 aa  ATR1_YEAST RecName: Full=Aminotriazole resistance protein;
   13::173     2e-09  24%  394 aa  SOTB_ERWT9 RecName: Full=Probable sugar efflux transporter;
   11::191     2e-09  21%  397 aa  YFHI_BACSU RecName: Full=Uncharacterized MFS-type transporter yfhI;
   10::183     2e-09  23%  386 aa  Y1560_METJA RecName: Full=Uncharacterized MFS-type transporter
   23::194     2e-09  27%  457 aa  XYLT_LACBR RecName: Full=D-xylose-proton symporter;AltName:
  137::268     2e-09  28%  535 aa  PHT42_ORYSJ RecName: Full=Probable anion transporter 2,
   45::168     2e-09  29%  394 aa  ARAJ_ECOLI RecName: Full=Protein araJ;
  133::287     3e-09  28%  554 aa  S22A1_HUMAN RecName: Full=Solute carrier family 22 member
  109::250     3e-09  25%  495 aa  S17A5_HUMAN RecName: Full=Sialin;AltName: Full=Solute carrier
   48::195     3e-09  26%  396 aa  NEPI_ECO27 RecName: Full=Purine ribonucleoside efflux pump nepI;
   39::167     3e-09  29%  401 aa  NASA_BACSU RecName: Full=Nitrate transporter;
   70::233     4e-09  29%  494 aa  SVOPL_MOUSE RecName: Full=Putative transporter SVOPL;AltName:
  131::345     4e-09  25%  592 aa  HXT5_YEAST RecName: Full=Probable glucose transporter HXT5;
   33::180     4e-09  24%  510 aa  EMRB_HAEIN RecName: Full=Multidrug resistance protein B homolog;
   88::215     6e-09  23%  413 aa  Y567_BUCAP RecName: Full=Uncharacterized transporter BUsg_567;
   90::250     6e-09  30%  515 aa  VACHT_TORCA RecName: Full=Vesicular acetylcholine transporter;     
   32::196     6e-09  27%  729 aa  MSSP3_ARATH RecName: Full=Monosaccharide-sensing protein 3;AltName:
    9::165     6e-09  22%  396 aa  MDTL_SHESA RecName: Full=Multidrug resistance protein mdtL;
   39::171     7e-09  27%  611 aa  YCR3_YEAST RecName: Full=Uncharacterized membrane protein YCR023C;
   86::246     7e-09  30%  511 aa  VACHT_TOROC RecName: Full=Vesicular acetylcholine transporter;     
   86::246     7e-09  30%  511 aa  VACHT_TORMA RecName: Full=Vesicular acetylcholine transporter;     
   30::178     9e-09  21%  405 aa  YJHB_ECOLI RecName: Full=Putative metabolite transport protein
  134::288     9e-09  29%  553 aa  S22A2_MOUSE RecName: Full=Solute carrier family 22 member
   48::189     9e-09  27%  394 aa  NEPI_SHIDS RecName: Full=Purine ribonucleoside efflux pump nepI;
   99::305     9e-09  24%  541 aa  HXT2_YEAST RecName: Full=High-affinity glucose transporter HXT2;
   75::216     9e-09  29%  588 aa  GTR12_XENLA RecName: Full=Solute carrier family 2, facilitated
   61::253     1e-08  24%  403 aa  YDHC_ECOLI RecName: Full=Inner membrane transport protein ydhC;
    7::377     1e-08  22%  390 aa  YBCL_BACSU RecName: Full=Uncharacterized MFS-type transporter ybcL;
   48::195     1e-08  26%  396 aa  NEPI_ECOL5 RecName: Full=Purine ribonucleoside efflux pump nepI;
  111::230     2e-08  29%  516 aa  YN2F_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   20::171     2e-08  20%  532 aa  YHCA_BACSU RecName: Full=Uncharacterized MFS-type transporter yhcA;
   10::158     2e-08  18%  390 aa  YCEJ_BACSU RecName: Full=Uncharacterized MFS-type transporter yceJ;
   99::252     2e-08  25%  532 aa  UNC17_CAEEL RecName: Full=Vesicular acetylcholine transporter
   99::263     2e-08  30%  524 aa  PLST1_ARATH RecName: Full=Probable plastidic glucose transporter 1;
   48::189     2e-08  26%  396 aa  NEPI_SHIFL RecName: Full=Purine ribonucleoside efflux pump nepI;
   48::189     2e-08  26%  396 aa  NEPI_SHIF8 RecName: Full=Purine ribonucleoside efflux pump nepI;
   48::189     2e-08  26%  396 aa  NEPI_ECOLI RecName: Full=Purine ribonucleoside efflux pump nepI;
   48::189     2e-08  26%  396 aa  NEPI_ECOBW RecName: Full=Purine ribonucleoside efflux pump nepI;
   32::194     2e-08  25%  734 aa  MSSP1_ARATH RecName: Full=Monosaccharide-sensing protein 1;AltName:
   70::193     2e-08  27%  428 aa  MMLH_RALEJ RecName: Full=Probable 4-methylmuconolactone
   13::175     2e-08  26%  397 aa  SOTB_ESCF3 RecName: Full=Probable sugar efflux transporter;
  134::288     2e-08  29%  555 aa  S22A2_RAT RecName: Full=Solute carrier family 22 member 2;AltName:
  109::250     2e-08  24%  495 aa  S17A5_SHEEP RecName: Full=Sialin;AltName: Full=Solute carrier
   67::245     2e-08  26%  526 aa  PLT4_ARATH RecName: Full=Probable polyol transporter 4;
    9::166     2e-08  22%  396 aa  MDTL_SHEON RecName: Full=Multidrug resistance protein mdtL;
   24::163     2e-08  27%  461 aa  CSBC_BACSU RecName: Full=Probable metabolite transport protein
   26::187     3e-08  27%  387 aa  NART_STAES RecName: Full=Probable nitrate transporter narT;
   26::187     3e-08  27%  387 aa  NART_STAEQ RecName: Full=Probable nitrate transporter narT;
   36::186     3e-08  25%  496 aa  NANT_ENTS8 RecName: Full=Putative sialic acid transporter;AltName:
  189::410     4e-08  26%  577 aa  YN42_SCHPO RecName: Full=Uncharacterized transporter C36.02c;
   38::220     4e-08  22%  511 aa  PLT1_ARATH RecName: Full=Putative polyol transporter 1;
   48::195     4e-08  25%  396 aa  NEPI_ECOUT RecName: Full=Purine ribonucleoside efflux pump nepI;
   48::195     4e-08  25%  396 aa  NEPI_ECOL6 RecName: Full=Purine ribonucleoside efflux pump nepI;
   48::195     4e-08  25%  396 aa  NEPI_ECOK1 RecName: Full=Purine ribonucleoside efflux pump nepI;
  126::342     4e-08  22%  533 aa  ANTR4_ARATH RecName: Full=Probable anion transporter 4,
  133::275     5e-08  25%  567 aa  OCTL_DROME RecName: Full=Organic cation transporter-like protein;
   36::186     5e-08  23%  496 aa  NANT_SALA4 RecName: Full=Putative sialic acid transporter;AltName:
  157::294     6e-08  24%  580 aa  YN41_SCHPO RecName: Full=Uncharacterized transporter C36.01c;
   13::174     6e-08  22%  395 aa  SOTB_ERWCH RecName: Full=Sugar efflux transporter B;
  133::271     6e-08  29%  554 aa  S22A1_RABIT RecName: Full=Solute carrier family 22 member
   53::392     6e-08  22%  405 aa  PMRA_LACLA RecName: Full=Multi-drug resistance efflux pump pmrA
   45::182     6e-08  24%  388 aa  NORA_STAAW RecName: Full=Quinolone resistance protein norA;
   45::182     6e-08  24%  388 aa  NORA_STAAU RecName: Full=Quinolone resistance protein norA;
   45::182     6e-08  24%  388 aa  NORA_STAAS RecName: Full=Quinolone resistance protein norA;
   45::182     6e-08  24%  388 aa  NORA_STAAN RecName: Full=Quinolone resistance protein norA;
   45::182     6e-08  24%  388 aa  NORA_STAAM RecName: Full=Quinolone resistance protein norA;
   45::182     6e-08  24%  388 aa  NORA_STAAC RecName: Full=Quinolone resistance protein norA;
   48::189     6e-08  26%  396 aa  NEPI_SHIBS RecName: Full=Purine ribonucleoside efflux pump nepI;
   71::220     6e-08  27%  488 aa  ERDL4_ARATH RecName: Full=Sugar transporter ERD6-like 4;
   36::209     8e-08  23%  396 aa  YFMO_BACSU RecName: Full=Multidrug efflux protein yfmO;
   62::214     8e-08  25%  454 aa  YAJR_ECOLI RecName: Full=Inner membrane transport protein yajR;
   45::182     8e-08  23%  388 aa  NORA_STAAR RecName: Full=Quinolone resistance protein norA;
   48::195     8e-08  25%  396 aa  NEPI_ECO57 RecName: Full=Purine ribonucleoside efflux pump nepI;
   13::150     8e-08  26%  456 aa  GUDP_PSEPU RecName: Full=Probable glucarate transporter;AltName:
   14::175     1e-07  23%  402 aa  SOTB_PSE14 RecName: Full=Probable sugar efflux transporter;
   50::187     1e-07  26%  436 aa  S17A9_HUMAN RecName: Full=Solute carrier family 17 member 9;
   65::228     1e-07  28%  477 aa  BAIG_EUBSP RecName: Full=Bile acid transporter;
  132::293     2e-07  24%  572 aa  YB30_YEAST RecName: Full=Uncharacterized transporter YBR180W;
   24::184     2e-07  22%  466 aa  MDTD_PECCP RecName: Full=Putative multidrug resistance protein
   70::219     2e-07  27%  487 aa  ERDL6_ARATH RecName: Full=Sugar transporter ERD6-like 6;
   64::194     2e-07  26%  492 aa  YCLF_BACSU RecName: Full=Uncharacterized transporter yclF;
   13::170     2e-07  23%  398 aa  SOTB_ENT38 RecName: Full=Probable sugar efflux transporter;
   80::310     2e-07  25%  557 aa  ITR2_SCHPO RecName: Full=Myo-inositol transporter 2;
   87::252     3e-07  25%  506 aa  SVOPL_DANRE RecName: Full=Putative transporter SVOPL;AltName:
  170::365     3e-07  24%  742 aa  SV2A_RAT RecName: Full=Synaptic vesicle glycoprotein 2A;       
  170::365     3e-07  24%  742 aa  SV2A_PONAB RecName: Full=Synaptic vesicle glycoprotein 2A;
  170::365     3e-07  24%  742 aa  SV2A_MOUSE RecName: Full=Synaptic vesicle glycoprotein 2A;       
  170::365     3e-07  24%  742 aa  SV2A_MACFA RecName: Full=Synaptic vesicle glycoprotein 2A;
  170::365     3e-07  24%  742 aa  SV2A_HUMAN RecName: Full=Synaptic vesicle glycoprotein 2A;
  170::365     3e-07  24%  742 aa  SV2A_BOVIN RecName: Full=Synaptic vesicle glycoprotein 2A;AltName:
  134::288     3e-07  30%  556 aa  S22A1_RAT RecName: Full=Solute carrier family 22 member 1;AltName:
   19::182     3e-07  21%  386 aa  PBUE_BACAM RecName: Full=Purine efflux pump pbuE;
   28::210     3e-07  22%  553 aa  GTR10_XENLA RecName: Full=Solute carrier family 2, facilitated
   34::178     3e-07  26%  472 aa  ARAE_ECOLI RecName: Full=Arabinose-proton symporter;AltName:
   34::178     3e-07  26%  472 aa  ARAE_ECO57 RecName: Full=Arabinose-proton symporter;AltName:
   37::202     4e-07  25%  435 aa  YYBO_BACSU RecName: Full=Uncharacterized transporter yybO;
   26::160     4e-07  26%  389 aa  NART_STAAW RecName: Full=Probable nitrate transporter narT;
   26::160     4e-07  26%  389 aa  NART_STAAT RecName: Full=Probable nitrate transporter narT;
   26::160     4e-07  26%  389 aa  NART_STAAS RecName: Full=Probable nitrate transporter narT;
   26::160     4e-07  26%  389 aa  NART_STAAN RecName: Full=Probable nitrate transporter narT;
   26::160     4e-07  26%  389 aa  NART_STAAM RecName: Full=Probable nitrate transporter narT;
   26::160     4e-07  26%  389 aa  NART_STAAE RecName: Full=Probable nitrate transporter narT;
   26::160     4e-07  26%  389 aa  NART_STAAC RecName: Full=Probable nitrate transporter narT;
   26::160     4e-07  26%  389 aa  NART_STAAB RecName: Full=Probable nitrate transporter narT;
   26::160     4e-07  26%  389 aa  NART_STAA9 RecName: Full=Probable nitrate transporter narT;
   26::160     4e-07  26%  389 aa  NART_STAA8 RecName: Full=Probable nitrate transporter narT;
   26::160     4e-07  26%  389 aa  NART_STAA3 RecName: Full=Probable nitrate transporter narT;
   26::160     4e-07  26%  389 aa  NART_STAA2 RecName: Full=Probable nitrate transporter narT;
   26::160     4e-07  26%  389 aa  NART_STAA1 RecName: Full=Probable nitrate transporter narT;
  153::309     5e-07  25%  576 aa  YQO5_SCHPO RecName: Full=Uncharacterized transporter C569.05c;
   14::160     5e-07  24%  518 aa  YFIU_BACSU RecName: Full=Uncharacterized MFS-type transporter yfiU;
  111::263     5e-07  20%  683 aa  SV2B_RAT RecName: Full=Synaptic vesicle glycoprotein 2B;       
   90::256     5e-07  24%  503 aa  SPX3_XENLA RecName: Full=Sugar phosphate exchanger 3;AltName:
   24::187     5e-07  20%  396 aa  SOTB_HAEIN RecName: Full=Probable sugar efflux transporter;
   24::187     5e-07  20%  396 aa  SOTB_HAEIG RecName: Full=Probable sugar efflux transporter;
   21::189     5e-07  23%  393 aa  SETB_ECOLI RecName: Full=Sugar efflux transporter B;
   30::182     5e-07  27%  448 aa  PCAK_PSEPU RecName: Full=4-hydroxybenzoate transporter;
   26::160     5e-07  26%  389 aa  NART_STAAR RecName: Full=Probable nitrate transporter narT;
   83::256     5e-07  27%  526 aa  BSU1_SCHPO RecName: Full=Vitamin B6 transporter bsu1;AltName:
   21::237     7e-07  22%  393 aa  SETB_SALTY RecName: Full=Sugar efflux transporter B;
   58::213     7e-07  26%  482 aa  EDL14_ARATH RecName: Full=Sugar transporter ERD6-like 14;
  239::348     9e-07  29%  391 aa  YFKF_BACSU RecName: Full=Uncharacterized MFS-type transporter yfkF;
  117::267     9e-07  20%  547 aa  YCT4_SCHPO RecName: Full=Uncharacterized transporter C794.04c;
  134::288     9e-07  30%  556 aa  S22A1_MOUSE RecName: Full=Solute carrier family 22 member
   50::205     9e-07  26%  463 aa  ERDL7_ARATH RecName: Full=Sugar transporter ERD6-like 7;
   75::225     1e-06  26%  493 aa  YLD2_CAEEL RecName: Full=Uncharacterized transporter C38C10.2;
  110::277     1e-06  29%  543 aa  YHM9_SCHPO RecName: Full=Probable metabolite transport protein
   74::179     1e-06  26%  452 aa  YDJE_ECOLI RecName: Full=Inner membrane metabolite transport
  137::262     1e-06  30%  558 aa  XYLL3_ARATH RecName: Full=D-xylose-proton symporter-like 3;
    7::129     1e-06  24%  474 aa  VBA2_YEAST RecName: Full=Vacuolar basic amino acid transporter 2;
   86::232     1e-06  29%  494 aa  SPX2_DANRE RecName: Full=Sugar phosphate exchanger 2;AltName:
  141::282     1e-06  28%  551 aa  S22A4_HUMAN RecName: Full=Solute carrier family 22 member
   75::213     1e-06  25%  479 aa  NPT3_BOVIN RecName: Full=Sodium-dependent phosphate transport
   84::222     2e-06  22%  482 aa  YFIG_BACSU RecName: Full=Putative metabolite transport protein
   43::192     2e-06  26%  427 aa  YDFJ_ECOLI RecName: Full=Putative inner membrane metabolite
  103::231     2e-06  27%  555 aa  YD387_YEAST RecName: Full=Probable metabolite transport protein
  141::282     2e-06  28%  551 aa  S22A4_PAPAN RecName: Full=Solute carrier family 22 member
   46::195     2e-06  22%  439 aa  PHT47_ORYSJ RecName: Full=Probable anion transporter 7;AltName:
   26::171     2e-06  23%  451 aa  GTR1_PIG RecName: Full=Solute carrier family 2, facilitated glucose
   48::237     2e-06  28%  458 aa  EDL10_ARATH RecName: Full=Sugar transporter ERD6-like 10;
   94::219     2e-06  26%  578 aa  VACHT_DROME RecName: Full=Vesicular acetylcholine transporter;     
   51::188     2e-06  20%  538 aa  TCMA_STRGA RecName: Full=Tetracenomycin C resistance and export
  130::267     2e-06  26%  545 aa  S22A6_MOUSE RecName: Full=Solute carrier family 22 member
  134::288     2e-06  26%  555 aa  S22A2_HUMAN RecName: Full=Solute carrier family 22 member
   80::207     2e-06  28%  508 aa  PT113_ORYSJ RecName: Full=Putative inorganic phosphate transporter
  155::462     3e-06  22%  534 aa  YMPB_CAEEL RecName: Full=Putative transporter B0361.11;
   24::187     3e-06  19%  402 aa  SOTB_HAEI8 RecName: Full=Probable sugar efflux transporter;
  136::273     3e-06  26%  551 aa  S22A6_RAT RecName: Full=Solute carrier family 22 member 6;AltName:
   38::220     3e-06  21%  511 aa  PLT2_ARATH RecName: Full=Putative polyol transporter 2;
   36::175     3e-06  29%  532 aa  PHT19_ARATH RecName: Full=Probable inorganic phosphate transporter
   25::189     3e-06  21%  465 aa  MDTD_YERPY RecName: Full=Putative multidrug resistance protein
   25::189     3e-06  21%  465 aa  MDTD_YERPS RecName: Full=Putative multidrug resistance protein
   25::189     3e-06  21%  465 aa  MDTD_YERPP RecName: Full=Putative multidrug resistance protein
   25::189     3e-06  21%  465 aa  MDTD_YERPN RecName: Full=Putative multidrug resistance protein
   25::189     3e-06  21%  465 aa  MDTD_YERPG RecName: Full=Putative multidrug resistance protein
   25::189     3e-06  21%  465 aa  MDTD_YERPE RecName: Full=Putative multidrug resistance protein
   25::189     3e-06  21%  465 aa  MDTD_YERPB RecName: Full=Putative multidrug resistance protein
   25::189     3e-06  21%  465 aa  MDTD_YERPA RecName: Full=Putative multidrug resistance protein
   25::189     3e-06  21%  465 aa  MDTD_YERP3 RecName: Full=Putative multidrug resistance protein
   54::209     3e-06  24%  470 aa  ERDL5_ARATH RecName: Full=Sugar transporter ERD6-like 5;
   39::177     3e-06  24%  392 aa  YUXJ_BACSU RecName: Full=Uncharacterized MFS-type transporter
   74::185     3e-06  26%  389 aa  YDHP_ECOLI RecName: Full=Inner membrane transport protein ydhP;
   74::185     3e-06  26%  389 aa  YDHP_ECO57 RecName: Full=Inner membrane transport protein ydhP;
   26::189     3e-06  23%  407 aa  Y1104_HAEIN RecName: Full=Putative metabolite transport protein
  121::293     3e-06  23%  590 aa  VGLU3_DANRE RecName: Full=Vesicular glutamate transporter 3;       
  111::263     3e-06  20%  683 aa  SV2B_MOUSE RecName: Full=Synaptic vesicle glycoprotein 2B;       
   18::172     3e-06  23%  407 aa  SOTB_PSESM RecName: Full=Probable sugar efflux transporter;
   19::180     3e-06  20%  400 aa  SOTB_PSEE4 RecName: Full=Probable sugar efflux transporter;
  128::287     3e-06  29%  540 aa  S22A7_MOUSE RecName: Full=Solute carrier family 22 member
  109::250     3e-06  20%  495 aa  S17A5_MOUSE RecName: Full=Sialin;AltName: Full=Solute carrier
   57::182     3e-06  27%  528 aa  PHT12_ORYSJ RecName: Full=Inorganic phosphate transporter 1-2;     
   34::178     3e-06  26%  472 aa  ARAE_KLEOX RecName: Full=Arabinose-proton symporter;AltName:
   14::168     4e-06  23%  402 aa  SOTB_PSEU2 RecName: Full=Probable sugar efflux transporter;
   41::173     4e-06  23%  505 aa  MOT6_HUMAN RecName: Full=Monocarboxylate transporter 6;       
   35::186     4e-06  21%  410 aa  MDFA_ECOLI RecName: Full=Multidrug translocase mdfA;AltName:
   35::186     4e-06  21%  410 aa  MDFA_ECOL6 RecName: Full=Multidrug translocase mdfA;AltName:
   35::186     4e-06  21%  410 aa  MDFA_ECO57 RecName: Full=Multidrug translocase mdfA;AltName:
   72::212     4e-06  22%  492 aa  GTR1_HUMAN RecName: Full=Solute carrier family 2, facilitated
   67::212     4e-06  22%  492 aa  GTR1_BOVIN RecName: Full=Solute carrier family 2, facilitated
   58::194     4e-06  26%  512 aa  EMRY_ECOLI RecName: Full=Multidrug resistance protein Y;
  112::256     4e-06  23%  576 aa  EAT4_CAEEL RecName: Full=Probable vesicular glutamate transporter
  108::280     6e-06  22%  560 aa  VGLU1_RAT RecName: Full=Vesicular glutamate transporter 1;       
  108::280     6e-06  22%  560 aa  VGLU1_MOUSE RecName: Full=Vesicular glutamate transporter 1;       
  108::280     6e-06  22%  560 aa  VGLU1_BOVIN RecName: Full=Vesicular glutamate transporter 1;       
  116::266     6e-06  23%  584 aa  VGL2A_DANRE RecName: Full=Vesicular glutamate transporter
   14::168     6e-06  22%  459 aa  TCR_STAES RecName: Full=Tetracycline resistance protein;
   14::168     6e-06  22%  459 aa  TCR_STAAU RecName: Full=Tetracycline resistance protein;AltName:
   41::198     6e-06  24%  447 aa  S17A9_MOUSE RecName: Full=Solute carrier family 17 member 9;
   32::196     6e-06  26%  729 aa  MSSP2_ARATH RecName: Full=Monosaccharide-sensing protein 2;AltName:
  130::247     6e-06  25%  584 aa  ITR1_YEAST RecName: Full=Myo-inositol transporter 1;
   86::235     6e-06  24%  496 aa  ERD6_ARATH RecName: Full=Sugar transporter ERD6;AltName:
   25::174     7e-06  29%  404 aa  Y4XM_RHISN RecName: Full=Uncharacterized MFS-type transporter y4xM;
   62::185     7e-06  23%  442 aa  UHPC_SALTY RecName: Full=Regulatory protein uhpC;
  125::292     7e-06  26%  557 aa  S22A5_HUMAN RecName: Full=Solute carrier family 22 member
   70::181     7e-06  28%  548 aa  PHT15_ORYSJ RecName: Full=Probable inorganic phosphate transporter
   70::181     7e-06  28%  538 aa  PHT14_ORYSJ RecName: Full=Probable inorganic phosphate transporter
   70::181     7e-06  28%  538 aa  PHT14_ORYSI RecName: Full=Probable inorganic phosphate transporter
   90::198     7e-06  26%  455 aa  MFS10_HUMAN RecName: Full=Major facilitator superfamily
   82::254     7e-06  22%  564 aa  HXT17_YEAST RecName: Full=Hexose transporter HXT17;
   97::242     7e-06  27%  510 aa  GTR2_BOVIN RecName: Full=Solute carrier family 2, facilitated
   72::212     7e-06  22%  492 aa  GTR1_RAT RecName: Full=Solute carrier family 2, facilitated glucose
   72::212     7e-06  22%  492 aa  GTR1_MOUSE RecName: Full=Solute carrier family 2, facilitated
   57::212     7e-06  23%  470 aa  ERDL8_ARATH RecName: Full=Sugar transporter ERD6-like 8;
   66::221     7e-06  23%  482 aa  EDL16_ARATH RecName: Full=Sugar transporter ERD6-like 16;
   12::184     7e-06  22%  407 aa  BCRH_RICPR RecName: Full=Uncharacterized transporter RP603;
   62::219     1e-05  21%  439 aa  UHPC_ECOLI RecName: Full=Regulatory protein uhpC;
  134::288     1e-05  25%  555 aa  S22A2_PONAB RecName: Full=Solute carrier family 22 member
   47::231     1e-05  28%  533 aa  QUTD_EMENI RecName: Full=Quinate permease;AltName: Full=Quinate
   60::249     1e-05  27%  500 aa  PROP_SALTY RecName: Full=Proline/betaine transporter;AltName:
   82::231     1e-05  25%  564 aa  HXT13_YEAST RecName: Full=Hexose transporter HXT13;
   41::186     1e-05  22%  490 aa  HIAT1_MOUSE RecName: Full=Hippocampus abundant transcript 1
   57::246     1e-05  28%  467 aa  EDL11_ARATH RecName: Full=Sugar transporter ERD6-like 11;
  116::237     1e-05  31%  525 aa  YQEH_SCHPO RecName: Full=Uncharacterized transporter C576.17c;
   75::201     1e-05  21%  403 aa  Y532_BUCBP RecName: Full=Uncharacterized transporter bbp_532;
  129::449     1e-05  22%  515 aa  VMAT2_RAT RecName: Full=Synaptic vesicular amine
    7::129     1e-05  31%  401 aa  TCR2_ECOLX RecName: Full=Tetracycline resistance protein, class B; 
  128::282     1e-05  28%  563 aa  S22A1_BOVIN RecName: Full=Solute carrier family 22 member
   60::249     1e-05  28%  500 aa  PROP_ECOLI RecName: Full=Proline/betaine transporter;AltName:
   60::249     1e-05  28%  500 aa  PROP_ECO57 RecName: Full=Proline/betaine transporter;AltName:
   34::178     1e-05  24%  413 aa  MDTM_SALTY RecName: Full=Multidrug resistance protein mdtM;
   34::178     1e-05  24%  413 aa  MDTM_SALTI RecName: Full=Multidrug resistance protein mdtM;
  158::294     1e-05  24%  609 aa  ITR2_YEAST RecName: Full=Myo-inositol transporter 2;
  100::231     1e-05  24%  512 aa  GTR7_HUMAN RecName: Full=Solute carrier family 2, facilitated
   75::230     1e-05  27%  488 aa  EDL13_ARATH RecName: Full=Putative sugar transporter ERD6-like 13;
   10::163     1e-05  19%  396 aa  BCR_ECOLI RecName: Full=Bicyclomycin resistance protein;AltName:
    9::184     1e-05  21%  409 aa  BCRH_RICTY RecName: Full=Uncharacterized transporter RT0591;
  261::403     2e-05  26%  416 aa  YBFB_BACSU RecName: Full=Uncharacterized MFS-type transporter ybfB;
  136::273     2e-05  27%  551 aa  S22A6_RABIT RecName: Full=Solute carrier family 22 member
   84::188     2e-05  26%  555 aa  PT111_ORYSJ RecName: Full=Inorganic phosphate transporter 1-11;    
   90::203     2e-05  29%  541 aa  PHT18_ORYSJ RecName: Full=Probable inorganic phosphate transporter
   92::212     2e-05  24%  439 aa  NPT3_HUMAN RecName: Full=Sodium-dependent phosphate transport
   26::160     2e-05  24%  385 aa  NART_STAHJ RecName: Full=Probable nitrate transporter narT;
   48::199     2e-05  19%  502 aa  NANT2_ECOL6 RecName: Full=Putative sialic acid transporter
   91::209     2e-05  26%  456 aa  MFS10_MOUSE RecName: Full=Major facilitator superfamily
  110::314     2e-05  23%  570 aa  HXT1_YEAST RecName: Full=Low-affinity glucose transporter HXT1;
   41::186     2e-05  22%  490 aa  HIAT1_HUMAN RecName: Full=Hippocampus abundant transcript 1
  100::231     2e-05  24%  512 aa  GTR7_RAT RecName: Full=Solute carrier family 2, facilitated glucose
   74::244     2e-05  25%  524 aa  GTR2_HUMAN RecName: Full=Solute carrier family 2, facilitated
   43::196     2e-05  23%  464 aa  GALP_ECOLI RecName: Full=Galactose-proton symporter;AltName:
   43::196     2e-05  23%  464 aa  GALP_ECOL6 RecName: Full=Galactose-proton symporter;AltName:
   37::149     2e-05  24%  382 aa  YCAD_SALEP RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::182     2e-05  23%  382 aa  YCAD_ESCF3 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   45::177     2e-05  21%  390 aa  Y466_BUCAI RecName: Full=Uncharacterized transporter BU466;
  108::280     2e-05  22%  560 aa  VGLU1_HUMAN RecName: Full=Vesicular glutamate transporter 1;       
  144::221     2e-05  27%  491 aa  SPX2_BOVIN RecName: Full=Sugar phosphate exchanger 2;AltName:
   15::170     2e-05  21%  404 aa  SOTB_PASMU RecName: Full=Probable sugar efflux transporter;
  158::297     2e-05  32%  551 aa  S22A3_MOUSE RecName: Full=Solute carrier family 22 member
  108::399     2e-05  23%  567 aa  RAG1_KLULA RecName: Full=Low-affinity glucose transporter;AltName:
   61::248     2e-05  29%  541 aa  PT112_ORYSJ RecName: Full=Probable inorganic phosphate transporter
  129::275     2e-05  23%  548 aa  ORCT_DROME RecName: Full=Organic cation transporter protein;
   46::164     2e-05  24%  469 aa  MDTD_YERE8 RecName: Full=Putative multidrug resistance protein
  116::246     3e-05  23%  582 aa  VGLU2_RAT RecName: Full=Vesicular glutamate transporter 2;       
  116::246     3e-05  23%  582 aa  VGLU2_MOUSE RecName: Full=Vesicular glutamate transporter 2;       
  116::246     3e-05  23%  582 aa  VGLU2_HUMAN RecName: Full=Vesicular glutamate transporter 2;       
  116::246     3e-05  23%  582 aa  VGLU2_BOVIN RecName: Full=Vesicular glutamate transporter 2;       
   87::224     3e-05  26%  506 aa  STP5_ARATH RecName: Full=Sugar transport protein 5;AltName:
  147::299     3e-05  29%  553 aa  S22AC_MOUSE RecName: Full=Solute carrier family 22 member
  158::297     3e-05  32%  551 aa  S22A3_RAT RecName: Full=Solute carrier family 22 member 3;AltName:
  133::224     3e-05  31%  554 aa  S22A2_RABIT RecName: Full=Solute carrier family 22 member
  138::270     3e-05  28%  552 aa  S226B_XENLA RecName: Full=Solute carrier family 22 member
   57::194     3e-05  25%  398 aa  LPLT_PHOLL RecName: Full=Lysophospholipid transporter lplT;
   26::119     3e-05  24%  475 aa  HSRA_ECOLI RecName: Full=Probable transport protein hsrA;AltName:
   53::208     3e-05  26%  478 aa  EDL15_ARATH RecName: Full=Sugar transporter ERD6-like 15;
   37::149     4e-05  24%  382 aa  YCAD_SALG2 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   37::149     4e-05  24%  382 aa  YCAD_SALDC RecName: Full=Uncharacterized MFS-type transporter ycaD;
   77::217     4e-05  24%  503 aa  XYLL1_ARATH RecName: Full=D-xylose-proton symporter-like 1;
   68::195     4e-05  23%  455 aa  UHPT_CHLPN RecName: Full=Probable hexose phosphate transport
   87::234     4e-05  23%  501 aa  SPX2_MOUSE RecName: Full=Sugar phosphate exchanger 2;AltName:
  154::234     4e-05  31%  501 aa  SPX2_HUMAN RecName: Full=Sugar phosphate exchanger 2;AltName:
  129::288     4e-05  27%  547 aa  S22A7_PIG RecName: Full=Solute carrier family 22 member 7;AltName:
   36::185     4e-05  21%  475 aa  MMR_STRCO RecName: Full=Methylenomycin A resistance
   45::186     4e-05  20%  479 aa  LMRB_BACSU RecName: Full=Lincomycin resistance protein lmrB;
  104::320     4e-05  23%  567 aa  HXT9_YEAST RecName: Full=Hexose transporter HXT9;
  104::320     4e-05  23%  567 aa  HXT11_YEAST RecName: Full=Hexose transporter HXT11;AltName:
   72::212     4e-05  21%  492 aa  GTR1_RABIT RecName: Full=Solute carrier family 2, facilitated
    4::71      5e-05  22%  124 aa  YMFD_BACSU RecName: Full=Uncharacterized MFS-type transporter
   45::164     5e-05  28%  448 aa  YJ94_YEAST RecName: Full=Uncharacterized membrane protein YJR124C;
   45::226     5e-05  24%  519 aa  YHD3_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   26::193     5e-05  22%  395 aa  YDER_BACSU RecName: Full=Uncharacterized MFS-type transporter ydeR;
   37::149     5e-05  23%  382 aa  YCAD_SALPB RecName: Full=Uncharacterized MFS-type transporter ycaD;
  130::244     5e-05  23%  589 aa  YAN6_SCHPO RecName: Full=Uncharacterized transporter C3H1.06c;
    4::98      5e-05  26%  400 aa  TCR8_PASMU RecName: Full=Tetracycline resistance protein, class
  129::288     5e-05  26%  547 aa  S22A7_BOVIN RecName: Full=Solute carrier family 22 member
  133::224     5e-05  30%  554 aa  S22A2_PIG RecName: Full=Solute carrier family 22 member 2;AltName:
   64::187     5e-05  26%  534 aa  PHT16_ORYSJ RecName: Full=Inorganic phosphate transporter 1-6;     
   68::198     5e-05  27%  527 aa  PHT11_ORYSJ RecName: Full=Inorganic phosphate transporter 1-1;     
   51::173     5e-05  23%  477 aa  MDTD_SERP5 RecName: Full=Putative multidrug resistance protein
  105::311     5e-05  22%  567 aa  HXT3_YEAST RecName: Full=Low-affinity glucose transporter HXT3;
   37::149     6e-05  23%  382 aa  YCAD_SALTY RecName: Full=Uncharacterized MFS-type transporter ycaD;
   37::149     6e-05  23%  382 aa  YCAD_SALTI RecName: Full=Uncharacterized MFS-type transporter ycaD;
   37::149     6e-05  23%  382 aa  YCAD_SALSV RecName: Full=Uncharacterized MFS-type transporter ycaD;
   37::149     6e-05  23%  382 aa  YCAD_SALPK RecName: Full=Uncharacterized MFS-type transporter ycaD;
   37::149     6e-05  23%  382 aa  YCAD_SALPC RecName: Full=Uncharacterized MFS-type transporter ycaD;
   37::149     6e-05  23%  382 aa  YCAD_SALPA RecName: Full=Uncharacterized MFS-type transporter ycaD;
   37::149     6e-05  23%  382 aa  YCAD_SALNS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   37::149     6e-05  23%  382 aa  YCAD_SALHS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   37::149     6e-05  23%  382 aa  YCAD_SALCH RecName: Full=Uncharacterized MFS-type transporter ycaD;
   37::149     6e-05  23%  382 aa  YCAD_SALA4 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     6e-05  22%  382 aa  Y2171_CITK8 RecName: Full=Uncharacterized MFS-type transporter
  117::289     6e-05  23%  587 aa  VGL2B_DANRE RecName: Full=Vesicular glutamate transporter
  114::216     6e-05  26%  449 aa  TUB3_AGRVI RecName: Full=Putative tartrate transporter;
   90::233     6e-05  27%  487 aa  S22FL_XENLA RecName: Full=Solute carrier family 22 member 15-like;
   99::236     6e-05  27%  463 aa  PCFT_XENLA RecName: Full=Proton-coupled folate transporter;AltName:
   25::118     6e-05  24%  471 aa  MDTD_SHIF8 RecName: Full=Putative multidrug resistance protein
   99::245     6e-05  25%  533 aa  GLPT_HUMAN RecName: Full=Glycerol-3-phosphate transporter;       
   42::149     8e-05  23%  382 aa  YCAD_SALAR RecName: Full=Uncharacterized MFS-type transporter ycaD;
   96::209     8e-05  26%  572 aa  YBN1_SCHPO RecName: Full=Putative inorganic phosphate transporter
   76::204     8e-05  22%  488 aa  YB91_YEAST RecName: Full=Probable metabolite transport protein
   97::199     8e-05  28%  433 aa  TUB4_AGRVI RecName: Full=Putative tartrate transporter;
   85::206     8e-05  23%  499 aa  SPX2_XENLA RecName: Full=Sugar phosphate exchanger 2;AltName:
  136::257     8e-05  27%  550 aa  S22A6_MACFA RecName: Full=Solute carrier family 22 member
   71::182     8e-05  26%  526 aa  PHT13_ORYSJ RecName: Full=Probable inorganic phosphate transporter
   19::157     8e-05  19%  388 aa  PBUE_BACSU RecName: Full=Purine efflux pump pbuE;
   25::118     8e-05  23%  471 aa  MDTD_ESCF3 RecName: Full=Putative multidrug resistance protein
   85::234     8e-05  23%  567 aa  HXT16_YEAST RecName: Full=Hexose transporter HXT16;
   85::234     8e-05  23%  567 aa  HXT15_YEAST RecName: Full=Hexose transporter HXT15;
   98::231     8e-05  25%  513 aa  GTR7_MOUSE RecName: Full=Solute carrier family 2, facilitated
   98::243     8e-05  25%  523 aa  GTR2_MOUSE RecName: Full=Solute carrier family 2, facilitated
  100::219     8e-05  27%  533 aa  GTR2_CHICK RecName: Full=Solute carrier family 2, facilitated
  125::244     1e-04  27%  589 aa  YI32_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   13::198     1e-04  21%  396 aa  SOTB_PSEA7 RecName: Full=Probable sugar efflux transporter;
   51::388     1e-04  24%  392 aa  SETA_ECOLI RecName: Full=Sugar efflux transporter A;
  144::282     1e-04  23%  564 aa  S22AL_MOUSE RecName: Full=Solute carrier family 22 member
  136::257     1e-04  27%  550 aa  S22A6_PONAB RecName: Full=Solute carrier family 22 member
   25::118     1e-04  23%  471 aa  MDTD_SHISS RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_SHIFL RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_SHIBS RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_SHIB3 RecName: Full=Putative multidrug resistance protein
   24::117     1e-04  26%  466 aa  MDTD_ERWCT RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECOUT RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECOSM RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECOSE RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECOLU RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECOLI RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECOLC RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECOL6 RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECOL5 RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECOK1 RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECOHS RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECODH RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECOBW RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECO8A RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECO81 RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECO7I RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECO5E RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECO57 RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECO55 RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECO45 RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECO27 RecName: Full=Putative multidrug resistance protein
   25::118     1e-04  23%  471 aa  MDTD_ECO24 RecName: Full=Putative multidrug resistance protein
   97::242     1e-04  25%  522 aa  GTR2_RAT RecName: Full=Solute carrier family 2, facilitated glucose
  274::398     1e-04  26%  398 aa  Y1317_METJA RecName: Full=Uncharacterized MFS-type transporter
   90::245     1e-04  28%  501 aa  SPX3_CHICK RecName: Full=Sugar phosphate exchanger 3;AltName:
  146::283     1e-04  27%  531 aa  S22AA_HUMAN RecName: Full=Solute carrier family 22 member
   83::220     1e-04  26%  537 aa  QAY_NEUCR RecName: Full=Quinate permease;AltName: Full=Quinate
   66::211     1e-04  21%  490 aa  GTR1_CHICK RecName: Full=Solute carrier family 2, facilitated
  264::404     1e-04  30%  456 aa  CF192_HUMAN RecName: Full=Uncharacterized MFS-type transporter
  128::448     2e-04  21%  514 aa  VMAT2_HUMAN RecName: Full=Synaptic vesicular amine
   85::289     2e-04  22%  576 aa  VGLU1_XENLA RecName: Full=Vesicular glutamate transporter 1;       
   85::206     2e-04  28%  499 aa  SPX2_XENTR RecName: Full=Sugar phosphate exchanger 2;AltName:
   13::174     2e-04  20%  396 aa  SOTB_PSEAE RecName: Full=Probable sugar efflux transporter;
   13::174     2e-04  20%  396 aa  SOTB_PSEAB RecName: Full=Probable sugar efflux transporter;
   13::174     2e-04  20%  396 aa  SOTB_PSEA8 RecName: Full=Probable sugar efflux transporter;
   11::184     2e-04  18%  395 aa  SOTB_ERWCT RecName: Full=Probable sugar efflux transporter;
  147::295     2e-04  26%  553 aa  S22AC_RAT RecName: Full=Solute carrier family 22 member 12;AltName:
  136::257     2e-04  27%  563 aa  S22A6_HUMAN RecName: Full=Solute carrier family 22 member
  161::270     2e-04  28%  558 aa  S226A_XENLA RecName: Full=Solute carrier family 22 member
   78::197     2e-04  26%  466 aa  PROP_STAAW RecName: Full=Putative proline/betaine transporter;
   78::197     2e-04  26%  466 aa  PROP_STAAS RecName: Full=Putative proline/betaine transporter;
   78::197     2e-04  26%  466 aa  PROP_STAAR RecName: Full=Putative proline/betaine transporter;
   78::197     2e-04  26%  466 aa  PROP_STAAN RecName: Full=Putative proline/betaine transporter;
   78::197     2e-04  26%  466 aa  PROP_STAAM RecName: Full=Putative proline/betaine transporter;
   78::197     2e-04  26%  466 aa  PROP_STAAC RecName: Full=Putative proline/betaine transporter;
   78::197     2e-04  26%  466 aa  PROP_STAA1 RecName: Full=Putative proline/betaine transporter;
   96::258     2e-04  28%  495 aa  PLST3_ARATH RecName: Full=Probable plastidic glucose transporter 3;
  250::401     2e-04  20%  418 aa  OXLT_OXAFO RecName: Full=Oxalate:formate antiporter;       
   48::189     2e-04  21%  397 aa  NEPI_SALPK RecName: Full=Purine ribonucleoside efflux pump nepI;
   48::189     2e-04  21%  397 aa  NEPI_SALPA RecName: Full=Purine ribonucleoside efflux pump nepI;
   72::180     2e-04  27%  466 aa  MFSD9_MOUSE RecName: Full=Major facilitator superfamily
   47::202     2e-04  22%  462 aa  ERDL2_ARATH RecName: Full=Sugar transporter ERD6-like 2;AltName:
   96::209     2e-04  25%  573 aa  YHD1_SCHPO RecName: Full=Putative inorganic phosphate transporter
   84::297     2e-04  26%  494 aa  SPX3_HUMAN RecName: Full=Sugar phosphate exchanger 3;AltName:
  136::257     2e-04  26%  547 aa  S22A6_PIG RecName: Full=Solute carrier family 22 member 6;AltName:
   97::226     2e-04  29%  536 aa  QAY_NEUTR RecName: Full=Quinate permease;AltName: Full=Quinate
   71::246     2e-04  25%  535 aa  PHT17_ARATH RecName: Full=Probable inorganic phosphate transporter
   95::198     2e-04  30%  496 aa  GTR11_HUMAN RecName: Full=Solute carrier family 2, facilitated
   93::189     2e-04  36%  518 aa  GIT1_YEAST RecName: Full=Probable metabolite transport protein
   43::197     2e-04  19%  432 aa  ANTR5_ARATH RecName: Full=Probable anion transporter 5;AltName:
  255::368     3e-04  25%  402 aa  YBJJ_ECOLI RecName: Full=Inner membrane protein ybjJ;
  131::451     3e-04  22%  517 aa  VMAT2_BOVIN RecName: Full=Synaptic vesicular amine
   50::196     3e-04  22%  500 aa  TPPB_ECOLI RecName: Full=Tripeptide permease tppB;
   50::196     3e-04  22%  500 aa  TPPB_ECOL6 RecName: Full=Tripeptide permease tppB;
   50::196     3e-04  22%  500 aa  TPPB_ECO57 RecName: Full=Tripeptide permease tppB;
   78::197     3e-04  27%  468 aa  PROP_STAHJ RecName: Full=Putative proline/betaine transporter;
   86::182     3e-04  25%  542 aa  PHT15_ARATH RecName: Full=Probable inorganic phosphate transporter
   42::149     4e-04  21%  382 aa  YCAD_SHIFL RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     4e-04  21%  382 aa  YCAD_SHIF8 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   69::188     4e-04  27%  464 aa  PROP_STAEQ RecName: Full=Putative proline/betaine transporter;
   48::189     4e-04  20%  397 aa  NEPI_SALTY RecName: Full=Purine ribonucleoside efflux pump nepI;
   48::189     4e-04  20%  397 aa  NEPI_SALTI RecName: Full=Purine ribonucleoside efflux pump nepI;
   48::189     4e-04  20%  397 aa  NEPI_SALPC RecName: Full=Purine ribonucleoside efflux pump nepI;
   48::189     4e-04  20%  397 aa  NEPI_SALPB RecName: Full=Purine ribonucleoside efflux pump nepI;
   48::189     4e-04  20%  397 aa  NEPI_SALCH RecName: Full=Purine ribonucleoside efflux pump nepI;
  259::392     4e-04  22%  406 aa  MDTG_CITK8 RecName: Full=Multidrug resistance protein mdtG;
  110::261     4e-04  24%  570 aa  HXT7_YEAST RecName: Full=High-affinity hexose transporter HXT6;
  110::261     4e-04  24%  570 aa  HXT6_YEAST RecName: Full=High-affinity hexose transporter HXT6;
  114::244     4e-04  25%  576 aa  HXT4_YEAST RecName: Full=Low-affinity glucose transporter
   59::208     4e-04  26%  474 aa  EDL17_ARATH RecName: Full=Sugar transporter ERD6-like 17;AltName:
   71::191     5e-04  23%  540 aa  YM8M_YEAST RecName: Full=Uncharacterized transporter YMR279C;
   73::213     5e-04  21%  459 aa  YDJK_ECOLI RecName: Full=Putative metabolite transport protein
  147::299     5e-04  26%  330 aa  S22AO_PONAB RecName: Full=Solute carrier family 22 member 24;
   86::182     5e-04  27%  524 aa  PHT11_ARATH RecName: Full=Inorganic phosphate transporter 1-1;     
  134::257     5e-04  21%  585 aa  OCT1_CAEEL RecName: Full=Organic cation transporter 1;AltName:
   42::202     5e-04  20%  467 aa  NPT1_HUMAN RecName: Full=Sodium-dependent phosphate transport
   48::189     5e-04  20%  397 aa  NEPI_SALG2 RecName: Full=Purine ribonucleoside efflux pump nepI;
   48::189     5e-04  20%  397 aa  NEPI_SALEP RecName: Full=Purine ribonucleoside efflux pump nepI;
   65::173     5e-04  29%  493 aa  GTR3_MOUSE RecName: Full=Solute carrier family 2, facilitated
  107::230     5e-04  25%  517 aa  ANTR6_ARATH RecName: Full=Probable anion transporter 6,
   42::149     7e-04  21%  382 aa  YCAD_ECOUT RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     7e-04  21%  382 aa  YCAD_ECOL6 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     7e-04  21%  382 aa  YCAD_ECOL5 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     7e-04  21%  382 aa  YCAD_ECOK1 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     7e-04  21%  382 aa  YCAD_ECO81 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     7e-04  21%  382 aa  YCAD_ECO45 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   69::186     7e-04  21%  394 aa  Y411_BUCBP RecName: Full=Uncharacterized transporter bbp_411;
  111::238     7e-04  25%  508 aa  STP12_ARATH RecName: Full=Sugar transport protein 12;AltName:
   84::227     7e-04  23%  494 aa  SPX3_MOUSE RecName: Full=Sugar phosphate exchanger 3;AltName:
   97::226     7e-04  28%  536 aa  QAY_NEUAF RecName: Full=Quinate permease;AltName: Full=Quinate
   71::182     7e-04  25%  521 aa  PHT13_ARATH RecName: Full=Probable inorganic phosphate transporter
   86::182     7e-04  27%  524 aa  PHT12_ARATH RecName: Full=Probable inorganic phosphate transporter
   89::197     7e-04  29%  520 aa  GTR14_HUMAN RecName: Full=Solute carrier family 2, facilitated
   12::184     7e-04  21%  404 aa  BCRH_RICBR RecName: Full=Uncharacterized transporter RBE_0856;
  110::245     0.001  22%  535 aa  YKH4_CAEEL RecName: Full=Uncharacterized transporter C02C2.4;
   51::168     0.001  25%  485 aa  YJDL_ECOLI RecName: Full=Inner membrane transporter yjdL;
  109::250     0.001  24%  539 aa  YHA8_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   23::163     0.001  21%  409 aa  YFNC_BACSU RecName: Full=Uncharacterized MFS-type transporter yfnC;
   42::149     0.001  20%  382 aa  YCAD_SHISS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     0.001  20%  382 aa  YCAD_SHIDS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     0.001  20%  382 aa  YCAD_ECOSM RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     0.001  20%  382 aa  YCAD_ECOSE RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     0.001  20%  382 aa  YCAD_ECOLU RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     0.001  20%  382 aa  YCAD_ECOLI RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     0.001  20%  382 aa  YCAD_ECOLC RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     0.001  20%  382 aa  YCAD_ECOHS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     0.001  20%  382 aa  YCAD_ECODH RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     0.001  20%  382 aa  YCAD_ECOBW RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     0.001  20%  382 aa  YCAD_ECO8A RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     0.001  20%  382 aa  YCAD_ECO7I RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     0.001  20%  382 aa  YCAD_ECO5E RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     0.001  20%  382 aa  YCAD_ECO57 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     0.001  20%  382 aa  YCAD_ECO55 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     0.001  20%  382 aa  YCAD_ECO27 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   42::149     0.001  20%  382 aa  YCAD_ECO24 RecName: Full=Uncharacterized MFS-type transporter ycaD;
  121::251     0.001  21%  589 aa  VGLU3_HUMAN RecName: Full=Vesicular glutamate transporter 3;       
   85::228     0.001  23%  495 aa  SPX3_BOVIN RecName: Full=Sugar phosphate exchanger 3;AltName:
  139::282     0.001  22%  557 aa  S22A5_MOUSE RecName: Full=Solute carrier family 22 member
   91::209     0.001  25%  456 aa  MFS10_BOVIN RecName: Full=Major facilitator superfamily
   21::157     0.001  29%  804 aa  FTSK_CHLTE RecName: Full=DNA translocase ftsK;
   99::232     0.001  19%  606 aa  ENB1_YEAST RecName: Full=Siderophore iron transporter ENB1;AltName:
   24::170     0.001  14%  394 aa  EMRD_ECOLI RecName: Full=Multidrug resistance protein D;
  124::165     0.001  38%  392 aa  CMLR_STRLI RecName: Full=Chloramphenicol resistance protein;
    1::422

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAVIFILILMVLLNADQMVMSPNIGAIEQEFNITDAQIGLVASSFTVIGALVSLVWGYLADRYSRKNLLI
SPNS1_XENTR     VTIVIILFYINLLNMDRFTVAGVLSDIKEDYHISDSNSGLVQTVFICSYMFLAPVFGYLGDRYNRKLIMC
EXUT_BACSU      --ILFLFLAGVINYLDRSALSIAAPFIQDDLTLSATQMGLIFSSFSIGYAIFNFLGGVASDRYGAKLTLF
SPNS1_XENLA     --IVIILFYINLLNMDRFTVAGVLPDIKKAFNISDSNSGLVQTVFICSYMFLAPVFGYLGDRYNRKLIMC
YIM0_YEAST      ---------------------PVLTIIERKFNITEELANVTIVVYFIFQGVAPSIMGGLADTFGRRPIVL
SPIN_DROME      ---VTVLCFVNLINMDRFTIAGVLTDVRNDFDIGNDSAGLLQTVFVISYMVCAPIFGYLGDRYSRPWIMA
YOU1_CAEEL      ---------------EMMLLSLISPALACEWGISSVQQALVTTCVFSGMMLSSTFWGKICDRFGRRKGLT
SPNS3_DANRE     IAVAVLCYINLLNYMDRYTIAGVLLRIQKFFFISDSTSGLLQTVFICSFMFLAPVFGYLGDRYDRKLIMI
PCAK_ACIAD      IAIVCFLIVFVD-GIDTAAMGFIAPALAQDWGVDRSQLGPVMSAALIIGALVS---GPTADRFGRKIVLS
MDTL_SALTY      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYLAGMATAMLFAGKIADQSGRKPVAI
MDTL_SALPB      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYLAGMATAMLFAGKIADQSGRKPVAI
MDTL_SALNS      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYLAGMATAMLFAGKIADQSGRKPVAI
MDTL_SALHS      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYLAGMATAMLFAGKIADQSGRKPVAI
MDTL_SALA4      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYLAGMATAMLFAGKIADQSGRKPVAI
MUCK_ACIAD      --------------ADLMLLSYSLNSIKAEFNLSTVEAGMLGS-FTLAGAIGGIFGGWACDRFGRVRIVV
MDTL_SALEP      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYLAGMATAMLFAGKIADQSGRKPVAI
MDTL_SALDC      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYLAGMATAMLFAGKIADQSGRKPVAI
MDTL_SALAR      ----FTLILLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYLAGMATAMLFAGKIADRSGRKPVAI
YITG_BACSU      MTIVAIGSIPLILTLGNSMLIPILPKMKSELHLSQFQVSLVITVFSLIAAFAIPIVGYLADRFSRKCLIL
MDTL_SALTI      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYLAGMATAMLFAGKIADQSGRKPVAI
MDTL_SALSV      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYLAGMATAMLFAGKIADQSGRKPVAI
MDTL_SALPK      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYLAGMATAMLFAGKIADQSGRKPVAI
MDTL_SALPA      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYLAGMATAMLFAGKIADQSGRKPVAI
MDTL_SALPC      ----FALVLLYPAGIDMYLVG--LPRIAVDLNASESQLHIAFSVYLAGMATAMLFAGKIADQSGRKPVAI
MDTL_SALCH      ----FALVLLYPAGIDMYLVG--LPRIAVDLNASESQLHIAFSVYLAGMATAMLFAGKIADQSGRKPVAI
YYBF_BACSU      -------------------VQPLMEEFTREFHVTPTAASLSLSVTTMLLAVSMLVFGSLSEVWGRKPIMG
SPNS1_DANRE     MTVIVLCYINLLNYMDRFTVAGVLPDIEHFFGIGDGTSGLLQTVFICSYMFLAPLFGYLGDRYNRKLIMC
BMR3_BACSU      --VVLGLLLGILMSADNTIVATAMGNIVADLGSFD-KFAWVTASYMVAVMAGMPIYGKLSDMYGRKRXXX
SVOP_PONAB      ---------------EMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLK
SVOP_HUMAN      ---------------EMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLK
SVOP_BOVIN      ---------------EMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLK
MDTL_KLEP3      ----FALVLLYPSGIDMYLVG--LPRIAQDLGASEAQLHIAFSVYLAGMASAMLFAGRIADRSGRKPXXX
MDTL_KLEP7      ----FALVLLYPSGIDMYLVG--LPRIAQDLGASEAQLHIAFSVYLAGMASAMLFAGRIADRSGRKPXXX
ANTR3_ARATH     --VILTACMMCLCNADRVVMSVAVVPLADKLGWSSSFLGVVQSSFLWGYIFSSVIGGALVDRYGGKRVLA
NANT_YERPY      ----FVLITLVLTD------------IKQEFGLTLIQATSLISAAFISRWFGGLVLGAMGDRYGRKLAMI
MDTL_VIBPA      ----FALVLLYPTAIDLYLVG--LPQIASDLNASESQLHIAFSVYLAGMATTMLFAGKIADSVGRKPIAV
NANT_YERPS      ----FVLITLVLTD------------IKQEFGLTLIQATSLISAAFISRWFGGLVLGAMGDRYGRKLAMI
NANT_YERPP      ----FVLITLVLTD------------IKQEFGLTLIQATSLISAAFISRWFGGLVLGAMGDRYGRKLAMI
NANT_YERPG      ----FVLITLVLTD------------IKQEFGLTLIQATSLISAAFISRWFGGLVLGAMGDRYGRKLAMI
NANT_YERPB      ----FVLITLVLTD------------IKQEFGLTLIQATSLISAAFISRWFGGLVLGAMGDRYGRKLAMI
NANT_YERP3      ----FVLITLVLTD------------IKQEFGLTLIQATSLISAAFISRWFGGLVLGAMGDRYGRKLAMI
GUDP_BACSU      --IVFMLFLVTSINADRATLSITGDSVQHDLGLDSVAMGYVFSAFGWAYVIGQLPGGWLLDRFGSKTIIA
SPNS3_MOUSE     -----VLCYINLLNYMNWFIIPGVLLVQKYFHISDSHAGLLQTVFISCLLVSAPVFGYLGDRYNRKAILS
SPNS3_HUMAN     --------------------------IQEVFQISDNHAGLLQTVFVSCLLLSAPVFGYLGDRHSRKATMS
MDTL_ECOSE      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_ECOLI      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_ECODH      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_ECOBW      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_ECO55      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
SV2C_HUMAN      -ALFFVLGMALMADGVEVVVGFVLPSAETDLCIPNSGSGWLGS-IVYLGMMVAFFWGGLADKVGRKQSLL
MDTL_ESCF3      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_SHISS      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_SHIFL      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_SHIDS      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_SHIBS      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_SHIB3      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_ECOUT      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_ECOLC      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_ECOK1      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_ECOHS      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_ECO5E      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_ECO57      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_ECO45      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
VACHT_DANRE     ----------------------------------DIQIGVLFASKALLQLLVNPLSGTFIDRVGYDLPLL
TCRB_BACSU      --LIWLCVLSFFSVLNEMVLNVSLPDIANEFNKLPASANWVNTAFMLTFSIGTALYGKLSDQLGIKNLLL
SPNS2_XENTR     ----------VLNYLDRYTVAGVLLDIQQHFEVKDSGAGLLQTVFICSFMVAAPIFGYLGDRFNRKVILS
PHDK_NOCSK      --VLMVFLIMVADGMDITLASHLFPPVIRDWGVPVSAVTLVVSLGVVAMAIGALVSGPVADRWGRKGVTV
MDTL_ECOL5      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_ECO27      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
ANTR2_ARATH     --VLLCFSSFLLCNMDRVNMSIAILPMSQEYNWSSATVGLIQSSFFWGYLLTQILGGIWADXXXXXXXXX
PHT43_ORYSJ     -------LALALCNADRVVMSVAIVPLSQAYGWTPSFAGVVQSSF-LWGYLVSIIGGALVDYYGGKRVMA
MDTL_ECO7I      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
YIM1_YEAST      ---------------------PVLSVIERKFDIDEELXXXXXXXXXXFQGLAPTFMGGFADSLGRRPVVL
SVOP_XENLA      ---------------EMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLK
SOTB_SHISS      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_SHIFL      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_SHIF8      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_SHIBS      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_SHIB3      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECOSM      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECOSE      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECOLU      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECOLI      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECOLC      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECOHS      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECODH      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECOBW      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECO8A      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECO7I      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECO5E      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECO57      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECO55      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECO24      LRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
MDTL_ECOSM      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_ECOLU      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
TPO3_YEAST      ---VLLSILVICVAYGSACISGGLGTVEKKYHV-GMEAAILSVSLMVIGSLGPLIWSPVSDLYGRRVAYF
MDTL_ECOL6      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_ECO8A      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_ECO81      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
MDTL_ECO24      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXKVADRSGRKPVAI
GARP_ECOLI      --ILLIIFIVTAVNADRATLSIAGTEVAKELQLSAVSMGYIFSAFGWAYLLMQIPGGWLLDKFGSKKVYT
GARP_ECO57      --ILLIIFIVTAVNADRATLSIAGTEVAKELQLSAVSMGYIFSAFGWAYLLMQIPGGWLLDKFGSKKVYT
SV2C_RAT        -ALFFVLGMALMADGVEVVVGFVLPSAETDLCIPNSGSGWLGS-IVYLGMMVAFFWGGLADKVGRKQSLL
SV2B_HUMAN      ---ILFFVLGLALMADGVVVSFALPSAEKDMCLSSSKKGMLGMIVYLGMMAGAFILGGLADKLGRKRVLS
MDTL_CITK8      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYLAGMATAMLFAGKVADQSGRKPXXX
VBA5_YEAST      ---------------DILIVGTIIDVVAEQFG-NYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLI
SV2C_MOUSE      -ALFFVLGMALMADGVEVVVGFVLPSAETDLCIPNSGSGWLGS-IVYLGMMVAFFWGGLADKVGRKQSLL
PHT41_ORYSJ     -AIVFLCFSAFLLNMDRVNMSIAILPMSAEFGWNPQTVGLIQSSFFWGYLLTQIAGGIWADTVGGKTVLG
NANT_YERPE      ----FVLITLVLTD------------IKQEFGLTLIQATSLISAAFISRWFGGLVLGAMGDRYGRKLAMI
NANT_YERPA      ----FVLITLVLTD------------IKQEFGLTLIQATSLISAAFISRWFGGLVLGAMGDRYGRKLAMI
NANT_SALTY      ----FVLIALVLTE------------VQSEFGLTTVQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMV
NANT_SALTI      ----FVLIALVLTE------------VQSEFGLTTVQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMV
NANT_SALSV      ----FVLIALVLTE------------VQSEFGLTTVQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMV
NANT_SALPK      ----FVLIALVLTE------------VQSEFGLTTVQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMV
NANT_SALPC      ----FVLIALVLTE------------VQSEFGLTTVQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMV
NANT_SALPB      ----FVLIALVLTE------------VQSEFGLTTVQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMV
NANT_SALPA      ----FVLIALVLTE------------VQSEFGLTTVQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMV
NANT_SALNS      ----FVLIALVLTE------------VQSEFGLTTVQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMV
NANT_SALHS      ----FVLIALVLTE------------VQSEFGLTTVQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMV
NANT_SALG2      ----FVLIALVLTE------------VQSEFGLTTVQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMV
NANT_SALEP      ----FVLIALVLTE------------VQSEFGLTTVQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMV
NANT_SALDC      ----FVLIALVLTE------------VQSEFGLTTVQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMV
NANT_SALCH      ----FVLIALVLTE------------VQSEFGLTTVQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMV
NANT_SALAR      ----FVLIALVLTE------------VQSEFGLTTVQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMV
ANTR1_ARATH     --VLLCFSAFLLCNMDRVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKRVLG
VACHT_RAT       ----------------------------------DVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLL
TPO2_YEAST      ---VLLSILVICVAYGSACISGGLGTVEKKYHV-GMEAAILSCSLMVIGSLGPLIWSPVSDLYGRRVAYF
SPNS1_HUMAN     --IVAVLCYINLLNMDRFTVAGVLPDIEQFFNIGDSSSGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMC
MDTM_ECO57      ------------------LIQPGIINVVRDFN-ADVSLAPAAVSLYLAGGM-ALQWGPLSDRIGRKPVLI
MDTL_SHIF8      ----FALVLLYPAGIDMYLVGPRIAA---DLNASEAQLHIAFSVYXXXXXXXXXXXXXXXDRSGRKPVAI
AQR1_YEAST      ---------------------PALRQLEKQFXXXXXXXXXXXXXYLLFQGISPTVSGGLADCFGRRPIIL
SPNS1_RAT       --IVVVLCYINLLNMDRFTVAGVLTDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMC
SPNS1_MOUSE     --IVVVLCYINLLNMDRFTVAGVLTDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMC
SOTB_ECOUT      LRVVTLAVAAFIFNTTEFVPVGLLSDIAHSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECOL6      LRVVTLAVAAFIFNTTEFVPVGLLSDIAHSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECOL5      LRVVTLAVAAFIFNTTEFVPVGLLSDIAHSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECOK1      LRVVTLAVAAFIFNTTEFVPVGLLSDIAHSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECO81      LRVVTLAVAAFIFNTTEFVPVGLLSDIAHSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECO45      LRVVTLAVAAFIFNTTEFVPVGLLSDIAHSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
SOTB_ECO27      LRVVTLAVAAFIFNTTEFVPVGLLSDIAHSFHMQTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLI
YWOD_BACSU      ------------------MISLALHSIQHEFHLSFTTVSWLISSFYLASAVAQPVTGKLGDLIGRKRLFL
SOTB_SALTY      LRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFMLLTSQMERRKLLI
SOTB_SALNS      LRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFMLLTSQMERRKLLI
VACHT_HUMAN     ----------------------------------DVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLL
NANT_CITK8      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
MDTM_ECOLI      ------------------LIQPGIINVVRDFN-ADVSLAPAAVSLYLAGGM-ALQWGPLSDRIGRRPVLI
VACHT_MOUSE     ----------------------------------DVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLL
TCR_STRPN       --LIWLCILSFFSVLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTAVYGKLSDQLGIKRLLL
TCR_BACSU       --LIWLCILSFFSVLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTAVYGKLSDQLGIKRLLL
TCR_BACST       --LIWLCILSFFSVLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTAVYGKLSDQLGIKRLLL
TCR_BACCE       --LIWLCILSFFSVLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTAVYGKLSDQLGIKRLLL
SPNS2_MOUSE     ----------VLNYLDRYTVAGVLLDIQQHFGVKDRGAGLLQSVFICSFMVAAPIFGYLGDRFNRKVILS
SPNS2_HUMAN     ----------VLNYLDRYTVAGVLLDIQQHFGVKDRGAGLLQSVFICSFMVAAPIFGYLGDRFNRKVILS
NANT_ESCF3      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
BENK_ACIAD      --IILSTLIIIFDGYDLVIYGVALPLLMKEWAIDPVTAGFIGSIALFGMMFGALIFGTIADKLSRKKVIA
YCEI_BACSU      ---------------DVGILSFIIAALHVEWNLSPEEMKWIGSVNSIGMXXXXXXXXXXXDRIGRKKVFI
TCR_STRAG       --LIWLCILSFFSVLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTAVYGKLSDQLGIKRLLL
PMRA_STRR6      ------------------------------------------------------IWGILADKYGRKPMMI
PMRA_STRPN      ------------------------------------------------------IWGILADKYGRKPMMI
YYAJ_BACSU      --------------ADLFTLSNVAPALIEHWGIPLSTIANVTAASFLGMFLGASLGGRLSDRIGRKKALN
SOTB_CITK8      LRVVTLAIAAFIFNTTEFVPVGLLSDIARSFAMPTAQVGIMLTIYAWVVALMSLPFMLLTSQVERRKLLI
DGOT_ECOLI      LTLVMIFITVVICYVDRANLAVASAHIQEEFGITKAEMGYVFSAFAWLYTLCQIPGGWFLDRVGSRVTYF
DGOT_ECOL6      LTLVMIFITVVICYVDRANLAVASAHIQEEFGITKAEMGYVFSAFAWLYTLCQIPGGWFLDRVGSRVTYF
PLT6_ARATH      -------IVSIIFGYDTGVMSGAMVFIEEDLKTNDVQIEVLTGILNLCALVGSLLAGRTSDIIGRRYTIV
BCR_HAEIN       ---IFILTLGILSMLPPFGVDPSFLEIAKDLDVSPEQVQHTLTSFAYGMAFGQLFWGPFGDSFGRKPIIL
AZR1_YEAST      ---------------DIMIVSTIIEEVAKQFG-SYSEIGWLFTGYSLPNALLALIWGRIATPIGFKETML
PLT5_ARATH      ----------ILLGYDIGVMSGAMIYIKRDLKINDLQIGILAGSLNIYSLIGSCAAGRTSDWIGRRYTIV
NANT_SHIFL      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_SHIF8      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_SHIB3      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_ECOSM      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_ECOSE      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_ECOLI      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_ECOLC      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_ECOL5      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_ECOHS      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_ECODH      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_ECOBW      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_ECO8A      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_ECO7I      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_ECO5E      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_ECO57      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_ECO55      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_ECO45      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_ECO27      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT_ECO24      ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
NANT1_ECOL6     ----FVLIALVLTE------------VQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMV
YRT3_CAEEL      ---------------------------EREFLWTGAEVGMMESSFFYGYAASQIPAGVLAAKFAPNKIFM
TCR_STAHY       --LIWLCILSFFSVLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTAVYGKLSDQLGIKRLLL
SVOP_MOUSE      ---------------EMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMSSSTLWGNISDQYGRKTGLK
SOTB_SALTI      LRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFMLLTSQMERRKLLI
SOTB_SALSV      LRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFMLLTSQMERRKLLI
SOTB_SALPK      LRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFMLLTSQMERRKLLI
SOTB_SALPC      LRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFMLLTSQMERRKLLI
SOTB_SALPB      LRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFMLLTSQMERRKLLI
SOTB_SALPA      LRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFMLLTSQMERRKLLI
SOTB_SALHS      LRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFMLLTSQMERRKLLI
SOTB_SALG2      LRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFMLLTSQMERRKLLI
SOTB_SALEP      LRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFMLLTSQMERRKLLI
SOTB_SALDC      LRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFMLLTSQMERRKLLI
SOTB_SALCH      LRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFMLLTSQMERRKLLI
SOTB_SALAR      LRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFMLLTSQIERRKLLI
SOTB_SALA4      LRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFMLLTSQMERRKLLI
PHT44_ORYSJ     -------------NMDRVNMSIAILPMSSEFGWSPATVGLIQSSFFWGYLLTQILGGIWADRXXXXXXXX
YQJV_BACSU      --------------------------------------GLVIAASSSVGILASFYGGYISDKFGRKNMML
EMRB_ECOLI      ----------------------------------------VITSFGVANAISIPLTGWLAKRVGEVKLFL
EMRB_ECO57      ----------------------------------------VITSFGVANAISIPLTGWLAKRVGEVKLFL
SVOP_RAT        ---------------EMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMSSSTLWGNISDQYGRKTGLK
SPNS1_BOVIN     --IVAVLCYINLLNMDRFTVAGVLPDIEQFFDIGDGSSGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMC
YJA1_SCHPO      ------------------MVAPCLDQIADRFHIQNSEKALILSIYLLVFAISPMISAPLSEVFGRRMLLQ
YTBD_BACSU      --------------------------------------GLTVSLYALGVTFGAPILTSLTSSMSRKTLLL
YHX6_SCHPO      ---------------DNTIVASTYTKIGAEFG-KFSQVSWTATAYMISCTAFQPLFGKFCDIYGRKKTLL
SGE1_YEAST      -------------------------------------IGWLVTGYALSNAVFMLLWGRLAEILGTKECLM
PLT3_ARATH      -------IISIIFGYDTGVMSGAQIFIRDDLKINDTQIEVLAGILNLCALVGSLTAGKTSDVIGRRYTIA
YWTG_BACSU      -----------LYGYDTGVISGAILFMKKELGLNAFTEGLVVSSLLVGAILGSGAAGKLTDRFGRKKAIM
YCNB_BACSU      LAGAFVAIL------NQTLLITALPHIMRDFNVDANQAQWLTTSFMLTNGILIPITAFLIEKFTSRALLI
SPNS2_DANRE     ----------VLNYMDRYTVAGVLLDIQKQFKVGDSSAGLLQTVFICSFMVAAPIFGYLGDRFNRKIILS
S22A7_HUMAN     -------------------------ATESQWDLVCEQKGLAASTFFFAGVLVGAVFGYLSDRFGRRRLLL
HXT10_YEAST     ------------------------------FQLSDVRTGLIVGIFNIGCALGGLTLGRLGDIYGRKIGLM
SVOPL_HUMAN     ------------------VVSP---VIRCEWQLENWQVALVTTMVFFGYMVFSILFGLLADRYGRWKILL
QACA_STAAU      -------------------------------------------SLVLAGFIIPL--SAFADKWGRKKALL
QACA_STAAM      -------------------------------------------SLVLAGFIIPL--SAFADKWGRKKALL
YNFM_ECOLI      -------------------VQPILPVLSQEFGLTPANSSISLSISTAMLAIGLLFTGPLSDAIGRKPVMV
YAAU_ECOLI      ------------------------------------------------------LFGYISDKVGRRKMFL
S22A7_PONAB     -------------------------ATESQWDLVCEQKGLAASTFFFAGVLVGAVFGYLSDRFGRRRLLL
GUDP_ECOLI      --VVMLFIVTSFNYGDRATLSIAGSEMAKDIGLDPVGMGYVFSAFSWAYVIGQIPGGWLLDRFGSKRVYF
YWFA_BACSU      --------------SEELVISPLLPDLAKAFS---SDVSVLALSISIYGVMIFILLVPLGDKYSRELSLL
YN43_SCHPO      -------------------------------------VALLGMSLYVCGASGPILWAPISELVGRKIPLI
YJJL_ECOLI      -AMLLLFFAAVINYLDRSSLSVANLTIREELGLSATEIGALLSVFSLAYGIAQLPCGPLLDRKGPRLMLG
Y588_BUCAI      ----------------------------KQFYLTPAESSLALSAATITMSLGMLFTGPLSDIIGRKSIMS
NEPI_SHISS      ----------------------------QDLGISEGVAGQSVTVTAFVAMFASLFITQTIQATDRRNVVI
YGAY_ECOLI      --IVLMSIATGLAVASNYYAQPLLDTIARNFSLSASSAGFIVTAAQLGYAAGLLFLVPLGDMFERRRLIV
YGAY_ECO57      --IVLMSIATGLAVASNYYAQPLLDTIARNFSLSASSAGFIVTAAQLGYAAGLLFLVPLGDMFERRRLIV
MHPT_ECOLI      ------------------------------FALDKMQMGWIFSA-GILGLLPALVGGMLADRYGRKRILI
BMR1_BACSU      ---------------------PVTPTIMNELHLSGTAVGYMVACFAITQLIVSPIAGRWVDRFGRKIMIV
ATR1_YEAST      ---IFTCMISQLLNQAGTTQTLSINILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLL
SOTB_ERWT9      LRVLMLAIAAFIFNTTEFVPVGLLSDIGSSFSMQTAQVGLMLTIYAWVVALMSLPMMLLTRNVERRMLLM
YFHI_BACSU      --IIFVLMICTFIGYTEYAVMGILTSIANDFHIQVSSAGLLVTAYAASVCLTGPLVTIISVKLPRKPVLL
Y1560_METJA     --VIWITTFTTMLGVG--FIAPIMAIYAQTLGATNLEIGLIFGSFALARTVAQIPVGVLSDIYGKKFFIV
XYLT_LACBR      ---------------DTGVISGAILFIQKQMNLGSWQQGWXXXXXXXXXXXXXXXXXXXXDRFGRRKLLL
PHT42_ORYSJ     -------------NADRVVMSVAVVPFAAQYGWSSSFLGIVQSSFLWGYVFSSMVGGALADRYGGKKVMA
ARAJ_ECOLI      -------------------------------------------SYYALGVVVGAIIALFSSRYSLKHILL
S22A1_HUMAN     -------------------------SIVTEFNLVCAKLDLFQSCLNAGFFFGSLGVGYFADRFGRKLCLL
S17A5_HUMAN     --------------------------------------GWILGSFFYGYIITQIPGGYVASKIGGKMLLG
NEPI_ECO27      ----------------------------QDLGISEGVAGQSVTVTAFVAMFASLFITQTIQATDRRYVVI
NASA_BACSU      --------------------------ISQDFGLSPFEKGLVVAVPILSGSVFRIILGILTDRIGPKKTAV
SVOPL_MOUSE     ------------------VVSP---VIRCEWQLENWQVAFVTTMVFFGYMVSSILFGLLADRYGRWKILL
HXT5_YEAST      --------------------------------LSDVRTGLMVSIFNIGCAIGGIVLSKLGDMYGRKGLMT
EMRB_HAEIN      ---------------DSTIANVAIPTIAGDLGASFSQGTWVITSFGVANAISIPITGWLAKRFGEVRLFL
Y567_BUCAP      ----------------------------------------------------TLFIGPLSDRIGRKSIMS
VACHT_TORCA     -----------LLNSTQRVLERNPNANE------DIQIGVLFASKAILQLLSNPFTGTFIDRVGYDIPLL
MSSP3_ARATH     --------------------------IKKEFHLEEPKIEGLIVAMSLIGALITTFSGPVSDKVGRRSMLI
MDTL_SHESA      ----FGLVLMYPTGIDMYLVG--LPQIANQLGATEAQLHIAFSVYLAGMATTMLFAGSLADRIGRKPITX
YCR3_YEAST      ---------------------PYVYFMVRDFNIADAQVGYLSSSFALCQVISAYHWGRFSEKHGRKITLT
VACHT_TOROC     -----------LLNSTQRVLERNPNANE------DIQIGVLFASKAILQLLSNPFTGTFIDRVGYDIPLL
VACHT_TORMA     -----------LLNSTQRVLERNPNANE------DIQIGVLFASKAILQLLSNPFTGTFIDRVGYDIPLL
YJHB_ECOLI      ---------------DFMMIFYILHIIKADLGITDIQATLIGTVAFIARPIGGGFFGAMADKYGRKPMMM
S22A2_MOUSE     -------------------------SIVTEFNLVCAHSWMLDQSLVNVGFFIGAVGGYLADRFGRKFCLL
NEPI_SHIDS      ----------------------------QDLGISEGVAGQSVTVTAFVAMFASLFITQTIQATDRRYVVI
HXT2_YEAST      ------------------------------YYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLM
GTR12_XENLA     ----------------------------------------IVVSALLIGALVSLVGGCLIDLYGRRTTII
YDHC_ECOLI      -------------------------------------------------------WGPLSDRYGRKPVLL
YBCL_BACSU      ---IYILIVSFLVGTSEYIISGILDQIAHTLGITLAAAGQLITIFSLVYALSTPVLMALTASMDRRKLMM
NEPI_ECOL5      ----------------------------QDLGISEGVAGQSVTVTAFVAMFASLFITQTIQATDRRYVVI
YN2F_SCHPO      -------------------------------------VALLGISLYVLGASGPVVWAPMCELFGRRRPMI
YHCA_BACSU      MAGLFLAIL------NQTLLNVAMPHLMTEFGVSATTIQWLTTGYMLVNGVLIPLSAFLITRFGQRSLFL
YCEJ_BACSU      --------VMFVIGTDTFXXXXXXXXXQDQFHVSTDLSGWMVSAYALGYALFAFIAGPISDRLNRKTVML
UNC17_CAEEL     ----------------------------------ELELGWLFASKALLQIFVNPFSGYIIDRVGYEIPMI
PLST1_ARATH     ------------------VMNGPIVSIARELGFEGNSIGLVVSIFIAGAFIGSIVAGPLVDKFGRRTFQI
NEPI_SHIFL      ----------------------------QDLGISEGVAGQSVTVTAFVAMFASLFITQTIQATDRRYVVI
NEPI_SHIF8      ----------------------------QDLGISEGVAGQSVTVTAFVAMFASLFITQTIQATDRRYVVI
NEPI_ECOLI      ----------------------------QDLGISEGVAGQSVTVTAFVAMFASLFITQTIQATDRRYVVI
NEPI_ECOBW      ----------------------------QDLGISEGVAGQSVTVTAFVAMFASLFITQTIQATDRRYVVI
MSSP1_ARATH     --------------------------INKDLNLPTSVQGLVVAMSLIGATVITTCSGPISDWLGRRPMLI
MMLH_RALEJ      --------------------------------------------------------GILSDRYGRARILV
SOTB_ESCF3      LRVVTLAIAAFIFNTTEFVPVGLLSDIAASFHMETAQTGIMLTIYAWVVALMSLPFMLLTSQVERRRLLI
S22A2_RAT       -------------------------SIVTEFNLVCAHLDLFQSVVNVGFFIGAMMIGYLADRFGRKFCLL
S17A5_SHEEP     --------------------------------------GWILGSFFYGYIITQIPGGYVASRSGGKLLLG
PLT4_ARATH      ----------VLLGYDVGVMSGAVLFIQQDLKITEVQTEVXXXXXXXXXXXXXXXXXRTSDSIGRKWTMA
MDTL_SHEON      ----FGLVLMYPTGIDMYLVG--LPQIASQLGASEAQLHIAFSVYLAGMATTMLFAGSLADRIGRKPITX
CSBC_BACSU      ---------------DTGVISGALLFINNDIPLTTLTEGLVVSMLLLGAIFGSALSGTCSDRWGRRKVVF
NART_STAES      ------------------IISPLMPFISQDVDISPGQISVILAIPVILGSVLRVPFGYLTNIVGAKWVFF
NART_STAEQ      ------------------IISPLMPFISQDVDISPGQISVILAIPVILGSVLRVPFGYLTNIVGAKWVFF
NANT_ENTS8      ----FVLIALVLTE------------IQDEFGLTTIQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMI
YN42_SCHPO      -----------------------------------------------------IIWAPLSELSGRKPPIL
PLT1_ARATH      ----------IILGYDIGVMSGASIFIKDDLKLSDVQLEILMGILNIYSLVGSGAAGRTSDWLGRRYTIV
NEPI_ECOUT      ----------------------------QDLGISEGVAGQSVTVTAFVAMFASLFITQTIQATDRRYVVI
NEPI_ECOL6      ----------------------------QDLGISEGVAGQSVTVTAFVAMFASLFITQTIQATDRRYVVI
NEPI_ECOK1      ----------------------------QDLGISEGVAGQSVTVTAFVAMFASLFITQTIQATDRRYVVI
ANTR4_ARATH     -------------NADRVVMSVAIVPLSLSRGWSKSFSGIVQSSF-LWGYLISIAGGTLVDRYGGKVVMA
OCTL_DROME      -----------------------------------------SDSLFMLGVLLSIVFGQLSDKYGRKPILF
NANT_SALA4      ----FVLIALVLTE------------VQSEFGLTTVQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMV
YN41_SCHPO      ------------------VLSPASATLAKKYHIGMTTSLLNVSLFMLGYCLGPICWAPMSEITGRKTPLY
SOTB_ERWCH      LRVVTLAIAAFIFNTTEFIPVGLLSDIANSFAMKTEDVGLMITIYAWIVAVASLICMLLTSGIERRKXXX
S22A1_RABIT     -------------------------SIVTEFNLVCAKVDLFQSCVNLGFFLGSLGVGYIADRFGRKLCLL
PMRA_LACLA      --------------------------------------GLAFSLPALASGLVAPIWGRLADEHGRKVMMV
NORA_STAAW      ------------------------------------------AAFALSQMIISPFGGTLADXXXXXXXXX
NORA_STAAU      ------------------------------------------AAFALSQMIISPFGGTLADXXXXXXXXX
NORA_STAAS      ------------------------------------------AAFALSQMIISPFGGTLADXXXXXXXXX
NORA_STAAN      ------------------------------------------AAFALSQMIISPFGGTLADXXXXXXXXX
NORA_STAAM      ------------------------------------------AAFALSQMIISPFGGTLADXXXXXXXXX
NORA_STAAC      ------------------------------------------AAFALSQMIISPFGGTLADXXXXXXXXX
NEPI_SHIBS      ----------------------------QDLGISEGVAGQSVTVTAFVAMFASLFITQTIQATDRCYVVI
ERDL4_ARATH     --------------------SPTQAAITKDLGLTVSEYS-VFGSLSNVGAMVAIASGQIAEYVGRKGSLM
YFMO_BACSU      ------------------LVDPILPAIAAQLHASPSEVSLLFTSYLLVTGFMMFFSGAISSRIGAKWTLI
YAJR_ECOLI      -------------------------------------------------AVFQIPFGLLSDRIGRKPLIV
NORA_STAAR      ------------------------------------------AAFALSQMIISPFGGTLADXXXXXXXXX
NEPI_ECO57      ----------------------------QDLGISEGVAGQSVTVTAFVAMFASLFITQTIQATDRRYVVI
GUDP_PSEPU      --ILLMLFLVTTINADRATISIAGSSIQKDFGLDAVTLGYIFSAFGWAYVLGQIPGGWLLDRFGSKKVYA
SOTB_PSE14      LGVFALALAAFIFNTTEFVPIGLLSNIGQSFEMTPAQVGLMLTIYAWVVSLMSLPMMLATRNIERRKLLM
S17A9_HUMAN     -------------------------SMSQDFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKVIL
BAIG_EUBSP      ------------------------------------------------------ILGKLGDVLGRRTTLL
YB30_YEAST      ---------------------PALPLLQREYDVSATTINATVSVFMAVFSVGPLFWGALADFGGRKFLYM
MDTD_PECCP      ---------------DTTIVNTALPSMAASLNESPLHMHSVIVSYVLTVAVMLPASGWLADRIGVKNIFF
ERDL6_ARATH     --------------------SPTQAAITKDLGLTVSEYS-VFGSLSNVGAMVAIASGQIAEYIGRKGSLM
YCLF_BACSU      --------------------------------------GTAVAIMSIYGSLVTIIGGWLADRFGTANTVF
SOTB_ENT38      LRVVTLAIAAFIFNTTEFVPVGLLSDIAQSFQMETAQVGIMLTIYAWVVALMSLPFMLLTSQMERRKLLI
ITR2_SCHPO      ----WIWVLSAVAGISGLLFGYDTGVISGALAVLGSDLGHVLSSATSFAALISATTGWLADWVGRKRLLL
SVOPL_DANRE     ------------------VVSPEIRC---EWHLEDWQVALV-STMVFFGFMVGVLCGYIADKYGRWKVVF
SV2A_RAT        ----FVLGLALMADGVEVVVGFVLPSAEKDMCLSDSNKGMLGL-IVYLGMMVAFLWGGLADRLGRRQCLL
SV2A_PONAB      ----FVLGLALMADGVEVVVGFVLPSAEKDMCLSDSNKGMLGL-IVYLGMMVAFLWGGLADRLGRRQCLL
SV2A_MOUSE      ----FVLGLALMADGVEVVVGFVLPSAEKDMCLSDSNKGMLGL-IVYLGMMVAFLWGGLADRLGRRQCLL
SV2A_MACFA      ----FVLGLALMADGVEVVVGFVLPSAEKDMCLSDSNKGMLGL-IVYLGMMVAFLWGGLADRLGRRQCLL
SV2A_HUMAN      ----FVLGLALMADGVEVVVGFVLPSAEKDMCLSDSNKGMLGL-IVYLGMMVAFLWGGLADRLGRRQCLL
SV2A_BOVIN      ----FVLGLALMADGVEVVVGFVLPSAEKDMCLSDSNKGMLGL-IVYLGMMVAFLWGGLADRLGRRQCLL
S22A1_RAT       -------------------------SIVTEFNLVDAKVDLFQSCVNLGFFLGSLVVGYIADRFGRKLCXX
PBUE_BACAM      ----------------ELIVGGILPQIASDLDISIVSAGQLISVFALGYAVSGPLLLAVTAKAERKRLYL
GTR10_XENLA     ------------------IISGALLMLKTVFQLTCFEQEALVSAVLFGALLASLIGGFIIDRSGRRTSIM
ARAE_ECOLI      ----------LLFGLDIGVIAGALPFITDHFVLTSRLQEWVVSSMMLGAAIGALFNGWLSFRLGRKYSLM
ARAE_ECO57      ----------LLFGLDIGVIAGALPFITDHFVLTSRLQEWVVSSMMLGAAIGALFNGWLSFRLGRKYSLM
YYBO_BACSU      ---------------DRVAISVAAPAIQDSFHLTATELGIVFSIYTYSYTLMQLPVGSLLDRFTRVGMTI
NART_STAAW      ------------------IIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLRVPFGYLTNIVGAKWVFF
NART_STAAT      ------------------IIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLRVPFGYLTNIVGAKWVFF
NART_STAAS      ------------------IIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLRVPFGYLTNIVGAKWVFF
NART_STAAN      ------------------IIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLRVPFGYLTNIVGAKWVFF
NART_STAAM      ------------------IIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLRVPFGYLTNIVGAKWVFF
NART_STAAE      ------------------IIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLRVPFGYLTNIVGAKWVFF
NART_STAAC      ------------------IIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLRVPFGYLTNIVGAKWVFF
NART_STAAB      ------------------IIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLRVPFGYLTNIVGAKWVFF
NART_STAA9      ------------------IIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLRVPFGYLTNIVGAKWVFF
NART_STAA8      ------------------IIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLRVPFGYLTNIVGAKWVFF
NART_STAA3      ------------------IIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLRVPFGYLTNIVGAKWVFF
NART_STAA2      ------------------IIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLRVPFGYLTNIVGAKWVFF
NART_STAA1      ------------------IIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLRVPFGYLTNIVGAKWVFF
YQO5_SCHPO      ------------------VFSVPAEAITTIFHIS-LTVSLLTMTVFLCGYIAGIVWAPLSELSGRKLPLL
YFIU_BACSU      -AISLFTIGVFMAALDNGIISAALTTINESFSVSPSW-GSWGITLYTLGLSVSVIVGKLSDRYGRKKLFL
SV2B_RAT        --LFFVLVLALMADGVEVVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLS
SPX3_XENLA      -------------------------------------LGLLDTIFLFAYAVGLFISGIIGDRLNMRLVLT
SOTB_HAEIN      -----------IFNTTEFVPVAMLSDIAQSFDMQTADTGLMMTVYAWTVLIMSLPAMLATGNMERKSXXX
SOTB_HAEIG      -----------IFNTTEFVPVAMLSDIAQSFDMQTADTGLMMTVYAWTVLIMSLPAMLATGNMERKSXXX
SETB_ECOLI      ------LIVAFLTGIAGALQTPTLSILTDEVHARPAMVGFFFTGSAVIGILVSQFLAGRSDRGDRKSLIV
PCAK_PSEPU      --VVLLCFLIVFLDGDTAAMGFIAPALSQEWGIDRASLGPVMSAALIGMVFGALGSGPLADRFGRKXXXX
NART_STAAR      ------------------IIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLRVPFGYLTNIVGAKWVFF
BSU1_SCHPO      -----IVFMFCLMQIYVIWTSNGFGSIEYQFNVS-AQVATLCLSMNILGSLGPMFLGPLSDIGGRKPVYF
SETB_SALTY      ------LIVAFLTGIAGALQTPTLSILTDEVHARPGMVGFFFTGSAVIGIIVSQFLAGRSDKKGRKKLIV
EDL14_ARATH     --------------------APTQSSIMKDLNLSIADFSFFGSILTVGLILGALICGKLADLVGRVYTIW
YFKF_BACSU      -------------------------------------VAIILPAFAIGSIIFQFPLGILSDKYGRRNVLL
YCT4_SCHPO      --------IAIVITANSSIFSDGGGIAAQQYHVGATVGDLCSATFLLGFAAGSVLFAPLSEVYGRLPLYS
S22A1_MOUSE     -------------------------SIVTEFNLVDAKVDLFQSCVNLGFFLGSLVVGYIADRFGRKXXXX
ERDL7_ARATH     --------------------SPAQAAIRNDLSLTIAEFSLFGSLLTFGAMIGAITSGPIADLVGRKGAMR
YLD2_CAEEL      -----------------------------EFDWDKQTTGMVLSSFFYGYIGSQIIGGHLASRYGGKRVVF
YHM9_SCHPO      ---------------------------ETTHNKSLQDIGMIAYVGTIVG---QLSFGWYSDRFGRKNGMI
YDJE_ECOLI      ----------------------------------------------------SLTGGFIGDYFGRRRAFR
XYLL3_ARATH     ------------------------------FNFSPVQLGLVVSG-SLYGALLGSISVYVADFLGRRRELI
VBA2_YEAST      ----------------------------------------ITTAYLITSTSFQPLYGSFSDALGRRNCLF
SPX2_DANRE      --------------------------------------GVLDNCFLVAYAVGMFFSGIFGERLPLRYYLS
S22A4_HUMAN     ------------------------------------KVPLTTSLFFVGVLLGSFVSGQLSDRFGRKNVLF
NPT3_BOVIN      ----------------------------KEFNTAEVSVGIIFSSINYGIILTLIPSGYLAGIFGAKQMLG
YFIG_BACSU      -----------------------------------------------------------SDRHGRRKTIL
YDFJ_ECOLI      ----------------------------------------------IVGAFI---FGKMGDRIGRKKVLF
YD387_YEAST     ----------------------------------------------------------LADRYGRRITLA
S22A4_PAPAN     ------------------------------------KVPLTTSLFFVGVLLGSFVSGQLSDRFGRKNVLF
PHT47_ORYSJ     --------------------------------VNQANKGMILSMFYYGYVLSQIPGGWAAQRIGGRRVLL
GTR1_PIG        ---------------------------------------LSVAIFSVGGMIGSFSVGLFVNRFGRRNSML
EDL10_ARATH     -------------------------AIMKELDLSMAQFSAFGSFLNLGGAVGALFSGQLAVILGRRRTLW
VACHT_DROME     ----------------------------------DSATGILFASKAIVQLMVNPFSGGLIDKIGYDLPMM
TCMA_STRGA      -------------------------AIQQDLHASLADVQWITNGYLLALAVSLITAGKLGDRFGHRQTFL
S22A6_MOUSE     ----------------------------------------LAQSLFMVGVLLAMMFGYLADRLGRRKVLI
S22A2_HUMAN     -------------------------SIVTEFNLVCANLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCLL
PT113_ORYSJ     -----------------------------------------------------LVFGWLGDKMGRKRVYG
YMPB_CAEEL      -----------------------------------------------IGAVIAVPFSMLADRYGRKPIIV
SOTB_HAEI8      -----------IFNTTEFVPVAMLSDIAQSFDMQTADTGLMMTVYAWTVLIMSLPAMLATGNMERKSXXX
S22A6_RAT       ----------------------------------------LAQSLYMVGVLLAMVFGYLADRLGRRKVLI
PLT2_ARATH      ----------IILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNIYSLIGSGAAGRTSDWIGRRYTIV
PHT19_ARATH     ---------------DLFCIAPIMKMISQIYYHKDS-IGLLSTSYAIATALGQLIFGYLGDRVGRRKVYG
MDTD_YERPY      ---------------DTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASGWLADRIGVKWVFF
MDTD_YERPS      ---------------DTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASGWLADRIGVKWVFF
MDTD_YERPP      ---------------DTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASGWLADRIGVKWVFF
MDTD_YERPN      ---------------DTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASGWLADRIGVKWVFF
MDTD_YERPG      ---------------DTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASGWLADRIGVKWVFF
MDTD_YERPE      ---------------DTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASGWLADRIGVKWVFF
MDTD_YERPB      ---------------DTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASGWLADRIGVKWVFF
MDTD_YERPA      ---------------DTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASGWLADRIGVKWVFF
MDTD_YERP3      ---------------DTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASGWLADRIGVKWVFF
ERDL5_ARATH     --------------------SPVQSDLTKELNLSVAEYSLFGSILTIGAMIGAAMSGRIADMIGRRATMG
YUXJ_BACSU      --------------------------------------GYVFGITFLMAFLVSPFWGRFGDKRGYKKILM
YDHP_ECOLI      ---------------------------------------------------------------------I
YDHP_ECO57      ---------------------------------------------------------------------I
Y1104_HAEIN     ---------------DLLILGFMLSAISADLNLTPAQGGSLVT-WTLIGAVFGILFGALSDKYGRVRVLT
VGLU3_DANRE     -----------------------------QFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFG
SV2B_MOUSE      --LFFVLGLALMADGVEIVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLS
SOTB_PSESM      LGVFALALAAFIFNTTEFVPIGLLSNIGQSFDMTPAQVGLMLTIYAWVVSLMSLPMMLATRNIERRKLLM
SOTB_PSEE4      LSVIALALAAFIFNTTEFVPVALLSDIGRSFDMTTAQVGLMLTIYAWVVALASLPMMLMTRNIEXXXXXX
S22A7_MOUSE     --------------------------IATEWDLVCEQRGLVTSTCFFIGVLLAVVYGYLSDRFGRRRLLL
S17A5_MOUSE     --------------------------------------GWILGSFFYGYIVTQIPGGYIASRVXXXXXXX
PHT12_ORYSJ     ------------------ITKPNPGTLPP--NVSSAVTG-VALCGTLAG---QLFFGWLGDKLGRKSVYG
ARAE_KLEOX      ----------LLFGLDIGVIAGALPFITDHFVLSSRLQEWVVSSMMLGAAIGALFNGWLSFRLGRK----
SOTB_PSEU2      LGVFALALAAFIFNTTEFVPIGLLSNIGQSFEMTPAQVGLMLTIYAWVVSLMSLPMMLATRNIERRKLLM
MOT6_HUMAN      --------------------------LQWEFQASNSETSWFPSILTAVLHMAGPLCSILVGRFGCRVTVM
MDFA_ECOLI      ------------------MIQPGMLAVVEQYQAGIDWVPTSMTAYLAGGMFLQWLLGPLSDRIGRRPVML
MDFA_ECOL6      ------------------MIQPGMLAVVEQYQAGIDWVPTSMTAYLAGGMFLQWLLGPLSDRIGRRPVML
MDFA_ECO57      ------------------MIQPGMLAVVEQYQAGIDWVPTSMTAYLAGGMFLQWLLGPLSDRIGRRPVML
GTR1_HUMAN      --------------------------------------------FSVGGMIGSFSVGLFVNRFGRRNSML
GTR1_BOVIN      ---------------------------------------LSVAIFSVGGMIGSFSVGLFVNRFGRRNSML
EMRY_ECOLI      ----------------------------------------VITSFGVANAIAIPVTGRLAQRIGEXXXXX
EAT4_CAEEL      -----------------------------EFNWTIDELSVMESSYFYGYLVTQIPAGFLAAKFPPNKLFG
VGLU1_RAT       -----------------------------QFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFG
VGLU1_MOUSE     -----------------------------QFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFG
VGLU1_BOVIN     -----------------------------QFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFG
VGL2A_DANRE     -----------------------------KFNWDPETVGLIHGSFFWGYIVTQIPGGYISSRLAANRVFG
TCR_STAES       -SVLFWLCILSFFSVNEMVLNVSLPDIANHFNTTPGITNWVNTAYMLTFSIGTAVYGKLSD-YINXXXXX
TCR_STAAU       -SVLFWLCILSFFSVNEMVLNVSLPDIANHFNTTPGITNWVNTAYMLTFSIGTAVYGKLSD-YINXXXXX
S17A9_MOUSE     -----LLLGTCLLYCARVTMPVCTVAMSQDFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKVIL
MSSP2_ARATH     --------------------------IKKEFNLESSVEGLIVAMSLIGATLITTCSGGVADWLGRRPMLI
ITR1_YEAST      ----------------------------------------IVTAATSLGALITSIFGTAADIFGRKRCLM
ERD6_ARATH      --------------------------ITKDLSLSVAEYSMFGSILTLGGLIGAVFSGKVADVLGRKRTML
Y4XM_RHISN      ----------------------SMGAMEMNGPFWPIQIKALSPSDSVFGSLTSAFWGRMGDRYGNRLMMV
UHPC_SALTY      --------------------------------LTRSDIGLLATLFYITYGVSKFVSGIVSDRSNARYFMG
S22A5_HUMAN     -----------------------LSTIVTEWNLVDWKAPLTISLFFVGVLLGSFISGQLSDRFGRKNVLF
PHT15_ORYSJ     -----------------------------------AAVNGVAFCGTLAG---QLFFGWLGDKMGRKKVYG
PHT14_ORYSJ     -----------------------------------AAVNGVAFCGTLAG---QLFFGWLGDKMGRKKVYG
PHT14_ORYSI     -----------------------------------AAVNGVAFCGTLAG---QLFFGWLGDKMGRKKVYG
MFS10_HUMAN     --------------------------------------GLIGSAFSVLQFLCAPLTGATSDCLGRRPVML
HXT17_YEAST     ------------INMDNFKM--NFGSYKHEYYLSNVRMGLLVAMFSIGCAIGGLIFARLADTLGRRLAIV
GTR2_BOVIN      ---------------------------------------LSVSSFAVGGMIASFFGGLLGDKLGRIKALL
GTR1_RAT        --------------------------------------------FSVGGMIGSFSVGLFVNRFGRRNSML
GTR1_MOUSE      --------------------------------------------FSVGGMIGSFSVGLFVNRFGRRNSML
ERDL8_ARATH     --------------------APTQFGIMEELNLSYSQFSVFGSILNMGAVLGAITSGKISDFIGRKGAMR
EDL16_ARATH     --------------------APTQSSIRQDLNLSLAEFSMFGSILTIGAMLGAVMSGKISDFSGRKGAMR
BCRH_RICPR      -----LLCLFILSPTTETIYTSGLPSLTRCFSI-DGCITQMTSTLYFLGFAVGILLGRLSDIYGRRPIVL
UHPC_ECOLI      --------------------------------LSRSDIGLLATLFYITYGVSKFVSGIVSDRSNARYFMG
S22A2_PONAB     -------------------------SIVTEFNLVCANLDLFQASVNVGFFFGSVSIGYIADRFGRKLCLL
QUTD_EMENI      ----------------------SLQSFQNEFNWESLNTDLISANIVSLGAFFGALFAYIGHFWGRRWGLM
PROP_SALTY      ----------------------------------DPSVQMIAALATLIRPLGGLFFGMLGDKYGRQKILA
HXT13_YEAST     ------------INMDNFKM--NFGSYKHEYYLSNVRMGLLVAMFSIGCAIGGLIFARLADTLGRRLAIV
HIAT1_MOUSE     -----VIVIFLEFFAWGLLTAPTLVVLHETFKHTFLMNGLIQGVKGLLSFLSAPLIGALSDVWGRKSFLL
EDL11_ARATH     -------------------------AIMKELDLSMAQFSAFGSFLNVGGAVGALFSGQLAVILGRRRTL-
YQEH_SCHPO      -----------------------------------SQVSLLGQSMFVLGALGPLFLGPLSDLLGRKLVYI
Y532_BUCBP      -----------------------------------------------------LFTGPLSDSIGRKVVMS
VMAT2_RAT       ----------------------------------NVQVGLLFASKATVQLLTNPFIGLLTNRIGYPIPMF
TCR2_ECOLX      -----IALVITLLDAMGILIMPVLPTLLREFIASED----IANHFGVLLALYALMWGKMSDRFGRRPVLL
S22A1_BOVIN     -------------------------SIVTEFNLVSWKVDLFQSCVNLGFFLGSLGVGYIADRFGRKVXXX
PROP_ECOLI      ----------------------------------DPSVQMVAALATLIRPLGGLFFGMLGDKYGRQKILA
PROP_ECO57      ----------------------------------DPSVQMVAALATLIRPLGGLFFGMLGDKYGRQKILA
MDTM_SALTY      ------------------LIQPGIINVVRDFN-ADVSLAPASVSLYLAGGM-ALQWGPLSDRIGRRPVLI
MDTM_SALTI      ------------------LIQPGIINVVRDFN-ADVSLAPASVSLYLAGGM-ALQWGPLSDRIGRRPVLI
ITR2_YEAST      ---------------------------------------------TSLGALITSVGGTAADVFGRRPCLM
GTR7_HUMAN      ------------------------------------------------------------DSCGRKGTLL
EDL13_ARATH     --------------------SPAQTGIMAGLNLSLAEFSFFGAVLTIGGLVGAAMSGKLADVFGRRGALG
BCR_ECOLI       -AIVFILGLLAMLMPLSIDMYPALPVISAQFGVPAGSTQMTLSTYILGFALGQLIYGPMADSFGRKPXXX
BCRH_RICTY      --VWMLLSLFILSPTTETIYTSGLPSLTKYFSI-DGCITQITSTLYFLGFAVGILLGRLSDIYGRRPIVL
YBFB_BACSU      --------------------------------VTSAAVSLLAG-FNIAGILLS---GIVADRWSSRKILC
S22A6_RABIT     ----------------------------------------LGQSLYMAGVLIAMVFGYLADRLGRRKVLI
PT111_ORYSJ     ----------------------------------------------LVGTLMGLVFGYFGDKLGRKRILM
PHT18_ORYSJ     -----------------------------------------------------LFFGWLGDKLGRKSVYG
NPT3_HUMAN      --------------------------------------GIIFSSINYGIILTLIPSGYLAGIFGAKKMLG
NART_STAHJ      ------------------IISPLMPYISQDVKVNPGQLSIILAIPVILGSILRVPFGYLTNIIGAKWVFF
NANT2_ECOL6     ---------------DFVLISLVLTEVQHEFGLTTIEAASLISAAFISRWFGGLAIGALSDKMGRRMAMV
MFS10_MOUSE     --------------------------------------GLIGSAFSLLQFFSAPLTGAASDYLGRRPVMM
HXT1_YEAST      --------------------------------LSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRGLXX
HIAT1_HUMAN     -----VIVIFLEFFAWGLLTAPTLVVLHETFKHTFLMNGLIQGVKGLLSFLSAPLIGALSDVWGRKSFLL
GTR7_RAT        ------------------------------------------------------------DSCGRKGTLL
GTR2_HUMAN      -------------------MNPKPTPWAEEETVAAAQLSLSVSSFAVGGMTASFFGGWLGDTLGRIKAML
GALP_ECOLI      --------------------------IADEFQITSHTQEWVVSSMMFGAAVGAVGSGWLSFKLGRKKSLM
GALP_ECOL6      --------------------------IADEFQITSHTQEWVVSSMMFGAAVGAVGSGWLSFKLGRKKSLM
YCAD_SALEP      -------------------------------NLPTWQVGMVSSSYFTGNLVGTLFTGYLIKRIGFNRSYY
YCAD_ESCF3      ------------------------------------QVGMVSSSYFTGNLVGTLLTGYLIKRLGFNRSYY
Y466_BUCAI      -------------------------------------IGLSMGIYGISQVIFQIPFGILSDKFNRKKIIL
VGLU1_HUMAN     -----------------------------QFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFG
SPX2_BOVIN      ----------------------------------------------------------------------
SOTB_PASMU      --VITFALAGFVFNTTEFIPVALLSDIAQSFAMPVSQTGLIITVYAWVVSLMSLPFMLLTAKAERRGXXX
S22A3_MOUSE     -------------------------------------LGFLAGAFTL---------GYAADRYGRLIIYL
RAG1_KLULA      --------------------------------LSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRRXXXX
PT112_ORYSJ     --------------------SPTPGSLPP--NIAAAVNG-VALCGTLSG---QLFFGWLGDKLGRKSVYG
ORCT_DROME      -------------------------------------LSATSDSLFMLGVLLSLIFGQMSDKLGRKPTFF
MDTD_YERE8      ----------------------------------------VIVSYVLTVAVMLPASGWLADRVGVKWVFF
VGLU2_RAT       -----------------------------KFNWDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFG
VGLU2_MOUSE     -----------------------------KFNWDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFG
VGLU2_HUMAN     -----------------------------KFNWDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFG
VGLU2_BOVIN     -----------------------------KFNWDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFG
STP5_ARATH      ------------------------------------------SSLYVAGLVASLVASRLTAAYGRRTTMI
S22AC_MOUSE     ----------------------------------------MAQSIFLAGILVAAVCGHASDRFGRRRVLT
S22A3_RAT       -------------------------------------LGFLAGAFTL---------GYAADRYGRLIVYL
S22A2_RABIT     -------------------------SIVTEFNLVCARLDLFQSAVNIGFFIGSVGIGYLADRFGRKLCLL
S226B_XENLA     ----------------------------------------VAQSIYMAGVLVSILFGGLSDKFGRRPLNI
LPLT_PHOLL      --------------------------------------------FVLAYILLAPFVGQIADRFPKDRVML
HSRA_ECOLI      ---------------DATILNTALPAIAHSLNRSPLAMQSAIISYTLTVAMLIPVSGWLADRFGTRRIFT
EDL15_ARATH     --------------------APTQTSIMKDLNLSIADYSLFGSILTVGLILGALICGKLTDLVGRVKTIW
YCAD_SALG2      -------------------------------NLPTWQVGMVSSSYFTGNLVGTLFTGYLIKRIGFNRSYY
YCAD_SALDC      -------------------------------NLPTWQVGMVSSSYFTGNLVGTLFTGYLIKRIGFNRSYY
XYLL1_ARATH     --------------------SPTLSGISW-YDLSSVDVGIITSG-SLYGALISIVAFSVADIIGRRKELI
UHPT_CHLPN      -----------------------------------AQLGIIGSTLYFSYGISKFVSGVMSDQSNPRYFMA
SPX2_MOUSE      -------------------------------------LGAVDNAFLVAYAIGMFISGIFGERLPLRYYLS
SPX2_HUMAN      ----------------------------------------------------------------------
S22A7_PIG       --------------------------IATEWDLVCEQKGLATSTFFFAGVLVGAVFGYLSDRFGRRRXXX
MMR_STRCO       ----------VMATLDVTVVNVAGATIQESLDTTLTQLTWIVDGYVLTFASLLMLAGGLANRIGAKTVYL
LMRB_BACSU      ----------------------------KELNITAATVQWLTTGYLLVLGILVPVSGLLLQWFTTRQLFT
HXT9_YEAST      ------------------------------YYLSKVRMGLIVSIFNIGCAIGGIVLSKVGDIYGRRIGLI
HXT11_YEAST     ------------------------------YYLSKVRMGLIVSIFNIGCAIGGIVLSKVGDIYGRRIGLI
GTR1_RABIT      --------------------------------------------FSVGGMIGSFSVGLFVNRFGRRNSML
YMFD_BACSU      --IIALSSVPLVMTLGNSMLIPVLPMMEKKLSVTSFQVSLIITVYSVVAIICIPIAGYLSDRFGRKKILL
YJ94_YEAST      -------------------------------NMTEDKIGLFMSLTLAGDVICSYILTWYADSWGRRRVLV
YHD3_SCHPO      --IVFVFILMTQAGLGQSIAPNNI--IGKSLGTTNGQLSWFPASYSLTVGTFILIAGRLGDIYGHKKMFV
YDER_BACSU      -----------IIVANLYYAQPLVGLISKAIGLSPSGAGLIVT-LTQIGYVAGLLFLVLGDIIENKKLIV
YCAD_SALPB      -------------------------------NLPTWQVGMVSSSYFTGNLVGTLFTGYLIKRIGFNHSYY
YAN6_SCHPO      ----------------------------------------IGTAYTLAQTSILPFCGIMSEVVGRKIVLY
TCR8_PASMU      -SIIIILLITVLDAIGIGLIMPVLPTLLNEFNSLATHYGVLLALYATMQVIFAPILGRLSDKYGRKPILL
S22A7_BOVIN     --------------------------IATEWDLVCEQKGLAISTFFFAGVLVGAVYGYLSDRFGRRRXXX
S22A2_PIG       -------------------------SIVTEFDLVCANLDLFQSAVNVGFFIGSVGIGYIADRFGRKLCLL
PHT16_ORYSJ     --------------------SPSPGTLPPHVS---ASVNGVAFVGTLSG---QLFFGWLGDKLGRKRVYG
PHT11_ORYSJ     -------------------------------NVSAAVTG-VALCGTLAG---QLFFGWLGDKLGRKSVYG
MDTD_SERP5      ----------------------------------------VIVSYVLTVAVMLPASGWLADRVGVQRVFF
HXT3_YEAST      ------------------------------YYLSKVRTGLIVSIFNIGCAIGGIILAKLGDMYGRKGLXX
YCAD_SALTY      -------------------------------NLPTWQVGMVSSSYFTGNLVGTLFTGYLIKRIGFNRSYY
YCAD_SALTI      -------------------------------NLPTWQVGMVSSSYFTGNLVGTLFTGYLIKRIGFNRSYY
YCAD_SALSV      -------------------------------NLPTWQVGMVSSSYFTGNLVGTLFTGYLIKRIGFNRSYY
YCAD_SALPK      -------------------------------NLPTWQVGMVSSSYFTGNLVGTLFTGYLIKRIGFNRSYY
YCAD_SALPC      -------------------------------NLPTWQVGMVSSSYFTGNLVGTLFTGYLIKRIGFNRSYY
YCAD_SALPA      -------------------------------NLPTWQVGMVSSSYFTGNLVGTLFTGYLIKRIGFNRSYY
YCAD_SALNS      -------------------------------NLPTWQVGMVSSSYFTGNLVGTLFTGYLIKRIGFNRSYY
YCAD_SALHS      -------------------------------NLPTWQVGMVSSSYFTGNLVGTLFTGYLIKRIGFNRSYY
YCAD_SALCH      -------------------------------NLPTWQVGMVSSSYFTGNLVGTLFTGYLIKRIGFNRSYY
YCAD_SALA4      -------------------------------NLPTWQVGMVSSSYFTGNLVGTLFTGYLIKRIGFNRSYY
Y2171_CITK8     ------------------------------------QVGMVSSSYFTGNLVGTLLTGYLIKRLGFNRSYY
VGL2B_DANRE     -----------------------------KFNWDPETVGMIHGSFFWGYTVTQIPGGYISSRLAANRVFG
TUB3_AGRVI      ----------------------------------------------------------------------
S22FL_XENLA     ----------------------------------------LASSLFFAGLLIGNVFGPLSDKLGRRPVLF
PCFT_XENLA      ----------------------------------------------LVGLFSVMLLGPWSDKVGRRPVLM
MDTD_SHIF8      ---------------DTTIVNTAIPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
GLPT_HUMAN      -------------------------------------LGALDYSFLCAYAVGMYLSGIIGERLPIRYYLT
YCAD_SALAR      ------------------------------------QVGMVSSSYFTGNLVGTLFTGYLIKRIGFNRSYY
YBN1_SCHPO      --------------------------------------GLVNASANIGNIFGQLLFGFMGDFFGRK--FV
YB91_YEAST      --------------------------LKQCIALTDSQYGAITSIFSIGGLFGSYYAGNWANRYGRKYVSM
TUB4_AGRVI      ----------------------------------------------------------------------
SPX2_XENLA      -------------------------------------LGSLDTAFLVSYAIGMFFSGIFGERLPLRYYLS
S22A6_MACFA     ----------------------------------------LAQSLYMVGVLLAMVFGYLADRLGRRKVLI
PHT13_ORYSJ     -----------------------------------AAVNGVALCGTLAG---QLFFGWLGDKLGRKSVYG
PBUE_BACSU      ----------------ELIVGGILPQIANDLDISIVSAGQLISVFALGYAVSGPLLLALTAKIERKRLYL
MDTD_ESCF3      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
HXT16_YEAST     ------------INMDNFKM--NFGSYKHEYYLSNVRMGLLVAMFSVGCSIGGVAFARLADTLGRRLAIV
HXT15_YEAST     ------------INMDNFKM--NFGSYKHEYYLSNVRMGLLVAMFSVGCSIGGVAFARLADTLGRRLAIV
GTR7_MOUSE      ----------------------------------------------------------MVNKWGRKGLLI
GTR2_MOUSE      ---------------------------------------LSVSSFAVGGMVASFFGGWLGDKLGRIKAML
GTR2_CHICK      -------------------VSPHILTMYWSLSVSMFAVGGMVSSFTV---------GWIGDRLGRKAMLV
YI32_SCHPO      ------------------------------------------SSYSWIGTAYSLACGIMSEVVGRKIVLY
SOTB_PSEA7      LSVIALALAAFIFNTTEFVPVGLLSDIGHSFDMPTSQVGLMLTIYAWVVSLASLPMMLLTRNIERRKLLV
SETA_ECOLI      -------------------------------------IGLFYTVNAIAGIGVSLWLAKRSDSQGRRKLII
S22AL_MOUSE     ----------------------------------------LTTSFFYVGVLLSFISGQLSDRFGRKNILF
S22A6_PONAB     ----------------------------------------LAQSLYMVGVLLAMVFGYLADRLGRRKVLI
MDTD_SHISS      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_SHIFL      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_SHIBS      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_SHIB3      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ERWCT      ---------------DTTIVNTALPSMAASLNESPLHMHSVIVSYVLTVAVMLPASGWLADRIGVKNIFF
MDTD_ECOUT      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECOSM      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECOSE      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECOLU      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECOLI      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECOLC      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECOL6      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECOL5      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECOK1      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECOHS      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECODH      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECOBW      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECO8A      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECO81      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECO7I      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECO5E      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECO57      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECO55      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECO45      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECO27      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
MDTD_ECO24      ---------------DTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASGWLADKVGVRNIFF
GTR2_RAT        ---------------------------------------LSVSSFAVGGMVASFFGGWLGDKLGRIKAML
Y1317_METJA     -------------------------------------------------ATFSIPFGILSDKIGRKSVLT
SPX3_CHICK      -------------------------------------LGTLDTIFLFSYAVGLFVSGIVGDRLNLRWVLS
S22AA_HUMAN     ----------------------------------------VVQFLLLTGMLVGIIGGHVSDRFGRRFILR
QAY_NEUCR       ------------------------------------------------GCLFAYATSYFLGR--RKSLIA
GTR1_CHICK      ---------------------------------------LSVAIFSVGGMIGSFSVGLFVNRFGRRNSML
CF192_HUMAN     ----------------------------EKFNLPAGYVGLVFLGMALSYAISSPLFGLLSDKRPRKWLLV
VMAT2_HUMAN     ----------------------------------NVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIF
VGLU1_XENLA     -------VAIVSMVNNNTVYKGNKLVIEQQFNWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFG
SPX2_XENTR      -------------------------------------LGSLDTAFLVSYAIGMFFSGIFGERLP----LR
SOTB_PSEAE      LSVIALALAAFIFNTTEFVPVGLLSDIGHSFEMPTSQVGLMLTIYAWVVSLASLPMMLLTRNIERRKLLV
SOTB_PSEAB      LSVIALALAAFIFNTTEFVPVGLLSDIGHSFEMPTSQVGLMLTIYAWVVSLASLPMMLLTRNIERRKLLV
SOTB_PSEA8      LSVIALALAAFIFNTTEFVPVGLLSDIGHSFEMPTSQVGLMLTIYAWVVSLASLPMMLLTRNIERRKLLV
SOTB_ERWCT      LRVVSLSLAAFIFNTAEFAPVALLSDIAASFSMSAAQVGLIITIYAWVVGLMSLPCMLLSSDMERRSLLI
S22AC_RAT       ----------------------------------------MAQSIFLAGILVAAVCGHASDRFGRRRVLT
S22A6_HUMAN     ----------------------------------------LAQSLYMVGVLLAMVFGYLADRLGRRKVLI
S226A_XENLA     -----------------------------------------------------------SDRYGRRALLI
PROP_STAAW      -----------------------------------------------------VVFGIIGDKYGRKVVLT
PROP_STAAS      -----------------------------------------------------VVFGIIGDKYGRKVVLT
PROP_STAAR      -----------------------------------------------------VVFGIIGDKYGRKVVLT
PROP_STAAN      -----------------------------------------------------VVFGIIGDKYGRKVVLT
PROP_STAAM      -----------------------------------------------------VVFGIIGDKYGRKVVLT
PROP_STAAC      -----------------------------------------------------VVFGIIGDKYGRKVVLT
PROP_STAA1      -----------------------------------------------------VVFGIIGDKYGRKVVLT
PLST3_ARATH     --------------------------------------GLVVSTCLGGAFIGSLFSGLVADGVGRRRAFQ
OXLT_OXAFO      -------------------------------------LGLAAGVLTIGVSIQNLFWGFVSDKIGRYKTMS
NEPI_SALPK      ----------------------------QDLGISEGVAGQSVTVTAFVAMFSSLFITQIIQATDRRYIVI
NEPI_SALPA      ----------------------------QDLGISEGVAGQSVTVTAFVAMFSSLFITQIIQATDRRYIVI
MFSD9_MOUSE     --------------------------------------GIVGSSYGVLQLFSSTFVGCWSDVVGRRSSLL
ERDL2_ARATH     --------------------SPAQSKIMEELGLSVADYSFFTSVMTLGGMITAVFSGKISALVGRRQTMW
YHD1_SCHPO      --------------------------------------GLVNAASNIGNIFGQLMFGFMGDFFGRK--FV
SPX3_HUMAN      -------------------------------------LGTLDTIFLFSYAVGLFISGIVGDRLNLRWVLS
S22A6_PIG       ----------------------------------------LAQSLYMVGVLLAMIFGYLANRLGRRKVLI
QAY_NEUTR       ----------------------------------------------------------------RKSLIA
PHT17_ARATH     -----------------------------------AAVNGVAFCGTLAG---QLFFGWLGDKLGRKKVYG
GTR11_HUMAN     ----------------------------------------------------------------KKSLLV
GIT1_YEAST      -------------------------------------------------ALVGIIFGQFADYYSRKSCIL
ANTR5_ARATH     --------------------------------INQSSKGTILSTFFVGYACSQVPGGWAAQKIGGRKVLL
YBJJ_ECOLI      ---------------------------------------LIYAGFTLGMTVGRFTGGWFIDRYSRVAVVR
VMAT2_BOVIN     ----------------------------------NVQVGLLFASKATVQLLTNPFIGLLTNRIGYPIPMF
TPPB_ECOLI      ----------------------------KQLGMSEADSITLFSSFSALVYGLVAIGGWLGDKVGTKRVIM
TPPB_ECOL6      ----------------------------KQLGMSEADSITLFSSFSALVYGLVAIGGWLGDKVGTKRVIM
TPPB_ECO57      ----------------------------KQLGMSEADSITLFSSFSALVYGLVAIGGWLGDKVGTKRVIM
PROP_STAHJ      -----------------------------------------------------IVFGIIGDKYGRKVVLT
PHT15_ARATH     -----------------------------------------------------LFFGWLGDKLGRKKVYG
YCAD_SHIFL      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_SHIF8      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
PROP_STAEQ      -----------------------------------------------------IVFGIIGDKYGRKIVLT
NEPI_SALTY      ----------------------------QDLGISEGVAGQSVTVTAFVAMFSSLFITQIIQATDRRYIVI
NEPI_SALTI      ----------------------------QDLGISEGVAGQSVTVTAFVAMFSSLFITQIIQATDRRYIVI
NEPI_SALPC      ----------------------------QDLGISEGVAGQSVTVTAFVAMFSSLFITQIIQATDRRYIVI
NEPI_SALPB      ----------------------------QDLGISEGVAGQSVTVTAFVAMFSSLFITQIIQATDRRYIVI
NEPI_SALCH      ----------------------------QDLGISEGVAGQSVTVTAFVAMFSSLFITQIIQATDRRYIVI
MDTG_CITK8      --------------------------------------GMIASVPGVAALLSAPRLGKLGDRIGPEKILI
HXT7_YEAST      --------------------------------LSKVRTGLIVSIFNIGCAIGGIILSKLGDMYGRKGLXX
HXT6_YEAST      --------------------------------LSKVRTGLIVSIFNIGCAIGGIILSKLGDMYGRKGLXX
HXT4_YEAST      ------------------------------YYLSKVRTGLIVSIFNIGCAIGGIILAKLGDMYGRKGLXX
EDL17_ARATH     --------------------------VMKDLDLSIAQFSAFGSFATLGAAIGALFCGNLAMVIGRRGTMW
YM8M_YEAST      MFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLI
YDJK_ECOLI      --------------------------------------------------LGALVGGIIGDKTGRRNAFI
S22AO_PONAB     ---------------------------------------MVQSLFMAGSLLGGLIYGHLSDRVGRKIICK
PHT11_ARATH     -----------------------------------------------------LFFGWLGDKLGRKK--V
OCT1_CAEEL      --------------------STYLDSLVTEFNLVQAWIEISTTSFYVGSFIGNCLFGYVADKFGRRRSFF
NPT1_HUMAN      ------LTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYGIILSSTSYGVIIIQVPVGYFSGIYSTKKMIG
NEPI_SALG2      ----------------------------QDLGISEGIAGQSVTVTAFVAMFSSLFITQIIQATDRRYIVI
NEPI_SALEP      ----------------------------QDLGISEGIAGQSVTVTAFVAMFSSLFITQIIQATDRRYIVI
GTR3_MOUSE      ---------------------------------------LCVAIFSVGGMIGSFSVGLFVNRFGRRNMLL
ANTR6_ARATH     -------LAFVICNMDKVNLSIAIIPMSHQFGWSSSVAGLVQSSFFWGYALSQLPGGWLSKIFGGRKVLE
YCAD_ECOUT      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECOL6      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECOL5      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECOK1      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECO81      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECO45      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
Y411_BUCBP      --------------------------------------------------------GWLSDKYGQKLIIN
STP12_ARATH     ---------------------------------------------------------------------I
SPX3_MOUSE      -------------------------------------LGTLDTVFLFSYAVGLFISGIIGDRLNLRWVLS
QAY_NEUAF       ----------------------------------------------------------------RRSLIA
PHT13_ARATH     -----------------------------------AAVNGVALCGTLAG---QLFFGWLGDKLGRKKVYG
PHT12_ARATH     -----------------------------------------------------LFFGWLGDKLGRKK--V
GTR14_HUMAN     ---------------------------------------LSVAIFSVGGMIGSFSVGLFVNRFGRRNMLI
BCRH_RICBR      -----LLCLFTLSPITETIYTSGLPSITEYFN-TDGSTTQITSSLYYLGALGILTLGRLSDIYGRRPVVL
YKH4_CAEEL      -------------------------------------------SGTFWGSLITVLPSFFIERFSPRHVLQ
YJDL_ECOLI      ------------------------------------------SAYASLVYVTPILGGWLADRLNRTAVIA
YHA8_SCHPO      -------LLVVCSAFGSSVIAGDLEDVSRDLKVGPEVANLSCSLMVVGFGIGPLVISPLSEMIGRRTLMI
YFNC_BACSU      --LIIIGICHMLNDSLQAVIPAMFPILERSMSLTFTQLGIIAFTLNMVSSVMQPVVGWYTDKRPRPYALP
YCAD_SHISS      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_SHIDS      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECOSM      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECOSE      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECOLU      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECOLI      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECOLC      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECOHS      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECODH      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECOBW      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECO8A      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECO7I      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECO5E      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECO57      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECO55      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECO27      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
YCAD_ECO24      ------------------------------------QVGVVSSSYFTGNLVGTLLTGYVIKRIGFNRSYY
VGLU3_HUMAN     -----------------------------QFNWDPETVGLIHGSFFWGYIMTQIPGGFISNKFAANRVFG
SPX3_BOVIN      -------------------------------------LGMLDTIFLFSYAVGLFISGIVGDRLNLRWVLS
S22A5_MOUSE     ----------------------------------DWKAPLTTSLFFVGVLMGSFISGQLSDRFGRKNVLF
MFS10_BOVIN     --------------------------------------GLIGSVFSLLQFLSAPLTGALSDCLGRRPGML
FTSK_CHLTE      ----------------------------------------------------------------------
ENB1_YEAST      -----------------------------------SQVGSINTVKSIVASVVAVPYARISDRFGRIECWI
EMRD_ECOLI      ----------------QTIYIPAIADMARDLNVREGAVQSVMGAYLLTYGVSQLFYGPISDRVGRRPVIL
CMLR_STRLI      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YSILVGEIPCLMSAFSRSYGELFFWRALTGIGVGASFPIVYSMIGDMFDEVKRGKVVALISSAISIGSVL
SPNS1_XENTR     IGISFWSLVTLLSSFSKQYFWLFLTRGLVGVGEASYSTIAPTIIADLFLADQRSRMLSFFYFATPVGCGL
EXUT_BACSU      VAMVVWSLFSGAVALAFGFVSLLIIRILFGMGEGPLSATINKMVNNWFPPTQRASVIGVTNSGTPLGGAI
SPNS1_XENLA     VGISFWSLVTLLSSFSNQYFWLFITRGLVGVGEASYSTIAPTIIADLFLADQRTRMLSFFYFATPVGCGL
YIM0_YEAST      WAILAYFCACIGLACAHNYAQILALRCLQAAGISPVIAINSGIMGDVTTKVERGGYVGLVAGFQVVGTAF
SPIN_DROME      VGVGLWSTTTLLGSFMKQFGWFIAFRALVGIGEASYSTIAPTIISDLFVHDMRSKMLALFYFAIPVGSGL
YOU1_CAEEL      FSTLVACIMGVISGMSPHFYVLLFFRGLTGFGIG-GVPQSVTLYAEFLPTAQRAKCVVLIESFWAIGAVF
SPNS3_DANRE     VGLVMWIVTTLGSSFVRKFWVLVATRALVGTGEASYSTIAPTIIGDLFAGSKRTLMISFFYIFIPVGSGL
PCAK_ACIAD      MSMLVFGGFTLACAYSTNLDSLVIFRFLTGIGLGAAMPNATT----LFSEYCPARIRSLLVTCMFCGYNL
MDTL_SALTY      VGALVFMMASLLCSRA-SEGSLFLGRFLQGVGAGGCYVVAFAILRDTLDEHRRAKVLSLLNGITCIVPVL
MDTL_SALPB      VGALVFMMASLLCSRA-SEGSLFLGRFLQGVGAGGCYVVAFAILRDTLDEHRRAKVLSLLNGITCIVPVL
MDTL_SALNS      VGALVFMMASLLCSRA-SEGSLFLGRFLQGVGAGGCYVVAFAILRDTLDEHRRAKVLSLLNGITCIVPVL
MDTL_SALHS      VGALVFMMASLLCSRA-SEGSLFLGRFLQGVGAGGCYVVAFAILRDTLDEHRRAKVLSLLNGITCIVPVL
MDTL_SALA4      VGALVFMMASLLCSRA-SEGSLFLGRFLQGVGAGGCYVVAFAILRDTLDEHRRAKVLSLLNGITCIVPVL
MUCK_ACIAD      ISILTFSILTCGLGLTQSFIQFGVLRFFASLGLGSLYIACNTLMAEYVPTKYRTTVLGTLQAGWTVGYIV
MDTL_SALEP      VGAIVFMMASLLCSRA-SEGSLFLGRFLQGIGAGGCYVVAFAILRDTLDEHRRAKVLSLLNGITCIVPVL
MDTL_SALDC      VGAIVFMMASLLCSRA-SEGSLFLGRFLQGIGAGGCYVVAFAILRDTLDEHRRAKVLSLLNGITCIVPVL
MDTL_SALAR      VGAIVFMMASLLCS-QATEGSLFLGRFLQGVGAGSCYVVAFAILRDTLDERRRAKVLSLLNGITCIVPVL
YITG_BACSU      YXXXXXXXXXXXXXXDNAYPWVMAGRALQGIGAAGTGPIAMALTGDLFKGAQESKVLGLVEASNGMGKVL
MDTL_SALTI      VGAIVFMMASLLCSRA-SEGSLFLGRFLQGVGAGGCYVVAFAILRDTLDEHRRAKVLSLLNGITCIVPVL
MDTL_SALSV      VGALVFMTASLLCSRA-SEGSLFLGRFLQGVGAGGCYVVAFAILRDTLDEHRRAKVLSLLNGITCIVPVL
MDTL_SALPK      VGAIVFMMASLLCSRA-SEGSLFLGRFLQGVGAGGCYVVAFAILRDTLDEHRRAKVLSLLNGITCIVPVL
MDTL_SALPA      VGAIVFMMASLLCSRA-SEGSLFLGRFLQGVGAGGCYVVAFAILRDTLDEHRRAKVLSLLNGITCIVPVL
MDTL_SALPC      VGAIVFMMASLLCSRA-SEGSLFLGRFLQGIGAGGCYVVAFAILRDTLDEHRRAKVLSLLNGITCIVPVL
MDTL_SALCH      VGAIVFMMASLLCSRA-SEGSLFLGRFLQGIGAGGCYVVAFAILRDTLDEHRRAKVLSLLNGITCIVPVL
YYBF_BACSU      ISMLAASVLCLASAFSPSFHTLLVLRTIQGVALAGLPSIAMAYLGEEIEPGSLGSAMGLYISGNAIGAVF
SPNS1_DANRE     VGIFFWSVVTLASSF---IGKDHFWRGLVGVGEASYSTIAPTIIADLFVKEKRTNMLSIFYFAIPVGSGM
BMR3_BACSU      XXXXXXXXXSALCGIAQTMNQLIIFRAIQGIGGGALLPIAFTIIFDLFPPEKRGKMSGMFGAVFGLSSVL
SVOP_PONAB      ISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGG-VPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVF
SVOP_HUMAN      ISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGG-VPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVF
SVOP_BOVIN      ISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGG-VPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVF
MDTL_KLEP3      XXXXXXXXXSLLCAQAHASSHFLVGRFIQGIGAGSCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_KLEP7      XXXXXXXXXSLICAQVHTSSHFLIGRFIQGIAAGSCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
ANTR3_ARATH     WGVALWSLATLLTPWAAAHSTLALLRAFFGLAEGVAMPSMTTLLSRWFPMDERASAVGISMAGFHMGNVV
NANT_YERPY      ISIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKASGFLISGFSIGAVL
MDTL_VIBPA      VGAMIFVLASFLGGMAEQPNTFLIARFCQGIGAGSCYVVAFAILRDTLDDERRAKVLSMLNGITCIIPVI
NANT_YERPS      TSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKASGFLISGFSIGAVL
NANT_YERPP      TSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKASGFLISGFSIGAVL
NANT_YERPG      TSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKASGFLISGFSIGAVL
NANT_YERPB      TSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKASGFLISGFSIGAVL
NANT_YERP3      TSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKASGFLISGFSIGAVL
GUDP_BACSU      LSIFFWSFFTLLQGAIGFFSALFALRFLVGLSEAPSFPGNGRVVASWFPSSERGTASAFFNSAQYFAIVI
SPNS3_MOUSE     FGILLWSGAGLSSSFSYQYSWLFFLRGFVGTGAASYSTIAPTVLGDLFVKDQRTCALAVFYIFIPVGSGL
SPNS3_HUMAN     FGILLWSGAGLSSSFSPRYSWLFFLRGIVGTGSASYSTIAPTVLGDLFVRDQRTRVLAVFYIFIPVGSGL
MDTL_ECOSE      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_ECOLI      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_ECODH      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_ECOBW      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_ECO55      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
SV2C_HUMAN      ICMSVNGFFAFLSSFVQGYGFFLFCRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIY
MDTL_ESCF3      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_SHISS      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_SHIFL      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_SHIDS      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_SHIBS      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_SHIB3      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_ECOUT      PGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_ECOLC      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_ECOK1      PGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_ECOHS      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_ECO5E      PGAALFIITSVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_ECO57      PGAALFIITSVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_ECO45      PGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
VACHT_DANRE     IGLLVMFLSTCIFAFAENYGTLFAARSLQGLGSAFADTSGIAMIADKFEEAERSRALGIALAFISFGSLV
TCRB_BACSU      FGIMVNGLGSIIGFVGHSFFPLILARFIQGIGAAAFPALVMVVVARYIPKENRGKAFGLIGSLVAMGEGV
SPNS2_XENTR     SGIFFWSAITFSSSF---IPKKYFWRGLVGIGEASYSTIAPTIIGDLFTKNTRTLMLSVFYFAIPLGSGL
PHDK_NOCSK      VGFVLF---CLATAGLGLTGDIHSFAALRIIGLGAVMPVALTIVADWMPKARRAQMVSIAFAGVGVGSII
MDTL_ECOL5      PGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_ECO27      PGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
ANTR2_ARATH     XXXXWWSFATIMTPIAARLGLPFLLRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSLALVYSGMYLGSVT
PHT43_ORYSJ     YGVALWSLATFLSAAARSLWLFLSTRVLLGMAEGVALPSMNNMVLRWFPRTERSSAVGIAMAGFQLGNTI
MDTL_ECO7I      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
YIM1_YEAST      VAIVIYFGACIGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMGDVTTRAERGGYVGYVAGFQVLGSAF
SVOP_XENLA      ISVIWTLYYGILSAFAPVYSWILVLRGLVGFGIGG-VPQSVTLYAEFLPMKSRAKCILLIEIFWALGTVF
SOTB_SHISS      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_SHIFL      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_SHIF8      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_SHIBS      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_SHIB3      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECOSM      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECOSE      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECOLU      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECOLI      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECOLC      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECOHS      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECODH      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECOBW      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECO8A      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECO7I      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECO5E      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECO57      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECO55      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECO24      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
MDTL_ECOSM      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_ECOLU      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
TPO3_YEAST      VSMVIFNIPC---ALAPNLGSLLACRFLCGVWSSSGLCLVGGSIADMFPSETRGKAIAFFAFAPYVGPVV
MDTL_ECOL6      PGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_ECO8A      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_ECO81      PGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
MDTL_ECO24      PGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
GARP_ECOLI      YSLFFWSLFTFLQGFVDMFPSMFFMRFMLGFSEAPSFPANARIVAAWFPTKERGTASAIFNSAQYFSLAL
GARP_ECO57      YSLFFWSLFTFLQGFVDMFPSMFFMRFMLGFSEAPSFPANARIVAAWFPTKERGTASAIFNSAQYFSLAL
SV2C_RAT        ICMSVNGFFAFLSSFVQGYGFFLLCRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIY
SV2B_HUMAN      MSLAVNASFASLSSFVQGYGAFLFCRLISGIGIGGALPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGLY
MDTL_CITK8      XXXXXXXXXSMLCSRATDGSLFLTGRFIQGIGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIVPVL
VBA5_YEAST      LAILIFEAGSLIAALASSMNMLIFGRVVAGVG-GSGLQTLCFVIGTMVGERSRPLVISILSCAFAVAAIV
SV2C_MOUSE      ICMSVNGFFAFLSSFVQGYGFFLVCRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIY
PHT41_ORYSJ     FGVIWWSIATALTPFAAKLGLPFLLRAFMGVGEGVAMPAMNNILSKWVPVSERSRSLALVYSGMYLGSVT
NANT_YERPE      TSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKASGFLISGFSIGAVL
NANT_YERPA      TSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKASGFLISGFSIGAVL
NANT_SALTY      SSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_SALTI      SSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_SALSV      SSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_SALPK      SSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_SALPC      SSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_SALPB      SSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_SALPA      SSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_SALNS      SSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_SALHS      SSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_SALG2      SSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_SALEP      SSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_SALDC      SSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_SALCH      SSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_SALAR      SSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
ANTR1_ARATH     FGVIWWSIATILTPVAAKLGYLLVVRAFMGVGEGVAMPAMNNILSKWVPVQERSRSLALVYSGMYLGSVT
VACHT_RAT       IGLGVMFASTVMFAFAEDYATLFAARSLQGLGSAFADTSGIAMIADKYEEPERSRALGVALAFISFGSLV
TPO2_YEAST      VSMVIFNIPC---ALAPNLGCLLACRFLCGVWSSSGLCLVGGSIADMFPSETRGKAIAFFAFAPYVGPVV
SPNS1_HUMAN     GGIAFWSLVTLGSSFIP--GE-HFWXXXXXXXXXXXXEASYSLIADLFVADQRSRMLSIFYFAIPVGSGL
MDTM_ECO57      TGALIFTLACAATMFTTSMTQFLIARAIQGTSICFIATVGYVTVQEAFGQTKGIKLMAIITSIVLIAPII
MDTL_SHIF8      PGSALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVL
AQR1_YEAST      AGMLIYVIASIGLACAPSYGVIIFLRCIQSIGISPTIAISSGVVGDFTLKHERGTFVGATSGFVLLGQCF
SPNS1_RAT       GGIAFWSLVTLGSSF---IPREHFWXXXXXXXXXXXXEASYSLIADLFVADQRSRMLSIFYFAIPVGSGL
SPNS1_MOUSE     GGIAFWSLVTLGSSF---IPREHFWXXXXXXXXXXXXEASYSLIADLFVADQRSRMLSIFYFAIPVGSGL
SOTB_ECOUT      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECOL6      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECOL5      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECOK1      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECO81      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECO45      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
SOTB_ECO27      CLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVL
YWOD_BACSU      FGLILVAVSAIGAPFAPTFMTLLVMRLFQSVGSSAIYPSGVGLIRNHIHE-RQASALAVLSIFASAMTAL
SOTB_SALTY      YLFVLFIASHVLSFLAWNFTVLVISR----IGIAFAHAIFWSITASLAIRLKRAQALSLIATGTALAMVL
SOTB_SALNS      YLFVLFIASHVLSFLAWNFTVLVISR----IGIAFAHAIFWSITASLAIRLKRAQALSLIATGTALAMVL
VACHT_HUMAN     IGLGVMFASTVLFAFAEDYATLFAARSLQGLGSAFADTSGIAMIADKYEEPERSRALGVALAFISFGSLV
NANT_CITK8      TSIILFSMGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
MDTM_ECOLI      TGALIFTLACAATMFTTSMTQFLIARAIQGTSICFIATVGYVTVQEAFGQTKGIKLMAIITSIVLIAPII
VACHT_MOUSE     IGLGVMFASTVMFAFAEDYATFFAARSLQGLGSAFADTSGIAMIADKYEEPERSRALGVALAFISFGSLV
TCR_STRPN       FGIIINCFGSVIGFVGHSFFSLLIMRFIQGAGAAAFPALVMVVVARYIPKENRGKAFGLIGSIVAMGEGV
TCR_BACSU       FGIIINCFGSVIGFVGHSFFSLLIMRFIQGAGAAAFPALVMVVVARYIPKENRGKAFGLIGSIVAMGEGV
TCR_BACST       FGIIINCFGSVIGFVGHSFFSLLIMRFIQGAGAAAFPALVMVVVARYIPKENRGKAFGLIGSIVAMGEGV
TCR_BACCE       FGIIINCFGSVIGFVGHSFFSLLIMRFIQGAGAAAFPALVMVVVARYIPKENRGKAFGLIGSIVAMGEGV
SPNS2_MOUSE     CGIFFWSAVTFSSSF---IPQQYFWRGLVGIGEASYSTIAPTIIGDLFTKNTRTLMLSVFYFAIPLGSGL
SPNS2_HUMAN     CGIFFWSAVTFSSSF---IPQQYFWRGLVGIGEASYSTIAPTIIGDLFTKNTRTLMLSVFYFAIPLGSGL
NANT_ESCF3      TSIVLFSVGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
BENK_ACIAD      VCIILFSLCTVLCGFSETTTQFSIFRFLAGVGIGGVMPNVIALVSEYAPKKFKSFFVTLMFSGYAIGGMT
YCEI_BACSU      ITLLCFSIGSGISAFVTSLSAFLILRFVIGMGLGGELPVASTLVSEAVVPEKRGRVIVLLESFWAVGWLA
TCR_STRAG       FGIIINCFGSVIGFVGHSFFSLLIMRFIQGAGAAAFPALVMVVVARYIPKENRGKAFGLIGSIVAMGEGV
PMRA_STRR6      RAGLAMTITMGGLAFVPNIYWLIFLRLLNGVFAGF-VPNATALIASQVPKEKSGSALGTLSTGVVAGTLT
PMRA_STRPN      RAGLAMTITMGGLAFVPNIYWLIFLRLLNGVFAGF-VPNATALIASQVPKEKSGSALGTLSTGVVAGTLT
YYAJ_BACSU      LFVFVFSIASLCNAAAWDIPSLMTFRFLTGFGVAAAMVITNSYLAEFFPSSVRGKYISFCAMIGLIGVPI
SOTB_CITK8      ---------CLFVLFIASHVLSFLWNVISRIGIAFAHAVFWSITASLAIRLKRAQALSLIATGTALAMVL
DGOT_ECOLI      IAIFGWSVATLFQGFATGLMSLIGLRAITGIFEAPAFPTNNRMVTSWFPEHERASAVGFYTSGQFVGLAF
DGOT_ECOL6      IAIFGWSVATLFQGFATGLMSLIGLRAITGIFEAPAFPTNNRMVTSWFPEHERASAVGFYTSGQFVGLAF
PLT6_ARATH      LASILFMLGSILMGWGPNYPVLLSGRCTAGLGVGFALMVAPVYSAEIATASHRGLLASLPHLCISIGILL
BCR_HAEIN       LGVIVGALTALVLTEINSVGNFTALRFVQGFFGAAPVVLSGALLRDLFSKDQLSKVMSTITLVFMLAPLV
AZR1_YEAST      FAIVIFEIGSLISALANSMSMLXXXXXXXXXXXXXXQSLSFVIGSTLVEESQRGILIAVLSCSFAIASVV
PLT5_ARATH      LAGAIFFAGAILMGLSPNYAFLMFGRFIAGIGVGYALMIAPVYTAEVSPASSRGFLNSFPEVFINAGIML
NANT_SHIFL      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_SHIF8      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_SHIB3      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_ECOSM      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_ECOSE      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_ECOLI      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_ECOLC      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_ECOL5      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_ECOHS      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_ECODH      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_ECOBW      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_ECO8A      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_ECO7I      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_ECO5E      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_ECO57      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_ECO55      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_ECO45      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_ECO27      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT_ECO24      TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
NANT1_ECOL6     TSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVV
YRT3_CAEEL      LGILVASFMNILSAISHPYTDIFVMQAVQGLALGVLYPAMHGVWKFWAPPLERSKLATTAFTGSSVGVMT
TCR_STAHY       FGIIINCFGSVIGFVGHSFFSLLIMRFIQGAGAAAFPALVMVVVARYIPKENRGKAFGLIGSIVAMGEGV
SVOP_MOUSE      ISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIG-GVPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVF
SOTB_SALTI      ---------CLFVLFIASHVLSFLWNVISRIGIAFAHAIFWSITASLAIRLKRAQALSLIATGTALAMVL
SOTB_SALSV      ---------CLFVLFIASHVLSFLWNVISRIGIAFAHAIFWSITASLAIRLKRAQALSLIATGTALAMVL
SOTB_SALPK      ---------CLFVLFIASHVLSFLWNVISRIGIAFAHAIFWSITASLAIRLKRAQALSLIATGTALAMVL
SOTB_SALPC      ---------CLFVLFIASHVLSFLWNVISRIGIAFAHAIFWSITASLAIRLKRAQALSLIATGTALAMVL
SOTB_SALPB      ---------CLFVLFIASHVLSFLWNVISRIGIAFAHAIFWSITASLAIRLKRAQALSLIATGTALAMVL
SOTB_SALPA      ---------CLFVLFIASHVLSFLWNVISRIGIAFAHAIFWSITASLAIRLKRAQALSLIATGTALAMVL
SOTB_SALHS      ---------CLFVLFIASHVLSFLWNVISRIGIAFAHAIFWSITASLAIRLKRAQALSLIATGTALAMVL
SOTB_SALG2      ---------CLFVLFIASHVLSFLWNVISRIGIAFAHAIFWSITASLAIRLKRAQALSLIATGTALAMVL
SOTB_SALEP      ---------CLFVLFIASHVLSFLWNVISRIGIAFAHAIFWSITASLAIRLKRAQALSLIATGTALAMVL
SOTB_SALDC      ---------CLFVLFIASHVLSFLWNVISRIGIAFAHAIFWSITASLAIRLKRAQALSLIATGTALAMVL
SOTB_SALCH      ---------CLFVLFIASHVLSFLWNVISRIGIAFAHAIFWSITASLAIRLKRAQALSLIATGTALAMVL
SOTB_SALAR      ---------CLFVLFIASHVLSFLWNVISRIGIAFTHAIFWSITASLAIRLKRAQALSLIATGTALAMVL
SOTB_SALA4      ---------CLFVLFIASHVLSFLWNVISRIGIAFAHAIFWSITASLAIRLKRAQALSLIATGTALAMVL
PHT44_ORYSJ     XXXXWWSIATVLTPLAAKIGLPFLMRAFMGIGEGVAMPAMNNILSKWVPVSERSRSLALVYSGMYLGSVT
YQJV_BACSU      VSIFGWMLVFAGFAAASNLWVFFVVNALNGLCKSLFEPASKALLSDMTEEKTRLLVFNLRYAAINIGVVF
EMRB_ECOLI      WSTIAFAIASWACGVSSSLNMLIFFRVIQGIVAGPLIPLSQSLLLNNYPPAKRSIALALWSMTVIVAPIC
EMRB_ECO57      WSTIAFAIASWACGVSSSLNMLIFFRVIQGIVAGPLIPLSQSLLLNNYPPAKRSIALALWSMTVIVAPIC
SVOP_RAT        ISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIG-GVPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVF
SPNS1_BOVIN     GGIAFWSLVTLGSSF---IPRERFWXXXXXXXXXXXXEASYSLIADLFVADQRSRMLSVFYFAIPVGSGL
YJA1_SCHPO      VGNVIFIVFNMACGLARTKAQMYIFRFLAGFGSATPMGLGSGTISDLFTPDERGKAVAVMSLAPLLGPTI
YTBD_BACSU      WIMFIFIAGNTMAATASSIGILLAARVISAFSHGVFMSIGSTIAADIVPEDKRASAISIMFTGLTVATVT
YHX6_SCHPO      AAYCVFGIGCFLCGTSRSLWQLVXXXXXXXXXXXXMNSTVSILMSDIVPLKQRGTYQGIINVFFAIGSSL
SGE1_YEAST      ISVIVFEIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGTSIVRENHRGIMITALAISYVIAEGV
PLT3_ARATH      LSAVIFLVGSVLMGYGPNYPVLMVGRCIAGVGVGFALMIAPVYSAEISSASHRGFLTSLPELCISLGILL
YWTG_BACSU      AAALLFCIGGLGVALAPNTGVMVLFRIILGLAVGTSTTIVPLYLSELAPKHKRGALSSLNQLMITVGILL
YCNB_BACSU      TAMSIFTAGTVVGAFAPNFPVLLTARIIQAAGAGIMMPLMQTVFLTIFPIEKRGQAMGMVGLVISFAPAI
SPNS2_DANRE     CGIFFWSAVTLLSSFKEYYWLLVLSRCLVGIGESSYSSISPTIIGDLFTNNKRTVMLSVFYLAIPXXXXX
S22A7_HUMAN     VAYVSTLVLGLASAASVSYVMFAITRTLTGSAL-AGFTIIVMPLELEWLDVEHRTVAGVLSSTFWTGGVM
HXT10_YEAST     CVILVYVVGIVIQASSDKWYQYFIGRIVSGMGVGGVAVLSPTLISEISPKHLRGTCVSFYQLMITLGIFL
SVOPL_HUMAN     ISFLWGAYFSLLTSFAPSYIWFVFLRTMVGCGVGHSQGLIIKT--EFLPTKYRGYMLPLSQVFWLAGSLL
QACA_STAAU      TGFALFGLVSLAIFFAESAEFVIAIRFLLGIAGALIMPTTLSMIRVIFENPKRATALAVWSIASSIGAVF
QACA_STAAM      TGFALFGLVSLAIFFAESAEFVIAIRFLLGIAGALIMPTTLSMIRVIFENPKRATALAVWSIASSIGAVF
YNFM_ECOLI      TALLLASICTLLSTMMTSWHGILIMRALIGLSLSGVAAVGMTYLSEEIHPSFVAFSMGLYISGNSIGGMS
YAAU_ECOLI      IDIIAIGVISVATMFVSSPVELLVMRVLIGIVIGADYPIATSMITEFSSTRQRAFSISFIAAMWYVGATC
S22A7_PONAB     VAYVSTLVLGLASAASVSYVMFAITRTLTGSAL-AGFTIIVMPLELEWLDVEHRTVAGVLSSTFWTGGMM
GUDP_ECOLI      WSIFIWSMFTLLQGFVDIFSALFTLRFLVGLAEAPSFPGNSRIVAAWFPAQERGTAVSIFNSAQYFATVI
YWFA_BACSU      AGLMIFIIGTVICALAQNIXXXXXXXXXXXXXXXXXVPTAYAVVGDRVPYTYRGKVMGLIVSSWSLALIF
YN43_SCHPO      VGMFMFSIFSIAVAVAKDVQTVMICRFFSGFCASSPLSVVAAAFADMFDNKTRGPAVCIFACITFAGPLI
YJJL_ECOLI      LGMFFWSLFQAMSGMVHNFTQFVLVRIGMGIGEAPMNPCGVKVINDWFNIKERGRPMGFFNAASTIGVAV
Y588_BUCAI      TSLFIAAMLTMICSMMTSWISIVLLRALTGLALSGVVAVAMTYISEEIHPNSLSFCMGLYISGNTIGGFL
NEPI_SHISS      LFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSIALVI
YGAY_ECOLI      SMTLLAAGGMLITASSQSLAMMILGTALTGL-FSVVAQILVPLAATLASPDKRGKVVGTIMSGLLLGILL
YGAY_ECO57      SMTLLAAGGMLITASSQSLAMMILGTALTGL-FSVVAQILVPLAATLASPDKRGKVVGTIMSGLLLGILL
MHPT_ECOLI      GSVALFGLFSLATAIAWDFPSLVFARLMTGVGLGAALPNLIALTSEAAGPRFRGTAVSLMYCGVPI----
BMR1_BACSU      IGLLFFSVSEFLFGIGKTVEMLFISRMLGGISAAFIMPGVTAFIADITTIKTRPKALGYMSAAISTXXXX
ATR1_YEAST      VGVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYGTFRKNIVISFVGAMAPIGATL
SOTB_ERWT9      IIFVMFVASHALSSVAWDFTTLLISR----IGIALSHAIFWSITASLAIRVKKTQALSMMATGTALAMVL
YFHI_BACSU      GLMAIFILSNLMSALAPNFAVLAISRILSASIHGAFFAIAMVFASEMVPPEKRAAAAASMNGGLTVALML
Y1560_METJA     CGTFFYGVSTLMYNFVSTVLGFLIVRIFTGIFSAFVTPVAGSYIAAIAPKTRLGEYMGIFNSAITLXXXX
XYLT_LACBR      LSAIIFFVGALGSAFSPEFWTLIISRIILGMAVGAASALIPTYLAELAPSDKRGTVSSLFQLMVMTGILL
PHT42_ORYSJ     GAAALWSLATFLTAASQSTIMLLAIRALFGLAEGVAFPTMSTFLPKWFPTHERATAVGISMGGFHLGNVI
ARAJ_ECOLI      FLVALCVIGNAMFTLSSSYLMLAIGRLVSGFPHGAFFGVGAIVLSKI---IKPGKVTAAVASGMTVANLL
S22A1_HUMAN     GTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMYQMAFTVGLV-
S17A5_HUMAN     FGILGTAVLTLFTAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLSISYAGAQLGTVI
NEPI_ECO27      LFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAISASLTMRLVPPRTVPKALSVIFGAVSIALVI
NASA_BACSU      IGMLVTMIPLLWGTFGRSLTELYAIGILLGV-AGASFAVALPMASRWYPPHLQGLAMG-IAGAGNSGTLF
SVOPL_MOUSE     LSFLWGAYFSLLTSFSPSYIWFVFLRTMVGCGVGHAQGLIIKT--EFLPTKYRGYMLPLSQVFWLAGSLL
HXT5_YEAST      XXXXXXXXXXXXXXXXDKWYQYFIGRIISGLGVGGITVLAPMLISEVSPKQLRGTLVSCYQLMITFGIFL
EMRB_HAEIN      VSTFLFVVSSWLCGIADSLEALIIFRVIQGAVAGPVIPLSQSLLLNNYPPEKRGMALAFWSMTIVVAPIF
Y567_BUCAP      SSLLIAAVLTIICSISNNWTVIVFLRALTGLALSGVVAVAMTYIVEEVHPNSVSFCMGLYISGNTIGGCS
VACHT_TORCA     IGLTIMFFSTITFAFGESYAVLFAARSLQGLGSAFADTSGIAMIADKYEESERTQALGIALAFISFGSLV
MSSP3_ARATH     LSSVLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETAPSEIRGLLNTFPQFCGSGGMFL
MDTL_SHESA      XXXXXXXXXXXXXXXXQSSDLFLVARFVQGVGAGCCYVVAFAILRDALDDKRRAKVLSMVNGVTCIIPVI
YCR3_YEAST      CGLIGTSVSLLILGFSRNFYQALVARSLMGL-LNGNVGVIRTIIGEIATERKQALAFSTMPLLFQFGAVV
VACHT_TOROC     IGLTIMFFSTITFAFGESYAILFAARSLQGLGSAFADTSGIAMIADKYEESERTQALGIALAFISFGSLV
VACHT_TORMA     IGLTIMFFSTITFAFGESYAILFAARSLQGLGSAFADTSGIAMIADKYEESERTQALGIALAFISFGSLV
YJHB_ECOLI      WAIFIYSVGTGLSGIATNLYMLAVCRFIVGLGMSGEYACASTYAVESWPKNLQSKASAFLVSGFSVGNII
S22A2_MOUSE     VTILINAISGVLMAISPNYAWMLVFRFLQGLVSKAGWLIGYILITEFVGLGYRRTVGICYQIAFTVGL--
NEPI_SHIDS      LFAVLLTISCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSIALVI
HXT2_YEAST      CVVLVYIVGIVIQASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFL
GTR12_XENLA     FTSILLVFANLLPVVVVSYGSLIAGRIFIGVSISLSAIATCVYIAELSPQDKRGMLVSLNELMIVAGILL
YDHC_ECOLI      IGLTIFALGSLGMLWVENAATLLVLRFVQAVGVCAAAVIWQALVTDYYPSQKVNRIFAAIMPLVGLSPAL
YBCL_BACSU      YALGLFVFGNVLAFVLPGYGWFXXXXXXXXXXXXXXXXXXXXXXXXXXSEGKQGSAIATVVMGFTASLII
NEPI_ECOL5      LFAVLLTLSCLLVSFANSFSLLLIGRACLGVALGGFWAISASLTMRLVPPRTVPKALSVIFGAVSIALVI
YN2F_SCHPO      IAVFIFCIFHIAVATAKDIQTVMICRFFCGFFGSSPITTVAGSFSDMFSARTRGLVIAVYSAIIFNGPLM
YHCA_BACSU      VAMFCFTLGTLVCGIAPNFSTMLIGRLIQAVGGGILQPLVMTTILLIFPPESRGKGMGIFGLAMMFAPAV
YCEJ_BACSU      WGLAGFIVSTFLCGIAPSFAAMCLFRFAAGVSAAFVTPQIWASIPVIVQPSQIIKGMGIATAGLAASQML
UNC17_CAEEL     LGLCTMFFSTAIFALGKSYGVLLFARSLQGFGSAFADTSGLAMIADRFEENERSAALGIALAFISFGCLV
PLST1_ARATH     FTIPL-ILGALVSAQAHSLDEILCGRFLVGLGIGVNTVLVPIYISEVAPTKYRGS----LGTLCQIGTCL
NEPI_SHIFL      LFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSIALVI
NEPI_SHIF8      LFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSIALVI
NEPI_ECOLI      LFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSIALVI
NEPI_ECOBW      LFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSIALVI
MSSP1_ARATH     LSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYISETAPPEIRGQLNTLPQFLGSGGMFL
MMLH_RALEJ      LAIIWFTLFGVLAGFAQSYQQLLIARTLQGLGFGGEWAVGAALMAEVIDSRHRGKAIGFVQSGFXXXXXX
SOTB_ESCF3      CLFVLFIASHILSFMAWSFTVLVISR----IGVAFAHAIFWSITASLAIRLKRXXXXXXXXXXXXXXMVL
S22A2_RAT       VTILINAISGALMAISPNYAWMLVFRFLQGLVSKAGWLIGYILITEFVGLGYRRMVGICYQIAFTVGL--
S17A5_SHEEP     FGIFATAIFTLFTPLAADFGALVALRALEGLGEGVTYPAMHAMWSSWAPPLERSKLLSISYAGAQLGTVV
PLT4_ARATH      LAALVFQTGAAVMAVAPSFEVLMIGRTLAGIGIGLGVMIAPVYIAEISPTVARGFFTSFPEIFINLGILL
MDTL_SHEON      XXXXXXXXXXXXXXXXQTSDLFLIARFAQGIGAGCCYVVAFAILRDVLDDKRRAKVLSMVNGVTCIIPVI
CSBC_BACSU      VLSIIFIIGALACAFSQTIGMLIASRVILGLAVGGSTALVPVYLSEMAPTKIRGTLGTMNNLMIVTGILL
NART_STAES      WSFIVLLLPIFLLGQAQSPGMLMLSGFFLGIG-GAIFSVGVTSVPKYFSKDK----VGLANGIYGVGNI-
NART_STAEQ      WSFIVLLLPIFLLGQAQSPGMLMLSGFFLGIG-GAIFSVGVTSVPKYFSKDK----VGLANGIYGVGNI-
NANT_ENTS8      SSIVLFSVGTLACGLAPGYTTLFIARLVIGIGMAGEYGASATYVIESWPKALRNKASGFLIXXXXXXXXX
YN42_SCHPO      IGMLGFGIFNISVAVGKDIQTIMMCRFFAGFFASAPLTVVAAALADMYSNKYRGTAITLFSAMVFDGPLV
PLT1_ARATH      LAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAPVYTAEVAPASSRGFLTSFPEIFINIGILL
NEPI_ECOUT      LFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSIALVI
NEPI_ECOL6      LFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSIALVI
NEPI_ECOK1      LFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSIALVI
ANTR4_ARATH     WGVALWSLATFLTPXXXXXXXXXXXXXMVGVAEGVALPCMNNMVARWFPPTERSRAVGIAMAGFQLGNVV
OCTL_DROME      ASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVFLVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFML
NANT_SALA4      SSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFXXXXXX
YN41_SCHPO      IGLFLFSVFQIAVATAQDIQTIMICRFFGGYGACVPLCVVAAAFADMYPNRYRGTAITIFAAVIFVGPLV
SOTB_ERWCH      XXXXXXXXXXXXXAVAWNFTVLVISRAGVALAHSVFWSITASLAIRMAPPGKRAQALGLIATGSSLAMVL
S22A1_RABIT     LTTLINAVSGVLTAVAPDYTSMLLFRLLQGLVSKGSWMSGYTLITEFVGSGYRRTVAILYQVAFSVGLV-
PMRA_LACLA      RASIVMTLTMGGIAFAPNVWWLLGLRLLMGFFSG-YIPNSTAMIASQAPKDKSGYALGTLATAMVSGTLI
NORA_STAAW      XXXXXFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFIL
NORA_STAAU      XXXXXFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFIL
NORA_STAAS      XXXXXFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFIL
NORA_STAAN      XXXXXFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFIL
NORA_STAAM      XXXXXFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFIL
NORA_STAAC      XXXXXFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFIL
NEPI_SHIBS      LFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSIALVI
ERDL4_ARATH     IAAIPNIIGWLSISFAKDTSFLYMGRLLEGFGVGIISYTVPVYIAEIAPQTMRGALGSVNQLSVTIGIML
YFMO_BACSU      LGLIFIIVFAGLGGSSSSIAQLVGYRGGWGLGNALFISTALAVIXXXXXXXX-AQAIILYEAALGLGISV
YAJR_ECOLI      GGLAVFAAGSVIAALSDSIWGIILGRALQGSGAIAA--AVMALLSDLTREQNRTKAMAFIGVSFGITFAI
NORA_STAAR      XXXXXFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADVSPSHQKAKNFGYMSAIINSGFIL
NEPI_ECO57      LFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSIALVI
GUDP_PSEPU      GSIFTWSLFTLLQGYIGEFGLLFLLRFMVGLAEAPSFPGNARIVASWFPTKERGTASAIFNSA-------
SOTB_PSE14      FVFGLFVVSHVLSAISPSFAILLVSR----VGIAFAHAVFWSVTASLAVRIKQVQXXXXXXXXXXXXMVL
S17A9_HUMAN     LSAITAVTPXXXXXXXXXXXFMTFSRILMGLLQGVYFPALTSLLSQKVRESERAFTYSIVGAGSQFGTLL
BAIG_EUBSP      LGIVIFAAGNVLTAVATSLIFMLAARFIVGIGTAAISPIVMAYIVTEYPQEETGKAFGLYMLISSGAVVV
YB30_YEAST      VSLLMLIVNILLAAVPVNIAALFVLRIFQAFASSSVISLGAGTVTDVVPPKHRGKAIAYFMMGPNMGPII
MDTD_PECCP      AAILLFTLGSLLCARSETLNELLASRVIQGIGGAMMVPVGRLTVMKIVPRDQYMAAMTFVTLPGQIGPLM
ERDL6_ARATH     IAAIPNIIGWLCISFAKDTSFLYMGRLLEGFGVGIISYTVPVYIAEIAPQNMRGGLGSVNQLSVTIGIML
YCLF_BACSU      YGGIFIMFGHIALAYPGSSIAFYISMVLIIVGTGLLKPNVSSVVGDLYEDPRRDSGFSIFYMGINLGGLL
SOTB_ENT38      GLFVLFIASHVLSFLAWNFNVL----VISRIGIAFAHAIFWSITASLAIRLKRXXXXXXXXXXXXXXMVL
ITR2_SCHPO      CADAIFVIGSVIMAASRNVAMMVVGRFIVGYGIGLTSLIVPMYITELAPARLRGRLVIIYVVFITGGQLI
SVOPL_DANRE     GGFVWAXXXXXXXXXXXXXGWFIFLRCMVGCGVAATSQ-GFVLKTEFIPAKYRAYLLPLASIFWMMGSIL
SV2A_RAT        ISLXXXXXXXXXXXXXQGYGTFLFCRLLXXXXXXXXXXXXFSYFSEFLAQEKRGEHLSWLCMFWMIGGVY
SV2A_PONAB      ISLXXXXXXXXXXXXXQGYGTFLFCRLLXXXXXXXXXXXXFSYFSEFLAQEKRGEHLSWLCMFWMIGGVY
SV2A_MOUSE      ISLXXXXXXXXXXXXXQGYGTFLFCRLLXXXXXXXXXXXXFSYFSEFLAQEKRGEHLSWLCMFWMIGGVY
SV2A_MACFA      ISLXXXXXXXXXXXXXQGYGTFLFCRLLXXXXXXXXXXXXFSYFSEFLAQEKRGEHLSWLCMFWMIGGVY
SV2A_HUMAN      ISLXXXXXXXXXXXXXQGYGTFLFCRLLXXXXXXXXXXXXFSYFSEFLAQEKRGEHLSWLCMFWMIGGVY
SV2A_BOVIN      ISLXXXXXXXXXXXXXQGYGTFLFCRLLXXXXXXXXXXXXFSYFSEFLAQEKRGEHLSWLCMFWMIGGVY
S22A1_RAT       XXXXXXXXXXXXXAVAPDYTSMLLFRLLQGMVSKGSWVSGYTLITEFVGSGYRRTTAILYQMAFTVGLV-
PBUE_BACAM      IALFVFFLSNLVAYFSPNFAVLMVSRVLASMSTGLIVVLSLTIAPKIVAPEYRARAIGIIFMGFSSAIAL
GTR10_XENLA     GSNLVVLAGSIILIATSSFWWLVVGRVTVGFAISISSMACCIYVSEIVRPHQRGTLVSLYETGITVGILI
ARAE_ECOLI      AGAILFVLGSIGSAFATSVEMLIAARVVLGIAVGIASYTAPLYLSEMASENVRGKMISMYQLMVTLGIVL
ARAE_ECO57      AGAILFVLGSIGSAFATSVEMLIAARVVLGIAVGIASYTAPLYLSEMASENVRGKMISMYQLMVTLGIVL
YYBO_BACSU      WSFLT--IXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXL---WFPPSERGLANSLFDSAAKFSNVI
NART_STAAW      TSFIVLLFPIFFLSQAQTPGMLMASGFFLGVG-GAIFSVGVTSVPKYFPKEK----VGLANGIYGMGNI-
NART_STAAT      TSFIVLLFPIFFLSQAQTPGMLMASGFFLGVG-GAIFSVGVTSVPKYFPKEK----VGLANGIYGMGNI-
NART_STAAS      TSFIVLLFPIFFLSQAQTPGMLMASGFFLGVG-GAIFSVGVTSVPKYFPKEK----VGLANGIYGMGNI-
NART_STAAN      TSFIVLLFPIFFLSQAQTPGMLMASGFFLGVG-GAIFSVGVTSVPKYFPKEK----VGLANGIYGMGNI-
NART_STAAM      TSFIVLLFPIFFLSQAQTPGMLMASGFFLGVG-GAIFSVGVTSVPKYFPKEK----VGLANGIYGMGNI-
NART_STAAE      TSFIVLLFPIFFLSQAQTPGMLMASGFFLGVG-GAIFSVGVTSVPKYFPKEK----VGLANGIYGMGNI-
NART_STAAC      TSFIVLLFPIFFLSQAQTPGMLMASGFFLGVG-GAIFSVGVTSVPKYFPKEK----VGLANGIYGMGNI-
NART_STAAB      TSFIVLLFPIFFLSQAQTPGMLMASGFFLGVG-GAIFSVGVTSVPKYFPKEK----VGLANGIYGMGNI-
NART_STAA9      TSFIVLLFPIFFLSQAQTPGMLMASGFFLGVG-GAIFSVGVTSVPKYFPKEK----VGLANGIYGMGNI-
NART_STAA8      TSFIVLLFPIFFLSQAQTPGMLMASGFFLGVG-GAIFSVGVTSVPKYFPKEK----VGLANGIYGMGNI-
NART_STAA3      TSFIVLLFPIFFLSQAQTPGMLMASGFFLGVG-GAIFSVGVTSVPKYFPKEK----VGLANGIYGMGNI-
NART_STAA2      TSFIVLLFPIFFLSQAQTPGMLMASGFFLGVG-GAIFSVGVTSVPKYFPKEK----VGLANGIYGMGNI-
NART_STAA1      TSFIVLLFPIFFLSQAQTPGMLMASGFFLGVG-GAIFSVGVTSVPKYFPKEK----VGLANGIYGMGNI-
YQO5_SCHPO      IGMFGFGIFNISVAVAKDIQTIMMCRFFSGFFASAPLTVVAAAFADMYSNKHRGTAITIFAALVFDGPLV
YFIU_BACSU      IEVCLFGLGSLLVALSQSFPLFLISRLIQALXXXXXXXXXSSHILATLPKEKQGKALGLLGAMNGMAAVL
SV2B_RAT        MSLAINASFASLSSFVQGYGAFLFCRXXXXXXXXXXXXXVFAYFSEFLSREKRGEHLSWLGIFWMTGGIY
SPX3_XENLA      FGMCSSAITMFLTEWLQFYNKIFYW-IVNGLLQSTGWPCVVAIMGNWFGKSGRGFVFGLWSACASVGNIL
SOTB_HAEIN      XXXXXXXVGHILSVIAWNFWILLLARMCIALAHSVFWSITASLVMRISPKHKKTQALGMLAIGTALATIL
SOTB_HAEIG      XXXXXXXVGHILSVIAWNFWILLLARMCIALAHSVFWSITASLVMRISPKHKKTQALGMLAIGTALATIL
SETB_ECOLI      FCCLLGVLACTLFAWNRNYFVLLFVGVFLSSFGSTANPQMFALAREHADKTGREAVMSFLRAQVSLAWVI
PCAK_PSEPU      XXXXXXXXXSLASAYATNVDQXXXXXXXXXXXXXAGMPNATTLLSEYTPE----RLKSLLVTSMFCGFNL
NART_STAAR      TSFIVLLFPIFFLGQAQTPGMLMASGFFLGVG-GAIFSVGVTSVPKYFPKEK----VGLANGIYGMGNI-
BSU1_SCHPO      CSIFVYTVFNISCALPRNIVQMIISHFIIGVAGSTALTNVAGGIPDLFPEDTAGVPMSLFVWACAGGAIA
SETB_SALTY      FCCVLGMLACVLFAWNRNYFILLFIGVFLSSFGSTANPQMFALAREHADRTGREAVMSILRAQVSLAWVI
EDL14_ARATH     ITNILVLIGWLAIAFAKDVRLLDLGRLLQGISVGISSYLGPIYISELAPRNLRGAASSLMQLFVGV----
YFKF_BACSU      VILLTGAL-CFFIAFPSPYGGCFF---IAGMAVGSTFTLGISYMTDLLPPHLLPAGNLLCGITFSLGSIL
YCT4_SCHPO      VTLVIFVVFQIGGGCSKNIWSLVIFRFFHGFFGCTPMSACGGTISDLFNPIQRTGALLVFCAAAFVGPLV
S22A1_MOUSE     XXXXXXXXXXXXXXXAPDYTSMLLFRLLQGMVSKGSWVSGYTLITEFVGSGYRRTTAILYQVAFTVGLV-
ERDL7_ARATH     VSSAFCVVGWLAIIFAKGVVALDLGRLATGYGMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSV
YLD2_CAEEL      VTILGSALLTLLNPVAARTSELAILRAAIGFLQGATFPAMHTMWSVWGPPLELSVLTGVTYAGAQIGNVI
YHM9_SCHPO      TATIILIVSTALCTGAYGYSALIAYRFFLGIGIGAEYPCGSVAASESSNELKSGAFIVVTDGAIDFGFVV
YDJE_ECOLI      INLLIVGIAATGAAFVPDMYWLIFFRFLMGTGMGALIMVGYASFTEFIPATVRGKWSARLSFVGNWSPML
XYLL3_ARATH     IAAVLYLLGSLITGCAPDLNILLVGRLLYGFGIGLAMHGAPLYIAETCPSQIRGTLISLKELFIVLGILL
VBA2_YEAST      FANGAFTIGCLACGFSKNIYMLSFMRAXXXXXXXXXXXXXXXVNSDVIPSSKRGIFQAFQNLLLGFGAIC
SPX2_DANRE      TGML------LSGLFTALFGLGFYWQALNGLVQTTGWPAVVACVGNWFGKGKRGFIMGVWNSHTSVGNIL
S22A4_HUMAN     ATMAVQTGFSFLQIFSISWEMFTVLFVIVGMGQISNYVVAFILGTEIL-----GKSVRIIFSTLGVCTFF
NPT3_BOVIN      AGLLISSLLTLFTPLTADFGVILVIRTVQGMAQGMAWTGQFTIWAKWAPPLERSKLTSIAGSGAAFGSFI
YFIG_BACSU      YLALLFIAATLGCTFSPNASVMIAFRFLLGLAVGCASVTVPTFLAEISPAERRGRIVTQNELMIVIGQLL
YDFJ_ECOLI      ITITMMGICTTLIGVLPTYAQIGVFRIIQGLGAGAEISGAGTMLAEYAPKGKRGIISSFVAMGTNCGTLS
YD387_YEAST     ICCSIFILAAIGMAIARTLTFLICGRLLVGIAVGVSAQCVPLFLSEISPSRIRGFMLTLNIIAITGGQLV
S22A4_PAPAN     ATMAVQTGFSFLQIFSISWEMFTVLFLIVGMGQISNYVVAFILGTEIL-----GKSVRIIFSTLGVCTFF
PHT47_ORYSJ     LSFVLWSLICLIPLDPKREVILVLSRLFVGVAQGFIFPAIHTVLAQWVPPQERSRSVSLTTSGMYLGAAG
GTR1_PIG        MMNLLAFISAVLMGFSKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILI
EDL10_ARATH     ACDLFCIFGWLSIAFAKNVLWLDLGRISLGIGVGLTSYVVPVYIAEITPKHVRGAFSA--STLLLQNSGI
VACHT_DROME     IGLTIMFFSTAVFACGSSYSVLFFARSLQGAGSAFADTAGLAMIADRFEENERSQALGIALAFISFGCLV
TCMA_STRGA      VGVAGFAVTSAAIGLSGSVAAIVVFRVLQGLFGALMQPSALGLLRVTFPPGKLNMAIGIWSGVVGASTAA
S22A6_MOUSE     LNYLQTAVSGTCAAYAPNYTVYCIFRLLSGMSLASIAINCMTLNMEWMPIHTRAYVGTLIGYVYSLGQFL
S22A2_HUMAN     TTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYR-RTVGIFYQXXXXXXXX
PT113_ORYSJ     ITLLLMVVSSLASGLSFSKHELCFFRFWLGVSIGGDYPLSATIMSEYANKRTRGAFIAAVFAMQGFGNII
YMPB_CAEEL      TTAILAFLANMAASFSPNFAIFLILRAFIGACSDSYLSVASVATCEYLSEKARAWITVVYNVAWSLGMVW
SOTB_HAEI8      XXXXXXXVGHILLVIAWNFWILLLARMCIALAHSVFWSITASLVMRISPKHKKTQALGMLAIGTALATIL
S22A6_RAT       LNYLQTAVSGTCAAYAPNYTVYCVFRLLSGMSLASIAINCMTLNVEWMPIHTRAYVGTLIGYVYSLGQFL
PLT2_ARATH      XXXXXXXXXXXXXXXXTNYPFIMVGRFVAGIGVGYAMMIAPVYTTEVAPASSRGFLSSFPEIFINIGILL
PHT19_ARATH     LSLLIMVFSSFGCGFSRSMVSLGFFRFVLGLGIGGDYPLSATIMSEFANKRTRGAFIAAVFSMQGLGILM
MDTD_YERPY      SAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQYMAAMAFVTLPGQIGPLV
MDTD_YERPS      SAIILFTFGSLMCAQSATLNELILSRVLQGVGDAMMVPVGRLTVMKIVPREQYMAAMAFVTLPGQIGPLV
MDTD_YERPP      SAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQYMAAMAFVTLPGQIGPLV
MDTD_YERPN      SAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQYMAAMAFVTLPGQIGPLV
MDTD_YERPG      SAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQYMAAMAFVTLPGQIGPLV
MDTD_YERPE      SAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQYMAAMAFVTLPGQIGPLV
MDTD_YERPB      SAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQYMAAMAFVTLPGQIGPLV
MDTD_YERPA      SAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQYMAAMAFVTLPGQIGPLV
MDTD_YERP3      SAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQYMAAMAFVTLPGQIGPLV
ERDL5_ARATH     FS----EMFCILGWLAIYLSKVAIWRFLVGYGMGVFSFVVPVYIAEITPKGLRGGFTTVHQLLICLGVSV
YUXJ_BACSU      ATGTGIALSIFFMGFVTSVYQLFFLRMAMGLVTGF-IPTSLAMISAQTPKSSAGKTLGTLQMGQVSGSLF
YDHP_ECOLI      FLMAIFTLGNVLSAIAPDYMTLMLSRILTSLNHGAFFGLGSVVAASVVPKHKQASAVATMFMGLTLANIG
YDHP_ECO57      FLMAIFTLGNVLSAIAPDYMTLMLSRILTSLNHGAFFGLGSVVAASVVPKHKQASAVATMFMGLTLANIG
Y1104_HAEIN     WTILLFAVFTGLCAIAQGYWDLLIYRTXXXXXXXXXXXXXMALAAEAWPARHRAKAASYVALGWQXXXXX
VGLU3_DANRE     AAIFLTSVLNMFSAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVI
SV2B_MOUSE      MSLAINASFASLSSFVQGYGAFLFCRXXXXXXXXXXXXXVFAYFSEFLSREKRGEHLSWLGIFWMTGGIY
SOTB_PSESM      FVFGLFVVSHVISAMASSFAILLVSR----VGIAFAHAVFWSVTASLAVRIKQVQXXXXXXXXXXXXMVL
SOTB_PSEE4      XXXXXXILSHLMSWLSQSFAMLLVSRIGIALAHAVFWAITASLAVRVAPPGQQAKXXXXXXXXXXXXMVM
S22A7_MOUSE     VAYVSTLALGLMSAASVNYIMFVTTRMLTGSAL-AGFTIIVLPLELEWLDVEHRTVAGVISTTFWXXXXX
S17A5_MOUSE     XXXXXTSVFTLFTPLAADLGTLVVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLTISYAGAQLGTVI
PHT12_ORYSJ     FTLILMVVCSIASGLSFGHATLCFFRFWLGFGIGGDYPLSATIMSEYASKKTRGAFIAAVFAMQGFGILF
ARAE_KLEOX      YSLMVGAVLFVASAFATSVEMLLVARIVLGVAVGIASYTAPLYLSEMASENVRGKMISMYQLMVTLGIVM
SOTB_PSEU2      FVFGLFVVSHVLSAIAPSFAILLVSR----VGIAFAHAVFWSVTASLAVRIKQVQXXXXXXXXXXXXMVL
MOT6_HUMAN      LGGVLASLGMVASSFSHNLSQLYFTAGITGLGMCFSFQSSITVLGFYFVR-RRVLANALASMGVSLGITL
MDFA_ECOLI      AGVVWFIVTCLAILLAQNIEQFTLLRFLQGISLCFIGAVGYAAIQESFEEAVCIKITALMANVALIAPLL
MDFA_ECOL6      AGVVWFIVTCLAILLAQNIEQFTLLRFLQGISLCFIGAVGYAAIQESFEEAVCIKITALMANVALIAPLL
MDFA_ECO57      AGVVWFIVTCLAILLAQNIEQFTLLRFLQGISLCFIGAVGYAAIQESFEEAVCIKITALMANVALIAPLL
GTR1_HUMAN      MMNLLAFVSAVLMGFSKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILI
GTR1_BOVIN      MMNLLAFVSAVLMGFSKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTELRGALGTLHQLGIVVGILI
EMRY_ECOLI      XXXXXXXXXXXXXXXXTNLDVLIFFRVVQGLMAGPLIPLSQSLLLRNYPPEKRTFALALWSMTVIIAPIC
EAT4_CAEEL      FGIGVGAFLNILLPYGKSDYLVAFIQITQGLVQGVCYPAMHGVWRYWAPPMERSKLATTAFTGSYAGAVL
VGLU1_RAT       FAIVATSTLNMLSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVV
VGLU1_MOUSE     FAIVATSTLNMLSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVV
VGLU1_BOVIN     FAIVATSTLNMLSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVV
VGL2A_DANRE     AAILLTSTLNMFSAARGHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVI
TCR_STAES       XXXXXXXXXXXXXAFHNHFFILIFGRLVQGVGSAAFPSLIMVVVARNITRKKQGKAFGFIGSIVALGEGL
TCR_STAAU       XXXXXXXXXXXXXAFHNHFFILIFGRLVQGVGSAAFPSLIMVVVARNITRKKQGKAFGFIGSIVALGEGL
S17A9_MOUSE     LSFITVTTPLLAHLGSGHLAFLTFSRILTGLLQGVYFPALTSLLSQKVQESERAFTYSTVGAXXXXXXXX
MSSP2_ARATH     LSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIYISETAPPEIRGLLNTLPQFTGSGGMFL
ITR1_YEAST      GSNLMFVIGAILQVSAHTFWQMAVGRLIMGFGVGIGSLIAPLFISEIAPKMIRGRLTVINSLWLTGGQLV
ERD6_ARATH      FCEFFCITGWLCVALAQNAMWLDCGRLLLGIGVGIFSYVIPVYIAEIAPKHVRGSFVFANQLMQNCGISL
Y4XM_RHISN      RALLGLAITQLLVAFAQDVWTILALRFLQGACAGYIAPAAYGV------EVTGGRDRARLFAWLQVATNV
UHPC_SALTY      IGLIATGVVNILFGFSTSXXXXXXXXXXXXXXQGFGSPVCARLLTAWYSRTERGGWWALWNTAHNVGGAL
S22A5_HUMAN     VTMGMQTGFSFLQIFSKNFEMFVVLFVLVGMGQISNYVAAFVLGTEIL-----GKSVRIIFS--TLGVCI
PHT15_ORYSJ     MTLMLMVICCLASGLSFGMATLCFFRFWLGFGIGGDYPLSATIMSEYANKRTRGAFIAAVFAMQGFGNLT
PHT14_ORYSJ     MTLMLMVICCLASGLSFGMATLCFFRFWLGFGIGGDYPLSATIMSEYANKRTRGAFIAAVFAMQGFGNLT
PHT14_ORYSI     MTLMLMVICCLASGLSFGMATLCFFRFWLGFGIGGDYPLSATIMSEYANKRTRGAFIAAVFAMQGFGNLT
MFS10_HUMAN     LCLMGVATSYAVWATSRSFAAFLASRLIGGISKG-NVSLSTAIVADLGSPLARSQGMAVIGVAFSLGFTL
HXT17_YEAST     IVVLVYMVGAIIQISSHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFL
GTR2_BOVIN      VANILSLVGALLMGFSKSHXXXXXXXXXXXXYCGLISGLIPMYIGEIAPTTLRGAIGALHQLAIVTGILI
GTR1_RAT        MMNLLAFVSAVLMGFSKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILI
GTR1_MOUSE      MMNLLAFVAAVLMGFSKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILI
ERDL8_ARATH     LSSVISAIGWLIIYLAKGDVPLDFGRFLTGYGCGTLSFVVPVFIAEISPRKLRGALATLNQLFIVIGLAS
EDL16_ARATH     TSACFCITGWLAVFFTKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGGLTTLNQLMIVIGSSV
BCRH_RICPR      LGLXXXXXXXXXXXXXXXXEMLMIARFIQAFGVSVGSVIGQSMARDSYQGAELSYVYAILSPWLLFIPAL
UHPC_ECOLI      IGLIATGIINILFGFSTSLWAFAVLWVLNAFFQGWGSPVCARLLTAWYSRTERGGWWALWNTAHNVGGAL
S22A2_PONAB     TTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYR-RTVGIFYQXXXXXXXX
QUTD_EMENI      FSALIGAGMMLGANGDRGLGLIYGGRVLAGIGVGAGSNICPIYISEMAPPAIRGRLVGVYELGWQIGGVV
PROP_SALTY      ITIVIMSISTFCIGLIPSYATIGIWKMAQGFSVGGEYTGASIFVAEYSPDRKRG----FMGSWLDFGSII
HXT13_YEAST     IVVLVYMVGAIIQISSHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFL
HIAT1_MOUSE     LTVFFTCAPIPLMKIS----PWWYFAVISVSGVFATFSVVFAYVADITQEHERSMAYGLVSATFAASLVT
EDL11_ARATH     ---WACDFFCVFGWLSIAFAKNVFWRISLGIGVGLISYVVPVYIAEITPKHVRGAFTA--SNQLLQNSGV
YQEH_SCHPO      GSLIIYVCFCISCALARNYAQLVISMLIMGVVGSTALGNVAGAVADVLDEDSNWGMYMFICSVASVGSPM
Y532_BUCBP      SSLFLASFCTFCCSNMNSWESIIFMRALTGLALSGVAAVAMTYLSEEMHPSVLSFSIGLYISGNTIGGFL
VMAT2_RAT       AGFCIMFISTVMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYDDEERGKXXXXXXXXXXXXXXX
TCR2_ECOLX      LSLIGASLDYLLLAFSSALWMLYLGRLLSGI-TGATGAVAASVIADTTSASQRVK---------------
S22A1_BOVIN     XXXXXXXSLGVLTAVAPDYTSLLIFRLLQGLVSKGSWTAGYTLITEFVGLGYRRTVAILYQMAFTVGLVL
PROP_ECOLI      ITIVIMSISTFCIGLIPSYDTIGIWAPILGFSVGGEYTGASIFVAEYSPDRKRG----FMGSWLDFGSII
PROP_ECO57      ITIVIMSISTFCIGLIPSYDTIGIWAPILGFSVGGEYTGASIFVAEYSPDRKRG----FMGSWLDFGSII
MDTM_SALTY      AGXXXXXXXXXXXXXXXSMTQFLVARFVQGTSICFIATVGYVTVQEAFGQTKAIKLMAIITSIVLVAPVI
MDTM_SALTI      AGXXXXXXXXXXXXXXXSMTQFLVARFVQGTSICFIATVGYVTVQEAFGQTKAIKLMAIITSIVLVAPVI
ITR2_YEAST      FSNLMFLIGAILQITAHKFWQMAAGRLIMGFGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLI
GTR7_HUMAN      INNIFAIIPAILSKVAKAFELIVFSRVVLGVCAGISYSALPMYLGELAPKNLRGMVGTMTEVFVIVGVFL
EDL13_ARATH     VSNSFCMAGWLMIAFSQATWSLDIGRLFLGVAAGVASYVVPVYIVEIAPKKVRGTFSA-INSLVMCASVA
BCR_ECOLI       XXXXXXXXXXXXXXXXNTIDQLIVMRFFHGLXXXXXSVVINALMRDIYPKEEFSRMMSFVMLVTTIAPLM
BCRH_RICTY      LGLXXXXXXXXXXXXXXXXEMLMIARFIQAFGVSVGSVIGQSMARDSYQGAELSYVYAILSPWLLFIPSL
YBFB_BACSU      ILYAVRALSIVILIYSHEPYLLLAFAILFGLVDFATVAPTQMLATQYFQNYSIGLMIGWLSLAHQIGSAL
S22A6_RABIT     LNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGIALNCMTLNVEWMPIHTRAYVGTLAGYVYSTGQFL
PT111_ORYSJ     AACAIGSGLSFGSSRKAVIGTLCFFRFWLGFGIGGDYPLSATIMSEYSNKKTRGAFIAAVFAMQGVGIIF
PHT18_ORYSJ     MTLLMMVICSIASGLSFSHATLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGFGILA
NPT3_HUMAN      AGLLISSLLTLFTPLAADFGVIIMVRTVQGMAQGMAWTGQFTIWAKWAPPLERSKLTTIAGSGSAFGSFI
NART_STAHJ      CSFVILLFPIFFLGQAQTPGMLMLSGFFLGVG-GAIFSVGVTSVPKYFSKDK----VGLANGIYGMGNI-
NANT2_ECOL6     LSIVLFSLGTLACGLAPGYAVMFIARIVIGLGMAGEYGSSVTYVIESWPVHLRNKXXXXXXXXXXXXXXX
MFS10_MOUSE     LSLTGLAISYAVWATSRSFKAFLASRVIGGISKG-NVNLSTAIVADLGSPPTRSQGMAVIGVAFSLAFTL
HXT1_YEAST      XXXXXXXXXXXXXXXXNKWYQYFIGRIISGLGVGGITVLSPMLISEVAPSEMRGTLVSCYQVMITLGIFL
HIAT1_HUMAN     LTVFFTCAPIPLMKIS----PWWYFAVISVSGVFATFSVVFAYVADITQEHERSMAYGLVSATFAASLVT
GTR7_RAT        INNIFAIIPAILSKVAKAFELIVFSRVVLGVCAGISYSALPMYLGELAPKNLRGMVGTVTEVFVIVGVFL
GTR2_HUMAN      VANILSLVGALLMGFSKSHILIIAGRSISGLYCGLISGLVPMYIGEIAPTALRGALGTFHQLAIVTGILI
GALP_ECOLI      IGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGVASYTAPLYLSEIAPEKIRGSMISMYQLMITIGILG
GALP_ECOL6      IGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGVASYTAPLYLSEIAPEKIRGSMISMYQLMITIGILG
YCAD_SALEP      LASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMAYYMGTFL
YCAD_ESCF3      LASLVFAAGCLGLGLMIGFWSWMAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMIYYVGTFL
Y466_BUCAI      LGLFMFFIGNIISASIHSIWGLIIGRFFQ--GSGAISGVCMAFLSDLIREENRVKSIAAIGVSFAISFLI
VGLU1_HUMAN     FAIVATSTLNMLSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVV
SPX2_BOVIN      -----------------------------GLVQTTGWPAVVSCVGNWFGKGKRGLIMGIWNSHTSVGNIL
SOTB_PASMU      XXXXXXXXXXXXXXXAWDFWVL----VLARIGVALTHSIFWAITASLVIRVKKSQAIGLLAIGCSLAMIL
S22A3_MOUSE     ISCFGVGITGVVVAFAPNFSVFVIFRFLQGVGKGACFVIVTEIVGS-----KQRRIVGIV---IQMFFTL
RAG1_KLULA      XXXXXXXXXXXXXXASDKWYQYFIGRIISGLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFL
PT112_ORYSJ     MTLLLMVICSIASGLSFSHATLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGFGILA
ORCT_DROME      ASLVLQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFLVAYVIALEMVGSSYRLFAGVAMQMFFSVGF--
MDTD_YERE8      SAIILFTLGSLLCAQAETLNELISSRVIQGIGGAMMVPVGRLTVMKIVPREQYMSAMAFVTLPGQIGPLV
VGLU2_RAT       AAILLTSTLNMLSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVI
VGLU2_MOUSE     AAILLTSTLNMLSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVI
VGLU2_HUMAN     AAILLTSTLNMLSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVI
VGLU2_BOVIN     AAILLTSTLNMLSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVI
STP5_ARATH      LGGFTFLFGALINGLAANIAMLISGRILLGFGVGFTNQAAPVYLSEVAPPRWRGAFNIGFSCFISMGVVA
S22AC_MOUSE     WSYLLVSVSGTAAAFMPTFPLYCLFRFLLASAVAGVMMNTASLLMEWTSAQGSPLVMTLNALGFSFGQVL
S22A3_RAT       ISCFGVGITGVVVAFAPNFSVFVIFRFLQGVGKGACFVIVTEIVGS-----KQRRIVGIV---IQMFFTL
S22A2_RABIT     VTILINAAAGVLMAVSPNYTWMLIFRLIQGLVSKAGWLIGYILI--------------------------
S226B_XENLA     WSNLQMFVTGICAAFSPNYIWYCIFRFLTGVAFSGIVLNSYSLTVEWIPTGNR----AFTSTATGYCYTM
LPLT_PHOLL      FANSFK----LLGAFTICLGDPFLGYALVGVGAASYSPAKYGILVELTDGDRLVKANGLMEASTIIAILT
HSRA_ECOLI      LAVSLFTLGSLACALSNSLPQLVVFRVIQGIGGAMMMPV-------------------------------
EDL15_ARATH     ITNILFVIGWFAIAFAKGVWLLDLGRLLQGISIGISVYLGPVYITEIAPRNLRGAA----SSFAQLFAGV
YCAD_SALG2      LASLIFAAGCVGLGGMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMAYYMGTFL
YCAD_SALDC      LASLIFAAGCVGLGGMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMAYYMGTFL
XYLL1_ARATH     LAAFLYLVGAIVTVVAPVFSILIIGRVTYGMGIGLTMHAAPMYIAETAPSQIRGRMISL----KEFSTVL
UHPT_CHLPN      IGLMITGLTNIFFGMSSSIVLFALWWGLNGWFQGWGWPPCARLLTHWYAKSERGTWWSVWSTSHNIGGAL
SPX2_MOUSE      AGMVXXXXXXXXXXXXYFWNIHMLWQICNGLVQTTGWPSVVTCVGNWFGKGKRGFIMGIWNSHTSVGNIL
SPX2_HUMAN      -----------------------------GLVQTTGWPSVVTCVGNWFGKGKRGFIMGIWNSHTSVGNIL
S22A7_PIG       XXXXXXXXXXXXXXXXXXYTMFAITRTLTGTAL-AGFTIIVMPLELEWLDVGHRTVAGVLSSTFWTGGVM
MMR_STRCO       WGMGVFFLASLACALAPTAETLIAARLVQGAGAAXXXXXXXXXXXXXXPEKRRTRMLGLWSAIVATSSGL
LMRB_BACSU      VSLIFSILGTFIXXXXXXXXXXXXXRIVQALGTGLLLPLMFNTILVIFPPHKRGAAMGTIGLVIMFAPAI
HXT9_YEAST      TVTAIYVVGILIQITSNKWYQYFIGRIISGLGVGGIAVLSPMLISEVAPKQIRGTLVQLYQLMCTMGIFL
HXT11_YEAST     TVTAIYVVGILIQITSNKWYQYFIGRIISGLGVGGIAVLSPMLISEVAPKHIRGTLVQLYQLMGTMGIFL
GTR1_RABIT      MMNLLAFVSAVLMGFSKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILI
YMFD_BACSU      ----------------------------------------------------------------------
YJ94_YEAST      YGCAMMLLSGLVFSFSENFTLLLVF-AIFGVEVGPFKSIEEAMIAHLSPHNARPEIYAIHALVGTIGSAL
YHD3_SCHPO      LGYIWFCIWSLISGFSYYAKSVIMFRALTGIXXXXXXXXXXXXXGRVYPPGKKKNLIALFGATAPNGFLL
YDER_BACSU      VXXXXXXXXXXXXXFVK-HGTLFLAAAFF-VGLGSAAQVLVPFASYLASDAARGRVVGNVMSGLLLGIML
YCAD_SALPB      LASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYYMGTFL
YAN6_SCHPO      TSIVLFLFGSAMCGAAQNMLWLVLCRAVQGIGGGGITSLVTIVIADITPLQTRPYYTGCMGVTWGLASVM
TCR8_PASMU      FSLLGAALDYLLMAFSTTLWMLY-----------------------------------------------
S22A7_BOVIN     XXXXXXXXXXXXXXXXXXYIMFAITRTLTGMAL-AGFTIIVMPLELEWLDVRHRTVAGVLSSTFWTGGVM
S22A2_PIG       LTILINAVSGVLMAISPTYTWMLVFRLIQGLVSKAGWMIGYILI--------------------------
PHT16_ORYSJ     ITLMLMVLCSLASALSFGHATLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGFGIIT
PHT11_ORYSJ     FTLILMVVCSVASGLSFGVSTLCFFRFWLGFGIGGDYPLSATIMSEYANKRTRGAFIAAVFAMQGFGILF
MDTD_SERP5      SAIVLFTLGSILCARSETLNELIASRVVQGIGGAMMVPVGRLTVMKIVPREQYMAAMTFVTLPGQIGPLM
HXT3_YEAST      XXXXXXXXXXXXXXXXNKWYQYFIGRIISGLGVGGIAVLSPMLISEVAPKEMRGTLVSCYQLMITLGIFL
YCAD_SALTY      LASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYYMGTFL
YCAD_SALTI      LASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYYMGTFL
YCAD_SALSV      LASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYYMGTFL
YCAD_SALPK      LASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYYMGTFL
YCAD_SALPC      LASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYYMGTFL
YCAD_SALPA      LASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYYMGTFL
YCAD_SALNS      LASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYYMGTFL
YCAD_SALHS      LASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYYMGTFL
YCAD_SALCH      LASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYYMGTFL
YCAD_SALA4      LASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYYMGTFL
Y2171_CITK8     IASLIFAAGCVGLGMMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
VGL2B_DANRE     AAILLTSTLNMFSAARVHYGCVMFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVV
TUB3_AGRVI      -----------LMAFVQGTTSFYILRFLLGVAEAGFFPGIILYLSFWFPARRRAAVTALFMAAAPLSTVL
S22FL_XENLA     FDIIFGYFTALAPSYEVFAVSRFFVGVMNGGMALVSFVLTQEYVGKSYWALTGSLTNLIFAVGIAFYALL
PCFT_XENLA      -------LPCIGLALQAAYQELHVGYFLIGSGISGDFNMIFAYIADVSDRQSRTFRVAVLEACLGIAGMV
MDTD_SHIF8      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
GLPT_HUMAN      FGMLAS------GAFTALFGLGYFYQVINGLVQTTGWPSVVTCLGNWFGKGRRGLIMGVWNSHTSVGNIL
YCAD_SALAR      LASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYYVGTFL
YBN1_SCHPO      YGXXXXXMPKSIHSPLSKMMWVFCWRWLLGVGIGGDYPMSAAITSERSKIKRRGTLISLIFAFQGFGTLA
YB91_YEAST      GASAMCMVXXXXXXXXXXXXXXXXGRFLVGMSCGTAIVITPLFINEIAPVEWRGAMGSMNQVSINLGILL
TUB4_AGRVI      -----------LMAFVQGTTSFYALRFLLGVAEAGFFPGIILYLSFWFPARRRAAVTAIFMAAAPLSTVL
SPX2_XENLA      GGMIISGIFTSFMGFGYYWNIHALWQILNGLAQTTGWPAVVTCMGNWFGKGKRGFIMGIWNSHTAVGNIL
S22A6_MACFA     LNYLQTAVSGTCAAFAPNFPIYCAFRLLSGMSLAGIALNCMTLNVEWMPIHTRACVGTLIGYVYSLGQFL
PHT13_ORYSJ     FTLVLMVVCSVASSFGRTVATLCFFRFWLGFGIGGDYPLSATIMSEYANKRTRGAFIAAVFAMQGFGILF
PBUE_BACSU      IALFVFFLSNLVAYFSPNFATLMVSRVLAAMSTGLIVVLSLTIAPKIVAPEYRARAIGIIFMGFSSAIAL
MDTD_ESCF3      TAIVLFTLGSLFCALSATLNELLLARALQGVGGAMMVPV-------------------------------
HXT16_YEAST     IVVLVYMVGAIIQISSHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFL
HXT15_YEAST     IVVLVYMVGAIIQISSHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFL
GTR7_MOUSE      NNVFAITSAVLMSKVARAFELIILSRVLVGICAGIAYSTLPMYLGELAPQNLRGALGTMTEVFVIIGVLL
GTR2_MOUSE      AASLTGALLMGCSKFGPAHALIIAGRSVSGLYCGLISGLVPMYIGEIAPTTLRGALGTLHQLALVTGILI
GTR2_CHICK      VNVLAGNLLMGLAKMGPSHILIIAGRAITGLYCGLSSGLVPMYVSEVSPTALRGALGTLHQLAIVTGILI
YI32_SCHPO      TSIVLFLFGSAMCGAAQNMLWLVLCRAVQGIGGGGIMSLVTIVIADITPLQTRPYYTGCMGVTWGVASVM
SOTB_PSEA7      GVFLLFIASHVLSGLAWNFPVLM----LSRIGIAFAHAVFWAITASLAVRVQQAKXXXXXXXXXXXXXXX
SETA_ECOLI      FCCLMAIGNALLFAFNRHYLTLITCGVLLASLANTAMPQLFALAREYADNSAREVVMSVMRAQLSLAWVI
S22AL_MOUSE     LTMAMHTGFSFIQVFSVNFEMFTLLYTLVGMGHISNYVAAFVLGTEMLSKSVR---IIFATLGVCIFFAF
S22A6_PONAB     LNYLQTAVSGTCTAFAPNFSIYCAFRLLSGMSLAGISLNCMTLNVEWMPIHTRACVGTLIGYVYSLGQFL
MDTD_SHISS      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_SHIFL      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_SHIBS      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_SHIB3      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ERWCT      AAILLFTLGSLLCARSETLDELLISRVIQGIGGAMMVPV-------------------------------
MDTD_ECOUT      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECOSM      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECOSE      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECOLU      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECOLI      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECOLC      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECOL6      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECOL5      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECOK1      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECOHS      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECODH      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECOBW      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECO8A      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECO81      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECO7I      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECO5E      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECO57      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECO55      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECO45      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECO27      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
MDTD_ECO24      TAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPV-------------------------------
GTR2_RAT        AASLTGALLMGCSKFGPAHALIIAGRSVSGLYCGLISGLVPMYIGEIAPTTLRGALGTLHQLALVTGILI
Y1317_METJA     IGYIVYGIVSLGFAYFISQKSLILLFALYGIAYALFAGNQKAYVSDLSSEDIRATALGLFYTVVGLTSLP
SPX3_CHICK      FSALVVFFFGTLTEWLHFYNKWFYW-VVNGLLQSTGWPCVVAVMGNWFGKAGRGFVFGLWSACASVGNIL
S22AA_HUMAN     WCLLQLAITDTCAAFAPTFPVYCVLRFLAGF---SSMIIISNNSLPSTEWIRKALVVILSSGALSIGQI-
QAY_NEUCR       FSVVFIIGAAIMLAADRGIDPIIAGRVLAGIGVGGASNMVPIYISELAPPAVRGRLVGIYELGWQIGGLV
GTR1_CHICK      MSNILAFLAAVLMGFSKSFEMLILGRFIIGLYSGLTTGFVPMYVGEVSPTALRGALGTFHQLGIVLGILI
CF192_HUMAN     FGMLLGPVPILKXXXXXXXXXXXXXXXXAGMSIIPTFPEILSCAHENFEESTLGLVSGLFSAMWSIGAFM
VMAT2_HUMAN     AGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYDDEERGNXXXXXXXXXXXXXXX
VGLU1_XENLA     FAIVATSTLNMLSAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVV
SPX2_XENTR      YYLSGGMIIC--GIFTSFMGLGYYWQILNGLAQTTGWPSVVTCMGNWFGKGKRGFIMGIWNSHTAVGNIL
SOTB_PSEAE      GVFLLFIASHVLSGLAWSFQVLM----LSRIGIAFAHAVFWAITASLAVRVQQAKXXXXXXXXXXXXXXX
SOTB_PSEAB      GVFLLFIASHVLSGLAWSFQVLM----LSRIGIAFAHAVFWAITASLAVRVQQAKXXXXXXXXXXXXXXX
SOTB_PSEA8      GVFLLFIASHVLSGLAWSFQVLM----LSRIGIAFAHAVFWAITASLAVRVQQAKXXXXXXXXXXXXXXX
SOTB_ERWCT      KIFILFAISNVLSGLAWNYWVLIMARIGVALSHAVFWSITASLVVRLAPADKKAQXXXXXXXXXXXXXXX
S22AC_RAT       WSYLLVSVSGTIAALMPTFPLYCLFRFLVASAVAGVMMNTASLLMEWTSAQAGPLMMTLNALGFSFGQVL
S22A6_HUMAN     LNYLQTAVSGTCAAFAPNFPIYCAFRLLSGMALAGISLNCMTLNVEWMPIHTRACVGTLIGYVYSLGQFL
S226A_XENLA     WSYFQMAVSGLCSAFSPNYLSYCIFRFLTGMALSGIGLNTTALIVEWVPTRVRTITGTLAGFSYTVGQLL
PROP_STAAW      STIILMAFSTLTIGLLPSYDQIGLWRVLQGFSTGGEYAGAMTYVAESSPDKRRNS----LGSGLEIGTLS
PROP_STAAS      STIILMAFSTLTIGLLPSYDQIGLWRVLQGFSTGGEYAGAMTYVAESSPDKRRNS----LGSGLEIGTLS
PROP_STAAR      STIILMAFSTLTIGLLPSYDQIGLWRVLQGFSTGGEYAGAMTYVAESSPDKRRNS----LGSGLEIGTLS
PROP_STAAN      STIILMAFSTLTIGLLPSYDQIGLWRVLQGFSTGGEYAGAMTYVAESSPDKRRNS----LGSGLEIGTLS
PROP_STAAM      STIILMAFSTLTIGLLPSYDQIGLWRVLQGFSTGGEYAGAMTYVAESSPDKRRNS----LGSGLEIGTLS
PROP_STAAC      STIILMAFSTLTIGLLPSYDQIGLWRVLQGFSTGGEYAGAMTYVAESSPDKRRNS----LGSGLEIGTLS
PROP_STAA1      STIILMAFSTLTIGLLPSYDQIGLWRVLQGFSTGGEYAGAMTYVAESSPDKRRNS----LGSGLEIGTLS
PLST3_ARATH     LSALPMIVGASVSASTESLMGMLLGRFLVGIGMGIGPSVTALYVTEVSPAYVRGTYGSSTQIATCIGLLG
OXLT_OXAFO      VVFGINAVVLALFPTIAALGDVAFMLAIAFFTWGGSYALFPSTNSDIFGTAYSARNYGFFWAAKATASIF
NEPI_SALPK      LFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAISASLTMRLVPARTVPKALSVIFGAVSIALVI
NEPI_SALPA      LFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAISASLTMRLVPARTVPKALSVIFGAVSIALVI
MFSD9_MOUSE     VCIXXXXXXXXXXGMSTNV--FLFTLARVPVGVFKTLSISRALLSDLVTEKERPLVLGQFNTASGVGFIL
ERDL2_ARATH     ISDVCCIFGWLAVAFAHDIIMLNTGRLFLGFGVGLISYVVPVYIAEITPKTFRGG----FSYSNQLLQCL
YHD1_SCHPO      YGXXXXXMPKSIHSPLSKMMWVFCWRWLLGVGIGGDYPMSAAITSERSKLNRRGTLISLIFAFQGFGTLA
SPX3_HUMAN      FSALVVFVFGALTEWLRFYNKWLYW-IVNGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNIL
S22A6_PIG       LNYLQTAVSGTCAAFAPNFPVYCAFRLLSGMSLAGISLSCMTLNVEWMPIHTRACVGTLIGYVYSLGQFL
QAY_NEUTR       FSVVFIIGAAIMLAADRGIAPIIAGRVLAGIGVGGASNMVPIYISELAPPAVRGRLVGIYELGWQIGGLV
PHT17_ARATH     MTLMVMVLCSIASGLSFGSNPLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAGILTGGIF
GTR11_HUMAN     NNIFVVSAAILFG-FSRKAGSIMLGRLLVGVNAGVSMNIQPMYLGESAPKELRGAVAMSSAIFTALGIVM
GIT1_YEAST      VALVIGSALCAASHGTTVPG--MFWRGLVGIGVGAEYPTSTLSANESANETKRGGILVMVTN--------
ANTR5_ARATH     LSFVLWSSTCFLVPLDPNXXXXXXXXXXXXXXXGFIFPSIHTVLAQWVPPHERSRLVSITTSGMYLGAAL
YBJJ_ECOLI      ASALMGALGIGLIIFVDSAWVAGVSVVLWGLGASLGFPLTISAASDTGPDAPTR--VSVVATTGYLAFLV
VMAT2_BOVIN     TGFCIMFISTVMFAFSRTYAFLLIARSLQGIGSSCSSVAGMGMLASVYDDEERXXXXXXXXXXXXXXXXX
TPPB_ECOLI      LGAIVLAIGYALVAWSHDAGIVYMGMAAIAVGNGLFKANPSSLLSTCYEDPRLDGAFTMYYMSVNIGSFF
TPPB_ECOL6      LGAIVLAIGYALVAWSHDAGIVYMGMAAIAVGNGLFKANPSSLLSTCYEDPRLDGAFTMYYMSVNIGSFF
TPPB_ECO57      LGAIVLAIGYALVAWSHDAGIVYMGMAAIAVGNGLFKANPSSLLSTCYEDPRLDGAFTMYYMSVNIGSFF
PROP_STAHJ      TTIILMALSTLTIGVLPNYDMIGLWRILQGFSTGGEYAGAMTYIAEISPDKKRNS----LGSGLEIGTLS
PHT15_ARATH     ITLMLMVLCSLGSGLSFGHSALCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGFGILA
YCAD_SHIFL      LSSFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_SHIF8      LSSFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
PROP_STAEQ      TTIILMAFSTLLIGVLPTYNEIGVWRVLQGFSTGGEYAGAMVYVAESSPDRKRNS----LGCGLEIGTLS
NEPI_SALTY      LFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAMSASLTMRLVPARTVPKALSVIFGAVSIALVI
NEPI_SALTI      LFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAMSASLTMRLVPARTVPKALSVIFGAVSIALVI
NEPI_SALPC      LFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAMSASLTMRLVPARTVPKALSVIFGAVSIALVI
NEPI_SALPB      LFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAMSASLTMRLVPARTVPKALSVIFGAVSIALVI
NEPI_SALCH      LFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAMSASLTMRLVPARTVPKALSVIFGAVSIALVI
MDTG_CITK8      TALIISVLLLIPMSFVQTPWQLGVLRFXXXXXXXXXXXXVQTLLVYNASNQIAGRIFSYNQSFRDIGNVT
HXT7_YEAST      XXXXXXXXXXXXXXXXNKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHLRGTLVSCYQLMITAGIFL
HXT6_YEAST      XXXXXXXXXXXXXXXXNKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHLRGTLVSCYQLMITAGIFL
HXT4_YEAST      XXXXXXXXXXXXXXXXNKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHIRGTLVSCYQLMITLGIFL
EDL17_ARATH     VSDFLCITGWLSIAFAKEVVLLNFGRIISGIGFGLTSYVVPVYIAEITPKHVRGTFT--FSNQLLQNAGL
YM8M_YEAST      VGYVIVIVWSIISGLSKSNSDAFFSRAFQGVGIAFILPNIMGLVGHVY----------------------
YDJK_ECOLI      LYEAIHIASMVVGAFSPNMDFLIACRFVMGVGLGALLVTLFAGFTEYMPGRNRGRVSFIGNWSYPLCSLI
S22AO_PONAB     LCFLQLAISNTCAAFAPTFLVYCILRFLAGFSTMTILGNTFILSLEWTLPQSRSMAIMVLLCSYSVGQ--
PHT11_ARATH     YGLTLVMMILCSVASGLSFGHLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGV----
OCT1_CAEEL      VILTVLIVCGTASSFAKDIESFIILRFFTGLAFPALFQIPFIICMEFMG--NSGRIFSGLMTSLFFGAAM
NPT1_HUMAN      FALCLSSVLSLLIPPAAGIGVAWVCRAVQGAAQGIVATAQFEIYVKWAPPLERGRLTSMSTSGFLLGPFI
NEPI_SALG2      LFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAMSASLTMRLVPARTVPKALSVIFGAVSIALVI
NEPI_SALEP      LFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAMSASLTMRLVPARTVPKALSVIFGAVSIALVI
GTR3_MOUSE      VNLLAIIAGCLMAKIAESVEMLILGRLLIGIFCGLCTGFVPMYIGEVSPTALRGAFGTLNQLGIVVGILV
ANTR6_ARATH     IGVFTWSFTALVPLLAGFMPGLIFSRILVGIGEGVSPSAATDLIARTIPVKERSRAVGFV----------
YCAD_ECOUT      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECOL6      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECOL5      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECOK1      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECO81      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECO45      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
Y411_BUCBP      IGLLCFLLGNIIAWSSNSIWGIILGRGLQGSGAISS--VCMTLLSELVLPHNRIKIMGLLGVSFGISFFL
STP12_ARATH     SMLLGGVLFCLLNGFATAVWMLIVGRLLLGFGIGFTNQSVPLYLSEMAPYKYRGALNIGFQLSITIGILV
SPX3_MOUSE      FSAFVVFVFGTLTEWLHFYNKWFYW-IVNGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNIL
QAY_NEUAF       FSVVFIIGAAIMLAADRGVDPIIAGRVLAGIGVGGASNMVPIYISELAPPAVRGRLVGIYELGWQIGGLV
PHT13_ARATH     ITLIMMILCSVASGLSLGNSALCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGV----
PHT12_ARATH     YGLTLIMMILCSVASGLSFGNLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGV----
GTR14_HUMAN     VNLLAATGGCLMGKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILV
BCRH_RICBR      FGLCIYAXXXXXXXFAPNIETLMLARFVQAFGVSVGSVIGQAMARDSYQGSELSYVYASLSPWLLFIPXX
YKH4_CAEEL      ISVALYILVTVITPFLATYFSVFLARIGMGLGEGFVFPTNNAIIGNWFPSSEKSTALSIFTLGNQIASAA
YJDL_ECOLI      GALLMTLGHVVLGIDTNSTFSLYLALAIIICGYGLFKSNISCLLGELYDENRRDGGFSLLYAAGNIGSIA
YHA8_SCHPO      YIVL--QIPC---ALAPNIACLLIVRFFCGCFGCTPLTLAGGVISDVWETRERGLAIAFFAAGPYAGPTL
YFNC_BACSU      VGLTASMLGILGLAFAPSFITILCCVFFIGLG-SAIFHPEGSRVAYMAAGTKRGLAQSIYQVGGNSGQAM
YCAD_SHISS      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_SHIDS      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECOSM      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECOSE      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECOLU      LASFIFAAGCAGLGLMIGFWSWLTWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECOLI      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECOLC      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECOHS      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECODH      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECOBW      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECO8A      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECO7I      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECO5E      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECO57      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECO55      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECO27      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
YCAD_ECO24      LASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYYVGTFL
VGLU3_HUMAN     AAIFLTSTLNMFSAARVHYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVV
SPX3_BOVIN      FSALVVFVFGTLTEWLHFYNKGLYW-IVNGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNIL
S22A5_MOUSE     LTMGMQTGFSFLQVFSVNFEMFTVLFVLVGMGQISNYVAAFVLGTEILSKSIR---IIFATLGVCIFYAF
MFS10_BOVIN     LSLAGVATSYAVWXXXXXXXXXXXXRVIGGISKG-NVSLCTAIVADLGSPSARSKGMAVIGVAFSLGFTL
FTSK_CHLTE      ----------------------------------------------------------------------
ENB1_YEAST      FALVLYTIGEIISAATPTFSGLFAGIVIQQFGYSGFRLLATALTGDLSGLRDRTLIPVIINTWVS-GNIV
EMRD_ECOLI      VGMSIFMXXXXXXXXXXXXXXXIAASAMQXXXXXXXXXXARTLPRDLYERTQLRHANSLLNMGILVSPLL
CMLR_STRLI      ---------------------------------------------------KQGRALAVLLSGTTVATVA


                         +         .         .         .         .         *         .:210
query           GMIVGGFLGPKYGWRVPFIAVSVPNIFFAVLSIFVLKEPKRGAFEKGIGELVQSGYEYPKAPKLSDYAKL
SPNS1_XENTR     GYIAGSKVTSTAGWHWALRVTPGLGLVAVLLLIFVAKEPPRGALER------KSDRPLTNTSWFSDVKAL
EXUT_BACSU      SGPIVGMIAVAFSWKVSFVLIMIIGLIWAVLWFKFVKEKPQETIKEAIKAETSPGEKIPLTFYLKQFTAF
SPNS1_XENLA     GYIVGSEMTSAAGWHWALRVTPXXXXXXXXXXIFVAEEPPRGALER------------------------
YIM0_YEAST      GALIGAGLSSKWGWRAIFWFLAIGSGICLVFSTLLMPETKR-----------------------------
SPIN_DROME      GYIVGAHLANDWRWALPILGI------VAVFLILLIKDPVRGHSE-------------------------
YOU1_CAEEL      EALLAYFVMESFGWRALMFLSSLPLGIFAVASFWL---PESARFDMASG---------------------
SPNS3_DANRE     GYIIGATVADATGWRWALRVSPAXXXXXXXXXVFLIPNPPRGASDNGGANMETTSY--------------
PCAK_ACIAD      GMAIGGFISPAFGWHSLFLLGGWAPLILMLLVIFFLPESYRFLIVKG-----------------------
MDTL_SALTY      APVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR------------------------------
MDTL_SALPB      APVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR------------------------------
MDTL_SALNS      APVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR------------------------------
MDTL_SALHS      APVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR------------------------------
MDTL_SALA4      APVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR------------------------------
MUCK_ACIAD      ATLLAGWLIPDHGWRVLFYVAIIP-VLMAVLMHFFVPEP-------------------------------
MDTL_SALEP      APVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR------------------------------
MDTL_SALDC      APVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR------------------------------
MDTL_SALAR      APVLGHLIMLRFPWQSLFYTMSAMGIIVCLLSLFILRETR------------------------------
YITG_BACSU      SPIIGSLIA-LLVWYGAFFAFPV----FCIISI-------------------------------------
MDTL_SALTI      APVMGHLIMLRFPWQSLFYTMSTMGIMVGLLSLFILRETR------------------------------
MDTL_SALSV      APVMGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR------------------------------
MDTL_SALPK      APVMGHLIMLRFPWQSLFYTMSTMGIIVGLLSLFILRETR------------------------------
MDTL_SALPA      APVMGHLIMLRFPWQSLFYTMSTMGIIVGLLSLFILRETR------------------------------
MDTL_SALPC      APVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR------------------------------
MDTL_SALCH      APVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILRETR------------------------------
YYBF_BACSU      GRIVSGLLSEYLNWHMAMGTIGVISLIASVI-FFINLPPSR-----------------------------
SPNS1_DANRE     GYIVGSKVDTAKDWHWALRVTPGXXXXXXXXXXXXXQEPKRGAIE-------------------------
BMR3_BACSU      GPLLGAIITDSISWHWVFVPIGALSLFFII----------------------------------------
SVOP_PONAB      EVVLAVFVMPSLGWRWLLILSAVPLLLFAVL-CFWLPESARGNQEKAIATL-------------------
SVOP_HUMAN      EVVLAVFVMPSLGWRWLLILSAVPLLLFAVL-CFWLPESARGNQEKAIATL-------------------
SVOP_BOVIN      EVVLAVFVMPSLGWRWLLILSAVPLLLFAVL-CFWLPESARGNQEKAIATL-------------------
MDTL_KLEP3      APVLGHLIMLKYPWQSLFYTMTGMGVMVGLLSVFILRETR------------------------------
MDTL_KLEP7      APVLGHLIMLKYPWQSLFYTMTGMGVMVAVLSVFILRETR------------------------------
ANTR3_ARATH     GLLLTPLMLSSIGISGPFILASLGLLWVSTWSSGVTNNPQDSPFTRSELRLIQAGKPVQPSPKPNPSLRL
NANT_YERPY      AAQAYSYVVPAFGWRMLFYIGLLPIIF-------------------------------------------
MDTL_VIBPA      APVIGHLIMLKFPWPSLFTTMAGMGILVSVLAIFVLKE--------------------------------
NANT_YERPS      AAQAYSYVVPAFGWRMLFYIGLLPIIF-------------------------------------------
NANT_YERPP      AAQAYSYVVPAFGWRMLFYIGLLPIIF-------------------------------------------
NANT_YERPG      AAQAYSYVVPAFGWRMLFYIGLLPIIF-------------------------------------------
NANT_YERPB      AAQAYSYVVPAFGWRMLFYIGLLPIIF-------------------------------------------
NANT_YERP3      AAQAYSYVVPAFGWRMLFYIGLLPIIF-------------------------------------------
GUDP_BACSU      FSPLMGWLTHSFGWHSVFVVMGIAGILLAVIWLKTVYEPKKHAYIEQGGGLISMDDSKSKQETESKWPYI
SPNS3_MOUSE     GYVLGSTVAELTGWRWALRLMPCXXXXXXXXXXXXVPDVPRGAAEK------------------------
SPNS3_HUMAN     GYVLGSAVTMLTGWRWALRVMPCLEXXXXXXXXXXXPDPPRGAAE-------------------------
MDTL_ECOSE      APVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETRPAA---------------------------
MDTL_ECOLI      APVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETRPAA---------------------------
MDTL_ECODH      APVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETRPAA---------------------------
MDTL_ECOBW      APVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETRPAA---------------------------
MDTL_ECO55      APVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETRPAA---------------------------
SV2C_HUMAN      ASAMAWAIIPHYGWRVFVIVCALPCVSSVVALTFMPESPR------------------------------
MDTL_ESCF3      APVLGHLIMLKFPWQSLFWAMATMGIAVLMLSLFILKETRPAA---------------------------
MDTL_SHISS      APVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR------------------------------
MDTL_SHIFL      APVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR------------------------------
MDTL_SHIDS      APVLGHLIMLKFPWQSLFWTMAIMGIAVLMLSLFILKETRPAA---------------------------
MDTL_SHIBS      APVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR------------------------------
MDTL_SHIB3      APVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR------------------------------
MDTL_ECOUT      APVLGHLIMLKFPWQSLFWTMATMGIALLMLSLFILKETRPAA---------------------------
MDTL_ECOLC      APVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR------------------------------
MDTL_ECOK1      APVLGHLIMLKFPWQSLFWTMATMGIALLMLSLFILKETRPAA---------------------------
MDTL_ECOHS      APVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR------------------------------
MDTL_ECO5E      APVLGHLIMLKFPWQSLFWTMAIMGIAVLMLSLFILKETRPAA---------------------------
MDTL_ECO57      APVLGHLIMLKFPWQSLFWTMAIMGIAVLMLSLFILKETRPAA---------------------------
MDTL_ECO45      APVLGHLIMLKFPWQSLFWTMATMGIALLMLSLFILKETRPAA---------------------------
VACHT_DANRE     APPFGGILYEFAGKRVPFIVLACVCLADGVLLLTVVK---------------------------------
TCRB_BACSU      GPAIGGMVAHYIHWSY-LLLIPTATIITVPFLIKLLKKEER-----------------------------
SPNS2_XENTR     GYITGSSVKQVAGWRWALRVSPVLGVITGTLLLIFVPTAKRGHAEQ------------------------
PHDK_NOCSK      GAYLAAAVIPTLGWQVMVXXXXXXXXXXXXFFVALVPEPAIISVRRGIPE--------------------
MDTL_ECOL5      APVLGHLIMLKFPWQSLFWTMATMGIAVLMLSLFILKETRPAA---------------------------
MDTL_ECO27      APVLGHLIMLKFPWQSLFWTMATMGIAVLMLSLFILKETRPAA---------------------------
ANTR2_ARATH     GLAFSPMLITKFGWPSVFYSFSLGSIWFLLWLKFAYSSPK------------------------------
PHT43_ORYSJ     GLLLSPIIMSRAGIFGPFV---------------------------------------------------
MDTL_ECO7I      APVLGHLIMLKFPWQSLFWTMATMGIAILMLSLFILKETRPAA---------------------------
YIM1_YEAST      GALIGAGLSSRWGWRAIFWFLAIGSGICFLASFLILPETKRNI--SGNGSVTPKSY--------------
SVOP_XENLA      EVLLAIFVMPTLGWRWLLILSALPLMLFAILCFWLLATLKRIATENGLGKLIVSRQE--DRGKIRDLFSP
SOTB_SHISS      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_SHIFL      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_SHIF8      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_SHIBS      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_SHIB3      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECOSM      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECOSE      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECOLU      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECOLI      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECOLC      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECOHS      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECODH      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECOBW      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECO8A      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECO7I      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECO5E      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECO57      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECO55      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECO24      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
MDTL_ECOSM      APVLGHLIMLKFPWQSLFWTMATMGIAVLMLSLFILKETRPAA---------------------------
MDTL_ECOLU      APVLGHLIMLKFPWQSLFWTMATMGIAVLMLSLFILKETRPAA---------------------------
TPO3_YEAST      GPLVNGFISVSTG---------------------------------------------------------
MDTL_ECOL6      APVLGHLIMLNFPWQSLFWTMAIMGVAVLMLSLFILKETRPAA---------------------------
MDTL_ECO8A      APVLGHLIMLKFPWQSLFWTMAMMGIAVLMLSLFILKETR------------------------------
MDTL_ECO81      APVLGHLIMLNFPWQSLFWTMAIMGVAVLMLSLFILKETRPAA---------------------------
MDTL_ECO24      APVLGHLIMLKFPWQSLFWTMAMMGIAVLMLSLFILKETR------------------------------
GARP_ECOLI      FSPLLGWLTFAWGWEHVFTVMGVIGFVLTALWIKLIHNPEELKFISENGAVVDMDHKKPSGPKLHYIKQL
GARP_ECO57      FSPLLGWLTFAWGWEHVFTVMGVIGFVLTALWIKLIHNPEELKFISENGAVVDMDHKKPSGPKLHYIKQL
SV2C_RAT        ASAMAWAIIPHYGWRVFVIVCALPCVSSVVALTFMPESPR------------------------------
SV2B_HUMAN      ASAMAWSIIPHYGW--------------------------------------------------------
MDTL_CITK8      APVLGHLIMLKFPWQSLFYTMIAMGIAVCLLSVFILKETR------------------------------
VBA5_YEAST      GPIIGGAFTTHVTWR-------------------------------------------------------
SV2C_MOUSE      ASAMAWAIIPHYGWRVFVIVCALPCVSSVVALTFMPESPR------------------------------
PHT41_ORYSJ     GLAFSPLLIHNFGWPSVFYSFGSLGVFW------------------------------------------
NANT_YERPE      AAQAYSYVVLAFGWRMLFYIGLLPIIF-------------------------------------------
NANT_YERPA      AAQAYSYVVLAFGWRMLFYIGLLPIIF-------------------------------------------
NANT_SALTY      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_SALTI      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_SALSV      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_SALPK      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_SALPC      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_SALPB      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_SALPA      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_SALNS      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_SALHS      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_SALG2      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_SALEP      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_SALDC      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_SALCH      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_SALAR      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
ANTR1_ARATH     GLAFSPFLIHQFGW---------PSVFYSFGSL-------------------------------------
VACHT_RAT       APPFGGILYEFAGKRVPFLVLAAVSLFDALLLLAVAK---------------------------------
TPO2_YEAST      GPLVNGFISVSTG---------------------------------------------------------
SPNS1_HUMAN     GYIAGSKVKDMAGWHWALRVTPGXXXXXXXXXXXXXREPPRGAVER------------------------
MDTM_ECO57      GPLSGAALMHFVHWKVLFAIIAVMGISFVGLLLAMPETVKRGA---------------------------
MDTL_SHIF8      APVLGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILKETR------------------------------
AQR1_YEAST      GSLIGAVLTARWDWRAIFWFLTIGCGSCFLIAFLILPETKR-----------------------------
SPNS1_RAT       GYIAGSKVKDLAGWHWALRVTPGXXXXXXXXXXXXXQEPPRGAVERHSG---------------------
SPNS1_MOUSE     GYIAGSKVKDVAGWHWALRVTPGXXXXXXXXXXXXXQEPPRGAVERHSG---------------------
SOTB_ECOUT      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECOL6      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECOL5      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECOK1      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECO81      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECO45      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
SOTB_ECO27      GLPLGRIVGQYFGWRMTFFAIGI-----------------------------------------------
YWOD_BACSU      GPTAGGFLIVWGGWPAIFI-VNLPFIILSLLGLYMFKDQKKGAGIKTI----------------------
SOTB_SALTY      GLPIGRVVGQYFGWRTTFFAIGM-----------------------------------------------
SOTB_SALNS      GLPIGRVVGQYFGWRTTFFAIGM-----------------------------------------------
VACHT_HUMAN     APPFGGILYEFAGKRVPFLVLAAVSLFDALLLLAVAK---------------------------------
NANT_CITK8      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
MDTM_ECOLI      GPLSGAALMHFMHWKVLFAIIAVMGISFVGLLLAMPETVKRGA---------------------------
VACHT_MOUSE     APPFGGILYEFAGKRVPFLVLAAVSLFDALLLLAVAK---------------------------------
TCR_STRPN       GPAIGGMIAHYIHWSYLLLIPMITIITVPFLMKLLKKEVRKGHFDKGI----------------------
TCR_BACSU       GPAIGGMIAHYIHWSYLLLIPMITIITVPFLMKLLKKEVRKGHFDKGI----------------------
TCR_BACST       GPAIGGMIAHYIHWSYLLLIPMITIITVPFLMKLLKKEVRKGHFDKGI----------------------
TCR_BACCE       GPAIGGMIAHYIHWSYLLLIPMITIITVPFLMKLLKKEVRKGHFDKGI----------------------
SPNS2_MOUSE     GYITG-----------------------------------------------------------------
SPNS2_HUMAN     GYITG-----------------------------------------------------------------
NANT_ESCF3      AAQVYSLVVPLWGWRALFFIGILPIIF-------------------------------------------
BENK_ACIAD      AAFLGSILVPLYGWKIMFMIAGI-----------------------------------------------
YCEI_BACSU      AALISYFVIPSFGWQ-------------------------------------------------------
TCR_STRAG       GPAIVGMIAHYIHWSYLLLIPMITIITVPFLMKLLKKEVRKGHFDKGISFLIVSVLSFKHIRKVTDPFVD
PMRA_STRR6      GPFIGGFIAELFGIRTVFLLVGSFLFLAAILTICFIKE--------------------------------
PMRA_STRPN      GPFIGGFIAELFGIRTVFLLVGSFLFLAAILTICFIKE--------------------------------
YYAJ_BACSU      TNIVSAFVIPSWGWRLVFVWGAVGLIYF--FFIHRLEEENRGEYAKADAILTRIEEQVEKQPKVSEYAGL
SOTB_CITK8      GLPIGRIVGQYFGWRTTFFAIGIGALITLVCLIKLL----------------------------------
DGOT_ECOLI      LTPLLIWIQEMLSWHWVFIVTGGIGIIWSLIWFKVYQPPR---LTKGISK--------------------
DGOT_ECOL6      LTPLLIWIQEMLSWHWVFIVTGGIGIIWSLIWFKVYQPPR---LTKGISK--------------------
PLT6_ARATH      GYIVNYFLPMHIGWRLMLGIAAVPSL---VLAFGILKMPE------------------------------
BCR_HAEIN       APIIGGYIVKFFHWHAIFYVISLVGXXXXXXVFFIIPE--------------------------------
AZR1_YEAST      GPFLGGVFTSSVTWR-------------------------------------------------------
PLT5_ARATH      GYVSNSNLPLKVGWRLMLGIGAVPSVILAIGVLAMPESPRWLVMQGRLGD--------------------
NANT_SHIFL      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_SHIF8      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_SHIB3      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_ECOSM      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_ECOSE      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_ECOLI      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_ECOLC      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_ECOL5      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_ECOHS      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_ECODH      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_ECOBW      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_ECO8A      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_ECO7I      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_ECO5E      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_ECO57      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_ECO55      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_ECO45      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_ECO27      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT_ECO24      AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
NANT1_ECOL6     AAQVYSLVVPVWGWRALFFIGILPIIF-------------------------------------------
YRT3_CAEEL      GLPASAYLVSHFSWSTPFYVFGVVGIIWSLIWMYV-----------------------------------
TCR_STAHY       GPAIGGMIAHYIHW--------------------------------------------------------
SVOP_MOUSE      EVLLAVFVMPSLGWR-------------------------------------------------------
SOTB_SALTI      GLPIGRVVGQYFGWRTTFFAIGM-----------------------------------------------
SOTB_SALSV      GLPIGRVVGQYFGWRTTFFAIGM-----------------------------------------------
SOTB_SALPK      GLPIGRVVGQYFGWRTTFFAIGM-----------------------------------------------
SOTB_SALPC      GLPIGRVVGQYFGWRTTFFAIGM-----------------------------------------------
SOTB_SALPB      GLPIGRVVGQYFGWRTTFFAIGM-----------------------------------------------
SOTB_SALPA      GLPIGRVVGQYFGWRTTFFAIGM-----------------------------------------------
SOTB_SALHS      GLPIGRVVGQYFGWRTTFFAIGM-----------------------------------------------
SOTB_SALG2      GLPIGRVVGQYFGWRTTFFAIGM-----------------------------------------------
SOTB_SALEP      GLPIGRVVGQYFGWRTTFFAIGM-----------------------------------------------
SOTB_SALDC      GLPIGRVVGQYFGWRTTFFAIGM-----------------------------------------------
SOTB_SALCH      GLPIGRVVGQYFGWRTTFFAIGM-----------------------------------------------
SOTB_SALAR      GLPIGRVVGQYFGWRTTFFAIGM-----------------------------------------------
SOTB_SALA4      GLPIGRVVGQYFGWRTTFFAIGM-----------------------------------------------
PHT44_ORYSJ     GLAFSPLLISRFGWPSVFYAFSLGSVWFAL----------------------------------------
YQJV_BACSU      GPVLGLYFGSSQSTTPFLVPAVIYGLYGIVLALQFKKHPSLSA---------------------------
EMRB_ECOLI      GPILGGYISDNYHWGWIFF-INVP----------------------------------------------
EMRB_ECO57      GPILGGYISDNYHWGWIFF-INVP----------------------------------------------
SVOP_RAT        EVLLAVFVMPSLGWR-------------------------------------------------------
SPNS1_BOVIN     GYIAGSKVKDVAGWHWALRVTPGXXXXXXXXXXXXXQEPPRGAVER------------------------
YJA1_SCHPO      GPVVSGFIAEYTTYKWIFWSTTIFSGFIFALSLPLLAE--------------------------------
YTBD_BACSU      GVPFGTFIGQQFGWRFAFMVIIAVGIIAFITN----------------GILVPSKLRKGTKTTMRDQLKL
YHX6_SCHPO      GGPVGGYFADQYTWRIGFL-IQVPLIAIAFLCVY------------------------------------
SGE1_YEAST      GPFIGGAFNEHLSWRWCFY-INLPIGAFAFIIL---------AFCNTSGEPHQKMWLPSKIKKIMDYGEL
PLT3_ARATH      GYVSNGKLTLKLGWRLMLGIAAFPSLILA-----------------------------------------
YWTG_BACSU      SYIVNYIFADAEAWR-------------------------------------------------------
YCNB_BACSU      GPTLSGWAVEAFSWRSLFYIILPFAVIDLILASILMK---------------------------------
SPNS2_DANRE     XXXXXXXAKDAGGWYWALRVSPMLGLTAGTLILIFVSEPKRGSADQPGGRL-------------------
S22A7_HUMAN     LLALVGYL--IRDWRWLLLAVTLP-CAPGILSLWWVPESARWLLTQG-----------------------
HXT10_YEAST     GYCT-NYGTKKYSWRVP-LGLCFAWAIFMVIGMVMVPESPRYLVEKG-----------------------
SVOPL_HUMAN     IIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFI---PESARFNVSTG---------------------
QACA_STAAU      GPIIGGALLEQFSWHSAFL-INVPFAIIAVVALFLLPESKLSK---------EKSHSWDIPSTILSIAGM
QACA_STAAM      GPIIGGALLEQFSWHSAFL-INVPFAIIAVVALFLLPESKLSK---------EKSHSWDIPSTILSIAGM
YNFM_ECOLI      GRLISGVFTDFFNWRIALAAIGCFALASALMFWKILPESR------------------------------
YAAU_ECOLI      ADLVGYWLDVEGGWRWMLGSAAIPCLLI-LIGRFELPESPRWLLRKG-----------------------
S22A7_PONAB     LLALVGYL--IRDWRWLLLAVTLP-CAPGILSLWWVPESARWLLTQG-----------------------
GUDP_ECOLI      FAPIMGWLTHEVGWSHVFFFMGGLGIVISFIWLKVIHEPNQ-----------------------------
YWFA_BACSU      GVPLGSFIGGVLHWRWTF----------------------------------------------------
YN43_SCHPO      GPIAGGFLAKSYGWRWTEYITSFMG-FFSTLCLLFMKE--------------------------------
YJJL_ECOLI      SPPILAAMMLVMGWRGMFITIGVLGIFLAI----------------------------------------
Y588_BUCAI      GRLLSSILAEKFSWSISLMVIGLFSFISSCFFLYFLPPSK------------------------------
NEPI_SHISS      AAPLGSFLGELIGWRNVFNAAAVMGIFWIIKSLPSL--PGEPSHQK------QNTFRLLQRP--------
YGAY_ECOLI      ARTVAGLLANLGGWRTVF----------------------------------------------------
YGAY_ECO57      ARTVAGLLANLGGWRTVF----------------------------------------------------
MHPT_ECOLI      ----------------------------------------------------------------------
BMR1_BACSU      XXXXXXXLAEVHS-RLPXXXXXXXXXXXXILSILTLREPER-----------------------------
ATR1_YEAST      GCLFAGLIGPKQ-WPWAFYAYSIAAFINFVLSIYAI----------------------------------
SOTB_ERWT9      GLPIGRMIGQLLGWRITFAVI-------------------------------------------------
YFHI_BACSU      GVPFGSYLGDVLNWRAVFSIITALGVFLGLMAAVPNRKPK------------------------------
Y1560_METJA     XXXXXXXLADMYGIKMPFYFCGFLGILAAIISYMKLED--------------------------------
XYLT_LACBR      AYITNSFSGFYTGWRLGFAAIPAALLFLGGL---ILPESPRFLVKSG-----------------------
PHT42_ORYSJ     SFL-------------------------------------------------------------------
ARAJ_ECOLI      GIPLGTYLSQEFSWRYTFLLIAVFNI--------------------------------------------
S22A1_HUMAN     --ALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPR------------------------------
S17A5_HUMAN     SLPLSGIICYYMNWTYVFYFFGTIGIFWFLLWIWLVSD--------------------------------
NEPI_ECO27      AAPLGGFLGELIGWRNVFAAMGVLCIFWIIKSL-------------------------------------
NASA_BACSU      ATLFGPRLAEQFGWHI------------------------------------------------------
SVOPL_MOUSE     IISMASVVIPTIGWRWLIRIASIPGIILIMAFKFI---PESARFNVSTG---------------------
HXT5_YEAST      GYCT-NFGTKNYSWRVPLGLCFAWSIFMIVGMTFVPESPR---YLVEVGKIEEAKRSLARANKTTEDSPL
EMRB_HAEIN      GPILGGWISDNIHWGWIFF-INVP----------------------------------------------
Y567_BUCAP      GRILSSILAEYFSWHIAFIVIGFFSLMSSCLFLYFLPSSK------------------------------
VACHT_TORCA     APPFGGVLYQFAGKWVPFLVLSFVCLLDGILLLMVV----------------------------------
MSSP3_ARATH     SLVFGMSLQESPSWRLMLGVLSIPSIAYFVLAAFFLPESPRWLVSKG-----------------------
MDTL_SHESA      APVIGHLIMLRFPWPSLFYTMAV-----------------------------------------------
YCR3_YEAST      GPMIGGFL--------------------------------------------------------------
VACHT_TOROC     APPFGGVLYQFAGKWVPFLVLSFVCLLDGILLLMVV----------------------------------
VACHT_TORMA     APPFGGVLYQFAGKWVPFLVLSFVCLLDGILLLMVV----------------------------------
YJHB_ECOLI      AAQIIPQFAEVYGWRNSFFIGLLP----------------------------------------------
S22A2_MOUSE     -LILAGVAYALPNWRWLQFAVTLPNFCFLLYFWCIPESPR------------------------------
NEPI_SHIDS      AAPLGSFLGELIGWRNVFNAAAV----MGVLCIF------------------------------------
HXT2_YEAST      GYCTN--YGTKVQWRVP-LGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIV
GTR12_XENLA     AYICNYFASVNNGWKYMFGLITPLAALQAVAMFFLPRSPR------------------------------
YDHC_ECOLI      APLLGSWLLVHFSWQAIFATLFAITVVL-ILPIFWLKPTTKARNNS------QDGLTF------TDLLRS
YBCL_BACSU      GVPLGRMIAVALGWKSVFGAIALLGLIAMVVIFFTL-------------PYTEGDKPVPLLQQLALFKKR
NEPI_ECOL5      AAPLGSFLGELIGWRNVFAAMGVLCIFWIIKSL-------------------------------------
YN2F_SCHPO      SPIVGGFIGKSYGWR-------------------------------------------------------
YHCA_BACSU      GPTLSGWIIEHYTWRIMF----------------------------------------------------
YCEJ_BACSU      GLPIGGFLA-SFTWHTPF----------------------------------------------------
UNC17_CAEEL     APPFGSVLYSLAGKPVPFLILSFVCLADAIAVFMVINPHRRGTDSHG-----------------------
PLST1_ARATH     GIIFSLLLGDPHWWRTMLYVASMPGFLLALGMQFAVESPR------------------------------
NEPI_SHIFL      AAPLGSFLGELIGWRNVFNAAAV----MGVLCIF------------------------------------
NEPI_SHIF8      AAPLGSFLGELIGWRNVFNAAAV----MGVLCIF------------------------------------
NEPI_ECOLI      AAPLGSFLGELIGWRNVFNAAAV----MGVLCIF------------------------------------
NEPI_ECOBW      AAPLGSFLGELIGWRNVFNAAAV----MGVLCIF------------------------------------
MSSP1_ARATH     SMVFTMSLSDSPSWRAMLGVLSIPSLLYLFLTVFYLPESPRWLVSKG-----------------------
MMLH_RALEJ      XXXXXXXXXPKMAWRVAFWSGIIP----ALIVLFIRRHVK------------------------------
SOTB_ESCF3      GLPVGRIVGQYFGWRTTFLAIGV-----------------------------------------------
S22A2_RAT       -LILAGVAYVIPNWRWLQFAVTLPNFCFLLYFWCIPESPR------------------------------
S17A5_SHEEP     SLPLSGVICYYMNWTYVFYFFGIVGIIWFILWICLVSD--------------------------------
PLT4_ARATH      GYVSNSGLSVHISWRIMLAVGILPSVFIG-FALCVIPESPRWLVMKG-----------------------
MDTL_SHEON      APVIGHLIMLKFPW---------PSLFYTMAAM-------------------------------------
CSBC_BACSU      AYIVNYLFTPFEAWR-------------------------------------------------------
NART_STAES      GTAVSSFCAPAIGWQNTVRSYLIILSIFAILMFFLKNEPK------------------------------
NART_STAEQ      GTAVSSFCAPAIGWQNTVRSYLIILSIFAILMFFLKNEPK------------------------------
NANT_ENTS8      XXXXYSLVVPVWGWRALFFIGILPIVF-------------------------------------------
YN42_SCHPO      SPIVGGFLTKSYGWRWTEYITSFMGFFALIIVYLFCDETYSKAIIQGKAKITGNYFVHAKSEELSDIAKN
PLT1_ARATH      GYVSNYFLPEHLGWRFMLGVGAVPSVFLAIGVLAMPESPRWLVLQGRLGD--------------------
NEPI_ECOUT      AAPLGSFLGELIGWRNVFAAMGVLCIFWIIKSL-------------------------------------
NEPI_ECOL6      AAPLGSFLGELIGWRNVFAAMGVLCIFWIIKSL-------------------------------------
NEPI_ECOK1      AAPLGSFLGELIGWRNVFAAMGVLCIFWIIKSL-------------------------------------
ANTR4_ARATH     GLMLSPILMSQGGIYGPFVIFGLSGFLWLLVWLSATSSPDRHP------QITKSELEYIKQKKQISTMEN
OCTL_DROME      TAVFAYFV---HDWRWLQIALTLPGLIF-MFYYWIIPESARWLLLKG-----------------------
NANT_SALA4      XXXXXXXXXXXWGWRALFFIGILPIIF-------------------------------------------
YN41_SCHPO      APIVGGFLTKSYGWR-------------------------------------------------------
SOTB_ERWCH      GLPLGRVIGQYLGWRVTFLTIA------------------------------------------------
S22A1_RABIT     --ALSGVAYAIPNWRWLQLTVSLP----------------------------------------------
PMRA_LACLA      GPSLGGLLAEWFGMANVFLIVGXXXXXXXXXXIFFVHE----NFE-----------PIAKGEMLSSKEII
NORA_STAAW      GPGIGGFMA-EVSHRMPFYFAGALGILAFIMSIVLIHDPKK-----------------------------
NORA_STAAU      GPGIGGFMA-EVSHRMPFYFAGALGILAFIMSIVLIHDPKK-----------------------------
NORA_STAAS      GPGIGGFMA-EVSHRMPFYFAGALGILAFIMSIVLIHDPKK-----------------------------
NORA_STAAN      GPGIGGFMA-EVSHRMPFYFAGALGILAFIMSIVLIHDPKK-----------------------------
NORA_STAAM      GPGIGGFMA-EVSHRMPFYFAGALGILAFIMSIVLIHDPKK-----------------------------
NORA_STAAC      GPGIGGFMA-EVSHRMPFYFAGALGILAFIMSIVLIHDPKK-----------------------------
NEPI_SHIBS      AAPLGSFLGELIGWRNVFNAAAV----MGVLCIF------------------------------------
ERDL4_ARATH     AYLLGLFV----PWRILAVTLLIPGLFF------------------------------------------
YFMO_BACSU      GPLAGGELG-SISWRAPFFGVSV-LMFIALIAIFMLPKLPKPAKRVGVFDAMKA----------------
YAJR_ECOLI      AMVLGPIITHKLGLHALFWMIAILATTGIALTIWVVPNSSTHVLNRESGMVKGSFSKVLAEPRL------
NORA_STAAR      GPGIGGFMA-EVSHRMPFYFAGALGILAFIMSVVLIHDPKK-----------------------------
NEPI_ECO57      AAPLGCFLGELIGWRNVFAAMGVLCIFWIIKSL-------------------------------------
GUDP_PSEPU      ----------------------------------------------------------------------
SOTB_PSE14      GIPLGRVLGEALGWRTTFLGIA------------------------------------------------
S17A9_HUMAN     TGAVGSLLLEWYGWQSIF----------------------------------------------------
BAIG_EUBSP      GPTCGGLIMNAAGWRVMWVCVALCVVVFLICTFSI----KKTAFEK----KSMAGFDKPG-------AAL
YB30_YEAST      APIVAGLILMKGNWRWLFGFTSIMTGIALILVTALLPETLR-----------------------------
MDTD_PECCP      GPALGGFLVEYASWHWIFLINLPVGIIGALATWFLM----------------------------------
ERDL6_ARATH     AYLLGLFV----PWRILAVTLLIPGLFF------------------------------------------
YCLF_BACSU      APLIVGTLGQKYNYHLGFGAAAV-----------------------------------------------
SOTB_ENT38      GLPIGRIVGQYFGWRTTF----------------------------------------------------
ITR2_SCHPO      ASLNAAFEHVHQGWRIMFGIGAAPAL-GQLISLFWTPESPRYLLRHNHVEKV-----YKILSRIHPEAKP
SVOPL_DANRE     IIVLGMTVVPTMGWRWMIRFSVIPSLVLIGLFMFI---PESARFQVSAGNI-------------------
SV2A_RAT        AAAMAWAIIPHYGWRVFVLVCAFPSV-FAIGALTTQPESPRFFLENG-----------------------
SV2A_PONAB      AAAMAWAIIPHYGWRVFVLVCAFPSV-FAIGALTTQPESPRFFLENG-----------------------
SV2A_MOUSE      AAAMAWAIIPHYGWRVFVLVCAFPSV-FAIGALTTQPESPRFFLENG-----------------------
SV2A_MACFA      AAAMAWAIIPHYGWRVFVLVCAFPSV-FAIGALTTQPESPRFFLENG-----------------------
SV2A_HUMAN      AAAMAWAIIPHYGWRVFVLVCAFPSV-FAIGALTTQPESPRFFLENG-----------------------
SV2A_BOVIN      AAAMAWAIIPHYGWRVFVLVCAFPSV-FAIGALTTQPESPRFFLENG-----------------------
S22A1_RAT       -----GLAGVAYAWRWLQLAVSLPTFLFLLYYWFVPESPR------------------------------
PBUE_BACAM      GVPVGIIISNAFGWRVLFLGIGVLSVSMLIISVFFEKIP-------------------------------
GTR10_XENLA     SYAMNYFLSANDGWKYMFGLAIIPAAFQFIVILFLPSKPHTLNFDNGFIELEEAG---------------
ARAE_ECOLI      AFLSDTAFSYSGNWR-------------------------------------------------------
ARAE_ECO57      AFLSDTAFSYSGNWR-------------------------------------------------------
YYBO_BACSU      GAPLVAFLVTTFDWRVAFLTIGCINVLFTIFFWQYYEQPER-----------------------------
NART_STAAW      GTAVSSFLAPPIGWQ-------------------------------------------------------
NART_STAAT      GTAVSSFLAPPIGWQ-------------------------------------------------------
NART_STAAS      GTAVSSFLAPPIGWQ-------------------------------------------------------
NART_STAAN      GTAVSSFLAPPIGWQ-------------------------------------------------------
NART_STAAM      GTAVSSFLAPPIGWQ-------------------------------------------------------
NART_STAAE      GTAVSSFLAPPIGWQ-------------------------------------------------------
NART_STAAC      GTAVSSFLAPPIGWQ-------------------------------------------------------
NART_STAAB      GTAVSSFLAPPIGWQ-------------------------------------------------------
NART_STAA9      GTAVSSFLAPPIGWQ-------------------------------------------------------
NART_STAA8      GTAVSSFLAPPIGWQ-------------------------------------------------------
NART_STAA3      GTAVSSFLAPPIGWQ-------------------------------------------------------
NART_STAA2      GTAVSSFLAPPIGWQ-------------------------------------------------------
NART_STAA1      GTAVSSFLAPPIGWQ-------------------------------------------------------
YQO5_SCHPO      SPIIGGFLTKSYGWRWTEYITSFMG-FFALVIVYL-----------------------------------
YFIU_BACSU      GPNIGSFL--------------------------------------------------------------
SV2B_RAT        ASAMAWSIIPHYGW--------------------------------------------------------
SPX3_XENLA      GAFLASSV-LKYGYEYAFLVTASVQFAGGIIIFFLVTSPKEGLPDTGEGEMDRAAQE-------------
SOTB_HAEIN      GLPIGRIVGQLVGWRVTFIAVLALSIMFLIIRL-------------------------------------
SOTB_HAEIG      GLPIGRIVGQLVGWRVTFIAVLALSIMFLIIRL-------------------------------------
SETB_ECOLI      GPPLAYALAMGFSFTVMYLSAAVAFIVCGVM---------------------------------------
PCAK_PSEPU      GMAGGGFISPAYGW--------------------------------------------------------
NART_STAAR      GTAVSSFLAPPIGWQ-------------------------------------------------------
BSU1_SCHPO      PMATGVDINAKYGWRLYYINIIVGGFFLIVILI-------------------------------------
SETB_SALTY      GPPLAYALAMGFSFTVMYLSAAVAFIVCGVMVWFFLPSMRKDA------PLATGTLEAPRRNR-------
EDL14_ARATH     GLSAFYALGTAVAWRSLAILGSIPSLVVLPLLFFIPESPR------------------------------
YFKF_BACSU      GPVAGGW---------------------------------------------------------------
YCT4_SCHPO      GPVMGGYIESKLGWRWDF----------------------------------------------------
S22A1_MOUSE     -----GLAGVAYAWRWLQLAVSLPTFLFLLYYWFVPESPR------------------------------
ERDL7_ARATH     SFIIGTLV----TWRVLALIGIIP-CAASFLGLFFIPESPR-----------------------------
YLD2_CAEEL      VLPLSGFLGFDGGWPSIFYIIGVFGVLWTAVWWYV-----------------------------------
YHM9_SCHPO      GALVPYILVCIFGWR---LSIGLGLVIPCVLLPFAMKDPK------------------------------
YDJE_ECOLI      SAAIGVVVIAFFSWRIMF----------------------------------------------------
XYLL3_ARATH     GFSVGSFIDVVGGWR-------------------------------------------------------
VBA2_YEAST      GASFGGTIASSIGWRWCFL-IQVP----------------------------------------------
SPX2_DANRE      GSLIAG-VYVSSAWGLSFI---VPGIIIAICFLFLVERPE------------------------------
S22A4_HUMAN     A--VGYMLLPLFAWRMLLLALTVPGVLCVPLWWFIPESPR------------------------------
NPT3_BOVIN      ILCVGGLISQALGW--PFI---------------------------------------------------
YFIG_BACSU      AYTFNAIIGSTMGWRYMLVIATLPAVVLWFGMLIVPESPRWLAAKGRMGDALR-----------------
YDFJ_ECOLI      ATAIWAFMFLAWGWRIPFLASVVVMVFAIWLRMNLKESP---VFEK------------------------
YD387_YEAST     SYVIASLMKEDNSWRYLFALSAIPAILFLSILDFIPESP-RWSISKG-----------------------
S22A4_PAPAN     A--VGYMLLPLFAWRMLLLALTVPGVLCVPLWWFIPESPR------------------------------
PHT47_ORYSJ     GMLFFPSLVKHMGAQSVFFVEAVLGVAWSVIWLKFSSEPPR-----------------------------
GTR1_PIG        AQVFGSIMGNEELWPLLLSVIFIPALLQCVLLPFCPESPR------------------------------
EDL10_ARATH     SLIY--FFGTVINWRVLAVIGALP-CFIPVIGIYFIPESPRWLAKIGSVKEVENSLHRGKDADVSDEAAE
VACHT_DROME     APPFGGALYQFAGKEVPFL---------------------------------------------------
TCMA_STRGA      GPIIGGLLVQHVGWEAVFF-INVP----------------------------------------------
S22A6_MOUSE     ---LAGIAYAVPHWRHLQLAVSVPFFVAFIYSWFFIESAR------------------------------
S22A2_HUMAN     XXXXXXXXXPH--WRWLQFTVALPNFFFLLYYWCIPESPR------------------------------
PT113_ORYSJ     GMIVSAAFKHSYAWRIILMFGAIP----------------------------------------------
YMPB_CAEEL      TLLVTLMTD---DWRWRYFIVSLPGVYGFALWYFLPESPH---------WLITKN----KTEKLKKY---
SOTB_HAEI8      GLPIGRIVGQLVGWRVTFIAVLALSIMFLIIRL-------------------------------------
S22A6_RAT       ---LAGIAYAVPHWRHLQLVVSVPFFIAFIYSWFFIESAR------------------------------
PLT2_ARATH      GYVSNYFLPEHIGWRFMLGIGAVPSVFLAIGVLAMPESPRWLVMQGRLGD--------------------
PHT19_ARATH     SSAV------------------------------------------------------------------
MDTD_YERPY      GPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHK------------------------------
MDTD_YERPS      GPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHK------------------------------
MDTD_YERPP      GPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHK------------------------------
MDTD_YERPN      GPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHK------------------------------
MDTD_YERPG      GPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHK------------------------------
MDTD_YERPE      GPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHK------------------------------
MDTD_YERPB      GPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHK------------------------------
MDTD_YERPA      GPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHK------------------------------
MDTD_YERP3      GPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPNHK------------------------------
ERDL5_ARATH     TYLLGSFI----GWRILALIGMIPCV-VQMMGLFVIPESPR-----------------------------
YUXJ_BACSU      GPLLGGMLADRFGXXXXXXXXXXXXXXXXLLVLFGVKE--------------------------------
YDHP_ECOLI      GVPAATWLGETIGWRMSFLATAGLGVISMVSLFFSL--PKGGA---------------------------
YDHP_ECO57      GVPAATWLGETIGWRMSFLATAGLGVISMVSLFFSL--PKGGA---------------------------
Y1104_HAEIN     XXXXXXXXXXHIGWRGMFLV----GIFPAFVAWFLLHEPE------------------------------
VGLU3_DANRE     AMPLAGILVQYVGWPSVFYIYGVFGIIWYIFWILLISEEERNYIETSIGE--------------------
SV2B_MOUSE      ASAMAWSIIPHYGW--------------------------------------------------------
SOTB_PSESM      GIPLGRVLGEALGWR-------------------------------------------------------
SOTB_PSEE4      GIPLGRVVGEALGWRITFLCIA------------------------------------------------
S22A7_MOUSE     XXXXXXYL--IRSWRWLLLAATLPCV-PGIISIWWVPESARWLLTQG-----------------------
S17A5_MOUSE     SLPLSGIICYYMNWTYVFYLFGIVGIVWFILWMWIVSD--------------------------------
PHT12_ORYSJ     GAIV------------------------------------------------------------------
ARAE_KLEOX      AFLSDTAFSYSGNWR-------------------------------------------------------
SOTB_PSEU2      GIPLGRVLGEALGWR-------------------------------------------------------
MOT6_HUMAN      WPLLSRYLLENLGWRGTFL---------------------------------------------------
MDFA_ECOLI      GPLVGAHVLPWEGMFVLFAALAAISFF-------------------------------------------
MDFA_ECOL6      GPLVGAHVLPWEGMFVLFAALAAISFF-------------------------------------------
MDFA_ECO57      GPLVGAHVLPWEGMFVLFAALAAISFF-------------------------------------------
GTR1_HUMAN      AQVFGSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPESPR------------------------------
GTR1_BOVIN      AQVFGSIMGNQELWPLLLSVIFIPALLQCILLPFCPESPR------------------------------
EMRY_ECOLI      GPILGGYICDNFSWGWIFL-INVPGIIVLTLCLTLLK---------------------------------
EAT4_CAEEL      GLPLSAFLVSYVSWAAPFYLYGVCGVIWAIL---------------------------------------
VGLU1_RAT       AMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVISEEERKYIEDAIGE--------------------
VGLU1_MOUSE     AMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVISEEERKYIEDAIGE--------------------
VGLU1_BOVIN     AMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVISEEERKYIEDAIGE--------------------
VGL2A_DANRE     AMPLAGILVQYTGWSSVFYVYGCFGIFWYMFWILVSYE--------------------------------
TCR_STAES       GPSIGGIIAHYIHW--------------------------------------------------------
TCR_STAAU       GPSIGGIIAHYIHW--------------------------------------------------------
S17A9_MOUSE     XXXXXXXXXDQCGWQSVF----------------------------------------------------
MSSP2_ARATH     SMVFGMSLMPSPSWRLMLGVLFIPSXXXXXXXXXXXPESPRWLVSKG-----------------------
ITR1_YEAST      AYGCGAGLNVNNGWRI------------------------------------------------------
ERD6_ARATH      FFIIGNFI----PWRLLTVVGLVPCVFHVFCLFFIPESPR------------------------------
Y4XM_RHISN      GSLGGAFLGGLILDALPFAAVNL-----------------------------------------------
UHPC_SALTY      IPLVMAAVALHYGWRV------------------------------------------------------
S22A5_HUMAN     FYAFGYMVLPLFAWRMLLVALTMPGVLCVALWWFIPESPRQGRFEE------------------------
PHT15_ORYSJ     GGIV------------------------------------------------------------------
PHT14_ORYSJ     GGIV------------------------------------------------------------------
PHT14_ORYSI     GGIV------------------------------------------------------------------
MFS10_HUMAN     GPMLGASL--------------------------------------------------------------
HXT17_YEAST     G-YCSVYGTRKYDWRVPLGLCFLWTLIIIIGMLLVPESPR------------------------------
GTR2_BOVIN      SQIVGFILGNHELWHILLGLSAVPAILQCLLLFFCPESPR------------------------------
GTR1_RAT        AQVFGSIMGNADLWPLLLSVIFIPALLQCILLPFCPESPR------------------------------
GTR1_MOUSE      AQVFGSIMGNADLWPLLLSVIFIPALLQCILLPFCPESPR------------------------------
ERDL8_ARATH     MFLIGAVV----NWRTLALTGVAPCVVLFFGTWFIPESPR------------------------------
EDL16_ARATH     SFLIGSLI----SWKTLALTGLAPCIVLLFGLCFIPESPR------------------------------
BCRH_RICPR      GSYIGGYIIEYLSWHYVFIFFSLAGTILLALYYQILPE--------------------------------
UHPC_ECOLI      IPIVMAAAALHYGWRAGMMIAGCMAIVVGIFLCWRLRDRPQALGLPAVGE--------------------
S22A2_PONAB     XXXXXXXXXPH--WRWLQFTVTLPNFFFLLYYWCIPESPR------------------------------
QUTD_EMENI      GFWVDETLAPSHQWIIPFAVQXXXXXXXXXXXXXXRESPRRGNREKGIETL-------------------
PROP_SALTY      STIVGEENFLEWGWRIPFF-IALPLGIIGLYLRHALEETP--AFQQHVDKLEQGDRELQDGPKVS-----
HXT13_YEAST     G-YCSVYGTRKYDWRVP-----------------------------------------------------
HIAT1_MOUSE     SPAIGAYLGQMYG---------------------------------------------------------
EDL11_ARATH     SLIY--FFGTVINWRVMAVIGAIPCI-LQTIGIFFIPESPRWLAKIRLSKEVESSLHRGKDTDVSGEAAE
YQEH_SCHPO      G--TGVAENPKLTWR-------------------------------------------------------
Y532_BUCBP      GRFLSSLFSEYFSWNIALEFISFLAFTSAVLFVYLLPKSK------------------------------
VMAT2_RAT       XXXFGSVLYEFVGKTAPFXXXXXXXXXDGAIQLFVL-QPSRVQPESQKGT--------PLTTLLKDPYIL
TCR2_ECOLX      ----------------------------------------------------------------------
S22A1_BOVIN     ---LSGLAYILPHWRWLQLAVSLPIFLLLFRFWFVPESPR------------------------------
PROP_ECOLI      STIVGEANFLDWGWRIPFF-IALPLGIIGLYLRHALEETP--AFQQHVDKLEQGDRELQDGPKVS-----
PROP_ECO57      STIVGEANFLDWGWRIPFF-IALPLGIIGLYLRHALEETP--AFQQHVDKLEQGDRELQDGPKVS-----
MDTM_SALTY      GPLSGAALMHFVHWKVLFGIIAV-----------------------------------------------
MDTM_SALTI      GPLSGAALMHFVHWKVLFGIIAV-----------------------------------------------
ITR2_YEAST      AYGCGGLNHVKNGWRILVGLSLIPTVLQFSFFCFLPDTPR------------------------------
GTR7_HUMAN      AQIFSAILGNPAGWPVLLALTGVPALLQLLTLPFFPESPRYSLIQKG-----------------------
EDL13_ARATH     ---VTYLLGSVISWQKLALISTVPCVFEFVGLFFIPESPR------------------------------
BCR_ECOLI       APIVGGWVLVWLSW--------------------------------------------------------
BCRH_RICTY      GSYIGGYIIEYSSWHYVFVFFSLIGTILLALYYKILPE--------------------------------
YBFB_BACSU      GAYVPGVIYTVTGEYTLAFYLSIGMLVLASVMNVMLREP-------------------------------
S22A6_RABIT     ---LAGVAYAVPHWRYLQLLVSVPFFAFFVYSWFFIESAR------------------------------
PT111_ORYSJ     AGLV------------------------------------------------------------------
PHT18_ORYSJ     GGIVAGFPAPAY----------------------------------------------------------
NPT3_HUMAN      ILCVGGLISQALSW--PFI---------------------------------------------------
NART_STAHJ      GTAVSSFLAPPIGWQ-------------------------------------------------------
NANT2_ECOL6     XXQVYSIVVPLWGWRSLFFVGMLPILF-------------------------------------------
MFS10_MOUSE     GPMLGAFLSVE---MVPWISL-------------------------------------------------
HXT1_YEAST      GYCT-NFGTKNYSWRVPLGLCFAWALFMIGGMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQY
HIAT1_HUMAN     SPAIGAYLGRVYG---------------------------------------------------------
GTR7_RAT        AQIFSAILGNPAGWPVLLALTGVPALLQLLTLPFFPESPRYSLIQKG-----------------------
GTR2_HUMAN      SQIIGFILGNYDLWHILLGLSGVRAILQSLLLFFCPESPR------------------------------
GALP_ECOLI      AYLSDTAFSYTGAWRWMLGVIIIPAILLLIGVFFLPDSPR------------------------------
GALP_ECOL6      AYLSDTAFSYTGAWRWMLGVIIIPAILLLIGVFFLPDSPR------------------------------
YCAD_SALEP      GQLL------------------------------------------------------------------
YCAD_ESCF3      GQLLVSKVSTELMNVLPWVTALIPLLFTRILS--------------------------------------
Y466_BUCAI      AVVSGPIIVHYFG----FFSIFWISAFLSIVCMIIV----------------------------------
VGLU1_HUMAN     AMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVISEEERKYIEDAIGE--------------------
SPX2_BOVIN      GSLLAG-VWVDQQWGLSFVVPGVITAIMGIITFFFLIE--------------------------------
SOTB_PASMU      GLPLGRLIGQFFGWRATF----------------------------------------------------
S22A3_MOUSE     GIIIPGIAYFTPSWQGIQLAISLPSFLF-LLYYWVVPESPRWLITRKQGE--------------------
RAG1_KLULA      GYCTN--YGTKVQWRVPLGLCFAWAIFMVLGMMFV---PESARFLVETDQIEEARKSLAKTNKVSIDDPV
PT112_ORYSJ     GGVVAGFQAPAPAYEVNAAASTVPQADYVWRIILML----------GALPAILTYYWRMKMPETARYTAL
ORCT_DROME      -MLTAGFAYFIHDWRWLQIAITLPGLLF-LCYYWIIPESARWLLMKG-----------------------
MDTD_YERE8      GPALGGFLVEYASWHWIFL---------------------------------------------------
VGLU2_RAT       AMPLAGILVQYTGWSSVF----------------------------------------------------
VGLU2_MOUSE     AMPLAGILVQYTGWSSVF----------------------------------------------------
VGLU2_HUMAN     AMPLAGILVQYTGWSSVF----------------------------------------------------
VGLU2_BOVIN     AMPLAGILVQYTGWSSVF----------------------------------------------------
STP5_ARATH      ANLINGTDSHRNGWRISLGLAAVPAAIMTVGCLFISDTP-------------------------------
S22AC_MOUSE     ---TGSVAYGVRSWRMLQLAVSAPFFLFFVYS-WWLPESARGKLDQGLQEL-------------------
S22A3_RAT       GIIIPGIAYFTPSWQGIQLAISLPSFLF-LLYYWVVPESPRWLITRKQGE--------------------
S22A2_RABIT     ----------------------------------------------------------------------
S226B_XENLA     GLVLVGLAFIIRDWQWLQLAASIPFFFYFLYSWWI-----------------------------------
LPLT_PHOLL      GSVVGGFLS---DWNLA-IALLVCALMYGIAVVANFFIPRLSAVRRDKG---------------------
HSRA_ECOLI      ----------------------------------------------------------------------
EDL15_ARATH     GISVFYALGTIVAWRNLAILGCIPSLMVLPLLFFIPESPR------------------------------
YCAD_SALG2      GQLL------------------------------------------------------------------
YCAD_SALDC      GQLL------------------------------------------------------------------
XYLL1_ARATH     GMVGGYGIGSLWGWRYMYATI-------------------------------------------------
UHPT_CHLPN      IPILTGFIIDYSGWRG---AMYVPGI--------------------------------------------
SPX2_MOUSE      GSLIAGVWVNQH-WGLSFI---VPGIITAIMGVFLIEYPE------------------------------
SPX2_HUMAN      GSLIAG-IWVNGQWGLSFI---VPGIITAVMGVFLIEHPE------------------------------
S22A7_PIG       LLALVGYL--IRDWRWLLLAVTLP-CAPGILSLWWVPESARWLLTQG-----------------------
MMR_STRCO       GPTVGGLMVSAFGWESIFL---------------------------------------------------
LMRB_BACSU      GPTFSGLVLEHLNWHWIF-WISLPFLVLALV---------------------------------------
HXT9_YEAST      GYCTN--YGTKTQWRVG-LGLCFAWTTFMVSGMMFVPESPRYLIEVGKDEEAKRSLSKSNKVSVDDPALL
HXT11_YEAST     GYCTN--YGTKTQWRVG-LGLCFAWATFMVSGMMFVPESPRYLIEVGKDEEAKRSLSKSNKVSVDDPALL
GTR1_RABIT      AQVFGSIMGNEDLWPLLLSVIFVPALLQCIVLPLCPESPR------------------------------
YMFD_BACSU      ----------------------------------------------------------------------
YJ94_YEAST      GAIICG----------------------------------------------------------------
YHD3_SCHPO      GSVFSGIFAQLSWWPWTYWTTAIVCIVFAIIGYFAI----------------------------------
YDER_BACSU      SRPISSLVADIWGWNAIFALSAVVSVILAIVLSKVLPARK------------------------------
YCAD_SALPB      GQLL------------------------------------------------------------------
YAN6_SCHPO      GPLIGGAISQKASWR-------------------------------------------------------
TCR8_PASMU      ----------------------------------------------------------------------
S22A7_BOVIN     LLALIGYL--IRDWRWLLLTVTLPCV-PGILTLWWVPESARWLLTQG-----------------------
S22A2_PIG       ----------------------------------------------------------------------
PHT16_ORYSJ     GGLV------------------------------------------------------------------
PHT11_ORYSJ     GAIVA--LAVSAGFRHAYPAPS------------------------------------------------
MDTD_SERP5      GPALGGFLVQYASWHWIFL-INIP----------------------------------------------
HXT3_YEAST      GYCT-NFGTKNYSWRVPLGLCFAWALFMIGGMTFVPESPRAGQIDEARASLSKVNKVAPDHPFIQQELEV
YCAD_SALTY      GQLL------------------------------------------------------------------
YCAD_SALTI      GQLL------------------------------------------------------------------
YCAD_SALSV      GQLL------------------------------------------------------------------
YCAD_SALPK      GQLL------------------------------------------------------------------
YCAD_SALPC      GQLL------------------------------------------------------------------
YCAD_SALPA      GQLL------------------------------------------------------------------
YCAD_SALNS      GQLL------------------------------------------------------------------
YCAD_SALHS      GQLL------------------------------------------------------------------
YCAD_SALCH      GQLL------------------------------------------------------------------
YCAD_SALA4      GQLL------------------------------------------------------------------
Y2171_CITK8     GQLL------------------------------------------------------------------
VGL2B_DANRE     AMPLAGILVQYSGWSSVFYIYGSFGIVWYMFWILVITDEERTYIEESIGE--------------------
TUB3_AGRVI      GSPISGALMEMHGWQWMFLIEAAPALILGVVVLFFLTD--------------------------------
S22FL_XENLA     GFYIRN-------WRTLAFVANSPGIFFLLLS-FVLPESPRWLYSRG-----------------------
PCFT_XENLA      ASIIGGHWRKAQGYINPFWLVFAVNLFTALYVYFCVEE--------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
GLPT_HUMAN      GSLIAGY-WVSTCWGLSFV---VPGAIVAAMGIFLIEHP-------------------------------
YCAD_SALAR      GQLL------------------------------------------------------------------
YBN1_SCHPO      GAIV------------------------------------------------------------------
YB91_YEAST      TQTLALKYADSYNWR-------------------------------------------------------
TUB4_AGRVI      GMEMHGFLG-LAGWQWMFLIEAAPAVILGVVVLFYLTD--------------------------------
SPX2_XENLA      GLIAGAFVSTAWG---------------------------------------------------------
S22A6_MACFA     ---LAGVAYAVPHWRHLQLLISVP----------------------------------------------
PHT13_ORYSJ     GAIV------------------------------------------------------------------
PBUE_BACSU      GVPLGILISDSFGWR-------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
HXT16_YEAST     G-YCSVYGTRKYSWRIP-----------------------------------------------------
HXT15_YEAST     G-YCSVYGTRKYSWRIP-----------------------------------------------------
GTR7_MOUSE      AQIFSAILGNATGWPILLALTGVPAVIQLLSLPFFPESPRYTLIEKG-----------------------
GTR2_MOUSE      SQIAGFILGNQDHWHILLGLSAVPAXXXXXXXXFCPESPR------------------------------
GTR2_CHICK      SQVLG-----------------------------------------------------------------
YI32_SCHPO      GPLIGGAISQNTTWR-------------------------------------------------------
SOTB_PSEA7      XIPLGRVVGEALGWRTTFMAISVLTLLYLVRSLPPLPSQNSGS---------------------------
SETA_ECOLI      GPPLAFMLALNYGFTVMFSIAAGIFTLSLVLIAFMLPSVARVELPSENALSMQGGWQ-------------
S22AL_MOUSE     GMVLPLFAYFIREWRRLLLAITLPGVLCGALWWFIPESPR------------------------------
S22A6_PONAB     ---LAGVAYAVPHWRHLQLLVSAP----------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
GTR2_RAT        SQIAGFILGNQDYWHILLGLSAVPAXXXXXXXXFCPESPR------------------------------
Y1317_METJA     ASLIAGYLW-KISPEMTFLYGSVLAIISGLLLLFI-----------------------------------
SPX3_CHICK      GAFLASCV-LKYGYEYAFVTASVQFAGGVIVFCGLLTSPK----EVGLPEL-------------------
S22AA_HUMAN     --ILGGLAYVFRDWQTLHVVASVPFFVFFLLSRWLVESAR------------------------------
QAY_NEUCR       GFWVNTTMAPRSQWLIPFAVQLIPAGLLFLGSFWIPESPR------------------------------
GTR1_CHICK      AQVFGLIMGNDSLWPLLLGFIFVPALLQCIILPFAPESPR------------------------------
CF192_HUMAN     GPTLGGFLYEKIGF--------------------------------------------------------
VMAT2_HUMAN     XPPFGSVLYEFVGKTAPFXXXXXXXXXDGAIQLFVL-QPSRVQPESQKGT--------PLTTLLKDPYIL
VGLU1_XENLA     AMPLAGVLVQYSGWSSVFYVYGSFGITWYMFWILVISEEERKYIEESIGE--STGFMNPMA---------
SPX2_XENTR      GLIAGAFVSTAWG---------------------------------------------------------
SOTB_PSEAE      XIPLGRVVGEALGWRTTFMAIA------------------------------------------------
SOTB_PSEAB      XIPLGRVVGEALGWRTTFMAIA------------------------------------------------
SOTB_PSEA8      XIPLGRVVGEALGWRTTFMAIA------------------------------------------------
SOTB_ERWCT      XXXXXXXXXQYLGWRVTFVLI---GLIAAVIMVGLMK---------------------------------
S22AC_RAT       ---TGSVAYGVRSWRMLQLAVSAPFFLFFVYSWWL---PESARWLITVGRLDQS----------------
S22A6_HUMAN     ---LAGVAYAVPHWRHLQLLVSAP----------------------------------------------
S226A_XENLA     ---LAGLAYAMRDWRWLQLCVSLPFFIFFLYS--------------------------------------
PROP_STAAW      GYIAASIMMASFGWRIP-----------------------------------------------------
PROP_STAAS      GYIAASIMMASFGWRIP-----------------------------------------------------
PROP_STAAR      GYIAASIMMASFGWRIP-----------------------------------------------------
PROP_STAAN      GYIAASIMMASFGWRIP-----------------------------------------------------
PROP_STAAM      GYIAASIMMASFGWRIP-----------------------------------------------------
PROP_STAAC      GYIAASIMMASFGWRIP-----------------------------------------------------
PROP_STAA1      GYIAASIMMASFGWRIP-----------------------------------------------------
PLST3_ARATH     SLFAGIPAKDNLGWRICFWISTVPAAMLAVFMELCVESPKRGVFEKLLG---------------------
OXLT_OXAFO      GGGLGAAIATNFGWNTAFLITAITSFIAFALATFVI--PRMG----------------------------
NEPI_SALPK      AAPLGSFLGGIIGWRNVFNAAAVMGVLCVI----------------------------------------
NEPI_SALPA      AAPLGSFLGGIIGWRNVFNAAAVMGVLCVI----------------------------------------
MFSD9_MOUSE     GPVVGGYL--------------------------------------------------------------
ERDL2_ARATH     GISLMFFTGNFFHWRTLALLSAIPSAFQVICLFFIPESPR------------------------------
YHD1_SCHPO      GAIV------------------------------------------------------------------
SPX3_HUMAN      GACLASSV-LQYGYEYAFLVTASVQFAGGIVIFFGLLEAEENFEEDSHRPLINGGEEYEPNYSIQDDSSV
S22A6_PIG       ---LAGVAYAVPRWRHLQMLVSVP----------------------------------------------
QAY_NEUTR       GFWVNTTMAPRSQWLIPFAVQLIPGLLF--LGSFWIPESPRWLFANG-----------------------
PHT17_ARATH     AIIVSAAFEAKFTYQIDALASTVPQADYVWRIILMV----------GALPAAMTYYSRSKMPETARYTAL
GTR11_HUMAN     GQVVGELLGGPQAWPLLLASCLVP----------------------------------------------
GIT1_YEAST      ----------------------------------------------------------------------
ANTR5_ARATH     GMWLLPALVELRGPESVFLAEALAGVIWSLLWIRYATDPPRSEHPK------------------------
YBJJ_ECOLI      GPPLLGYLGEHYGLR-------------------------------------------------------
VMAT2_BOVIN     XPPFGSVLYEFVGKTAPFXXXXXXXXXDGAIQLFVL-QPSRVQPESQKGT--------PLTTLLRDPYIL
TPPB_ECOLI      SMIATPWLAAKYGWSVAF-ALSVVGLLITIVN--------------------------------------
TPPB_ECOL6      SMIATPWLAAKYGWSVAF-ALSVVGLLITIVN--------------------------------------
TPPB_ECO57      SMIATPWLAAKYGWSVAF-ALSVVGLLITIVN--------------------------------------
PROP_STAHJ      GYIAASIMMEAWGWRIP-----------------------------------------------------
PHT15_ARATH     GGIV------------------------------------------------------------------
YCAD_SHIFL      GQLL------------------------------------------------------------------
YCAD_SHIF8      GQLL------------------------------------------------------------------
PROP_STAEQ      GYIAASILVNSWGWRIP-----------------------------------------------------
NEPI_SALTY      AAPLGSFLGGIIGWRNVFNAAAVMGVLCVI----------------------------------------
NEPI_SALTI      AAPLGSFLGGIIGWRNVFNAAAVMGVLCVI----------------------------------------
NEPI_SALPC      AAPLGSFLGGIIGWRNVFNAAAVMGVLCVI----------------------------------------
NEPI_SALPB      AAPLGSFLGGIIGWRNVFNAAAVMGVLCVI----------------------------------------
NEPI_SALCH      AAPLGSFLGGIIGWRNVFNAAAVMGVLCVI----------------------------------------
MDTG_CITK8      GPLMGAAISASYGFRAVFCVTAGVVLFNAIYS--------------------------------------
HXT7_YEAST      GYCT-NFGTKNYSWRVPLGLCFAWALFMIGGMTFVPESPR------------------------------
HXT6_YEAST      GYCT-NFGTKNYSWRVPLGLCFAWALFMIGGMTFVPESPR------------------------------
HXT4_YEAST      GYCTN--YGTKVQWRVP-----------------------------------------------------
EDL17_ARATH     AMIY--FCGNFITWRTLALLGALP-CFIQVIGLFFVPESPR-----------------------------
YM8M_YEAST      ----------------------------------------------------------------------
YDJK_ECOLI      AMGLTPLISAEWNWRVQLLIPAILSLIATALAWRYFPESPRWLESRG-----------------------
S22AO_PONAB     -MLLGGLAFAIQDWRVLQLTVSTP-IIVLFLSSWKMVESARNQLDEGLKEL-------------------
PHT11_ARATH     GILAGGFV--------------------------------------------------------------
OCT1_CAEEL      ALL-------------------------------------------------------------------
NPT1_HUMAN      VLLVTGVICESLGWPMVF----------------------------------------------------
NEPI_SALG2      AAPLGSFLGGIIGWRNVFNAAAVMGVLCVI----------------------------------------
NEPI_SALEP      AAPLGSFLGGIIGWRNVFNAAAVMGVLCVI----------------------------------------
GTR3_MOUSE      AQIFG-----------------------------------------------------------------
ANTR6_ARATH     ----------------------------------------------------------------------
YCAD_ECOUT      GQLL------------------------------------------------------------------
YCAD_ECOL6      GQLL------------------------------------------------------------------
YCAD_ECOL5      GQLL------------------------------------------------------------------
YCAD_ECOK1      GQLL------------------------------------------------------------------
YCAD_ECO81      GQLL------------------------------------------------------------------
YCAD_ECO45      GQLL------------------------------------------------------------------
Y411_BUCBP      AVILSPIIVNMFGFYCLFLINSLLSIFCLFFGMFYI----------------------------------
STP12_ARATH     ANVLNFFFSKSWGWRLSLGGAVVPALIITVGSL-ILPDTPNSMIERGQFRLAEA----------------
SPX3_MOUSE      GAFLASSV-LQYGYEYAFLVTASVQFAGGIIIFFGL----------------------------------
QAY_NEUAF       GFWVNTTMAPRSQWLIPFAVQLIPGLLF--LGSFWIPESPRWLFANG-----------------------
PHT13_ARATH     GILAGGFV--------------------------------------------------------------
PHT12_ARATH     GILAGGFV--------------------------------------------------------------
GTR14_HUMAN     AQIFG-----------------------------------------------------------------
BCRH_RICBR      XXXXXXXXXXXXXWHYTFVFFSLTGTVLLTLYCKILPE--------------------------------
YKH4_CAEEL      GSMVAAVCASDLGWPATFYFAGIFATGWSILWFF------------------------------------
YJDL_ECOLI      APIACGLAAQWYGWHV------------------------------------------------------
YHA8_SCHPO      GPLVGGWIG-------------------------------------------------------------
YFNC_BACSU      APLI------------------------------------------------------------------
YCAD_SHISS      GQLL------------------------------------------------------------------
YCAD_SHIDS      GQLL------------------------------------------------------------------
YCAD_ECOSM      GQLL------------------------------------------------------------------
YCAD_ECOSE      GQLL------------------------------------------------------------------
YCAD_ECOLU      GQLL------------------------------------------------------------------
YCAD_ECOLI      GQLL------------------------------------------------------------------
YCAD_ECOLC      GQLL------------------------------------------------------------------
YCAD_ECOHS      GQLL------------------------------------------------------------------
YCAD_ECODH      GQLL------------------------------------------------------------------
YCAD_ECOBW      GQLL------------------------------------------------------------------
YCAD_ECO8A      GQLL------------------------------------------------------------------
YCAD_ECO7I      GQLL------------------------------------------------------------------
YCAD_ECO5E      GQLL------------------------------------------------------------------
YCAD_ECO57      GQLL------------------------------------------------------------------
YCAD_ECO55      GQLL------------------------------------------------------------------
YCAD_ECO27      GQLL------------------------------------------------------------------
YCAD_ECO24      GQLL------------------------------------------------------------------
VGLU3_HUMAN     AMPLAGVLVQYIGWSSVF----------------------------------------------------
SPX3_BOVIN      GACLASSV-LQYGYEYAFLVTAAVQFAGGIIIFFGL----------------------------------
S22A5_MOUSE     GMVLPLFAYFIRDWRMLLLALTVPGVLCGALWWFIPESPR------------------------------
MFS10_BOVIN     GPTLGAFLPSE---TVPWLAL-------------------------------------------------
FTSK_CHLTE      ----------------------------------------------------------------------
ENB1_YEAST      SSVAGNVAPYKWRWGYGIFCIIVP----------------------------------------------
EMRD_ECOLI      APLIGGLLDTMWNWRACYLFLLV-----------------------------------------------
CMLR_STRLI      GVPGGSLLGTWLGWRATFWAVAV-----------------------------------------------


                         .         .         .         +         .         .         .:280
query           VKVKTNLLLFFQGIAGTIPWGAIPYFLVEFFRRERGLSVETATLVFLVFXXXXXXXXXXXXXXXASIYAK
SPNS1_XENTR     LKNPSFILSXXXXXXXXXXXXXLALWGPTYLMRSRRVIYKTESMIFXXXXXXXXXXXXXXXXEISKRYRK
EXUT_BACSU      AFFAYNYILFF-----FLTW--FPSYLVD----ERGLSVESMSVITVI----------------------
SPNS1_XENLA     ----------------------------------------------------------------------
YIM0_YEAST      ----------------------------------------------------------------------
SPIN_DROME      ----------------------------------------------------------------------
YOU1_CAEEL      ----------------------------------------------------------------------
SPNS3_DANRE     ----------------------------------------------------------------------
PCAK_ACIAD      ----------------------------------------------------------------------
MDTL_SALTY      ----------------------------------------------------------------------
MDTL_SALPB      ----------------------------------------------------------------------
MDTL_SALNS      ----------------------------------------------------------------------
MDTL_SALHS      ----------------------------------------------------------------------
MDTL_SALA4      ----------------------------------------------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
MDTL_SALEP      ----------------------------------------------------------------------
MDTL_SALDC      ----------------------------------------------------------------------
MDTL_SALAR      ----------------------------------------------------------------------
YITG_BACSU      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
MDTL_SALSV      ----------------------------------------------------------------------
MDTL_SALPK      ----------------------------------------------------------------------
MDTL_SALPA      ----------------------------------------------------------------------
MDTL_SALPC      ----------------------------------------------------------------------
MDTL_SALCH      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
SPNS1_DANRE     ----------------------------------------------------------------------
BMR3_BACSU      ----------------------------------------------------------------------
SVOP_PONAB      ----------------------------------------------------------------------
SVOP_HUMAN      ----------------------------------------------------------------------
SVOP_BOVIN      ----------------------------------------------------------------------
MDTL_KLEP3      ----------------------------------------------------------------------
MDTL_KLEP7      ----------------------------------------------------------------------
ANTR3_ARATH     LKLPTWAIIFAN---VTNNWG---YFVLLSWMPVYFQTVFNVNLKQAAWFSALPWATMAISGYYAG--AA
NANT_YERPY      ----------------------------------------------------------------------
MDTL_VIBPA      ----------------------------------------------------------------------
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
GUDP_BACSU      KQLLTNRMLIGVYIATTLTYFFLTWFPV-YLVQARGMSILEAGFV-------------------------
SPNS3_MOUSE     ----------------------------------------------------------------------
SPNS3_HUMAN     ----------------------------------------------------------------------
MDTL_ECOSE      ----------------------------------------------------------------------
MDTL_ECOLI      ----------------------------------------------------------------------
MDTL_ECODH      ----------------------------------------------------------------------
MDTL_ECOBW      ----------------------------------------------------------------------
MDTL_ECO55      ----------------------------------------------------------------------
SV2C_HUMAN      ----------------------------------------------------------------------
MDTL_ESCF3      ----------------------------------------------------------------------
MDTL_SHISS      ----------------------------------------------------------------------
MDTL_SHIFL      ----------------------------------------------------------------------
MDTL_SHIDS      ----------------------------------------------------------------------
MDTL_SHIBS      ----------------------------------------------------------------------
MDTL_SHIB3      ----------------------------------------------------------------------
MDTL_ECOUT      ----------------------------------------------------------------------
MDTL_ECOLC      ----------------------------------------------------------------------
MDTL_ECOK1      ----------------------------------------------------------------------
MDTL_ECOHS      ----------------------------------------------------------------------
MDTL_ECO5E      ----------------------------------------------------------------------
MDTL_ECO57      ----------------------------------------------------------------------
MDTL_ECO45      ----------------------------------------------------------------------
VACHT_DANRE     ----------------------------------------------------------------------
TCRB_BACSU      ----------------------------------------------------------------------
SPNS2_XENTR     ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
MDTL_ECOL5      ----------------------------------------------------------------------
MDTL_ECO27      ----------------------------------------------------------------------
ANTR2_ARATH     ----------------------------------------------------------------------
PHT43_ORYSJ     ----------------------------------------------------------------------
MDTL_ECO7I      ----------------------------------------------------------------------
YIM1_YEAST      ----------------------------------------------------------------------
SVOP_XENLA      QFRCTTLLLWFIWFSNAFSYYGLVLLTTELFQ--------------------------------------
SOTB_SHISS      ----------------------------------------------------------------------
SOTB_SHIFL      ----------------------------------------------------------------------
SOTB_SHIF8      ----------------------------------------------------------------------
SOTB_SHIBS      ----------------------------------------------------------------------
SOTB_SHIB3      ----------------------------------------------------------------------
SOTB_ECOSM      ----------------------------------------------------------------------
SOTB_ECOSE      ----------------------------------------------------------------------
SOTB_ECOLU      ----------------------------------------------------------------------
SOTB_ECOLI      ----------------------------------------------------------------------
SOTB_ECOLC      ----------------------------------------------------------------------
SOTB_ECOHS      ----------------------------------------------------------------------
SOTB_ECODH      ----------------------------------------------------------------------
SOTB_ECOBW      ----------------------------------------------------------------------
SOTB_ECO8A      ----------------------------------------------------------------------
SOTB_ECO7I      ----------------------------------------------------------------------
SOTB_ECO5E      ----------------------------------------------------------------------
SOTB_ECO57      ----------------------------------------------------------------------
SOTB_ECO55      ----------------------------------------------------------------------
SOTB_ECO24      ----------------------------------------------------------------------
MDTL_ECOSM      ----------------------------------------------------------------------
MDTL_ECOLU      ----------------------------------------------------------------------
TPO3_YEAST      ----------------------------------------------------------------------
MDTL_ECOL6      ----------------------------------------------------------------------
MDTL_ECO8A      ----------------------------------------------------------------------
MDTL_ECO81      ----------------------------------------------------------------------
MDTL_ECO24      ----------------------------------------------------------------------
GARP_ECOLI      LSNRMMLGVFFQYFINTITWFFLTWFPI-YLVQEKGMSILKVGLV-------------------------
GARP_ECO57      LSNRMMLGVFFQYFINTITWFFLTWFPI-YLVQEKGMSILKVGLV-------------------------
SV2C_RAT        ----------------------------------------------------------------------
SV2B_HUMAN      ----------------------------------------------------------------------
MDTL_CITK8      ----------------------------------------------------------------------
VBA5_YEAST      ----------------------------------------------------------------------
SV2C_MOUSE      ----------------------------------------------------------------------
PHT41_ORYSJ     ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
NANT_SALTY      ----------------------------------------------------------------------
NANT_SALTI      ----------------------------------------------------------------------
NANT_SALSV      ----------------------------------------------------------------------
NANT_SALPK      ----------------------------------------------------------------------
NANT_SALPC      ----------------------------------------------------------------------
NANT_SALPB      ----------------------------------------------------------------------
NANT_SALPA      ----------------------------------------------------------------------
NANT_SALNS      ----------------------------------------------------------------------
NANT_SALHS      ----------------------------------------------------------------------
NANT_SALG2      ----------------------------------------------------------------------
NANT_SALEP      ----------------------------------------------------------------------
NANT_SALDC      ----------------------------------------------------------------------
NANT_SALCH      ----------------------------------------------------------------------
NANT_SALAR      ----------------------------------------------------------------------
ANTR1_ARATH     ----------------------------------------------------------------------
VACHT_RAT       ----------------------------------------------------------------------
TPO2_YEAST      ----------------------------------------------------------------------
SPNS1_HUMAN     ----------------------------------------------------------------------
MDTM_ECO57      ----------------------------------------------------------------------
MDTL_SHIF8      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
SPNS1_RAT       ----------------------------------------------------------------------
SPNS1_MOUSE     ----------------------------------------------------------------------
SOTB_ECOUT      ----------------------------------------------------------------------
SOTB_ECOL6      ----------------------------------------------------------------------
SOTB_ECOL5      ----------------------------------------------------------------------
SOTB_ECOK1      ----------------------------------------------------------------------
SOTB_ECO81      ----------------------------------------------------------------------
SOTB_ECO45      ----------------------------------------------------------------------
SOTB_ECO27      ----------------------------------------------------------------------
YWOD_BACSU      ----------------------------------------------------------------------
SOTB_SALTY      ----------------------------------------------------------------------
SOTB_SALNS      ----------------------------------------------------------------------
VACHT_HUMAN     ----------------------------------------------------------------------
NANT_CITK8      ----------------------------------------------------------------------
MDTM_ECOLI      ----------------------------------------------------------------------
VACHT_MOUSE     ----------------------------------------------------------------------
TCR_STRPN       ----------------------------------------------------------------------
TCR_BACSU       ----------------------------------------------------------------------
TCR_BACST       ----------------------------------------------------------------------
TCR_BACCE       ----------------------------------------------------------------------
SPNS2_MOUSE     ----------------------------------------------------------------------
SPNS2_HUMAN     ----------------------------------------------------------------------
NANT_ESCF3      ----------------------------------------------------------------------
BENK_ACIAD      ----------------------------------------------------------------------
YCEI_BACSU      ----------------------------------------------------------------------
TCR_STRAG       PGLGKNILFMIGVLCGGIIFGTVAGFVSMVPYMMKDVHQLSTAEIGSVIIFPGTMSVIIFGYIGGILVDR
PMRA_STRR6      ----------------------------------------------------------------------
PMRA_STRPN      ----------------------------------------------------------------------
YYAJ_BACSU      LKLKITIVLIFEGFYGFASW--VPSLL-----KSNGVTMEN-TLWYNVLHSVGAPLGALLGSMISERF--
SOTB_CITK8      ----------------------------------------------------------------------
DGOT_ECOLI      ----------------------------------------------------------------------
DGOT_ECOL6      ----------------------------------------------------------------------
PLT6_ARATH      ----------------------------------------------------------------------
BCR_HAEIN       ----------------------------------------------------------------------
AZR1_YEAST      ----------------------------------------------------------------------
PLT5_ARATH      ----------------------------------------------------------------------
NANT_SHIFL      ----------------------------------------------------------------------
NANT_SHIF8      ----------------------------------------------------------------------
NANT_SHIB3      ----------------------------------------------------------------------
NANT_ECOSM      ----------------------------------------------------------------------
NANT_ECOSE      ----------------------------------------------------------------------
NANT_ECOLI      ----------------------------------------------------------------------
NANT_ECOLC      ----------------------------------------------------------------------
NANT_ECOL5      ----------------------------------------------------------------------
NANT_ECOHS      ----------------------------------------------------------------------
NANT_ECODH      ----------------------------------------------------------------------
NANT_ECOBW      ----------------------------------------------------------------------
NANT_ECO8A      ----------------------------------------------------------------------
NANT_ECO7I      ----------------------------------------------------------------------
NANT_ECO5E      ----------------------------------------------------------------------
NANT_ECO57      ----------------------------------------------------------------------
NANT_ECO55      ----------------------------------------------------------------------
NANT_ECO45      ----------------------------------------------------------------------
NANT_ECO27      ----------------------------------------------------------------------
NANT_ECO24      ----------------------------------------------------------------------
NANT1_ECOL6     ----------------------------------------------------------------------
YRT3_CAEEL      ----------------------------------------------------------------------
TCR_STAHY       ----------------------------------------------------------------------
SVOP_MOUSE      ----------------------------------------------------------------------
SOTB_SALTI      ----------------------------------------------------------------------
SOTB_SALSV      ----------------------------------------------------------------------
SOTB_SALPK      ----------------------------------------------------------------------
SOTB_SALPC      ----------------------------------------------------------------------
SOTB_SALPB      ----------------------------------------------------------------------
SOTB_SALPA      ----------------------------------------------------------------------
SOTB_SALHS      ----------------------------------------------------------------------
SOTB_SALG2      ----------------------------------------------------------------------
SOTB_SALEP      ----------------------------------------------------------------------
SOTB_SALDC      ----------------------------------------------------------------------
SOTB_SALCH      ----------------------------------------------------------------------
SOTB_SALAR      ----------------------------------------------------------------------
SOTB_SALA4      ----------------------------------------------------------------------
PHT44_ORYSJ     ----------------------------------------------------------------------
YQJV_BACSU      ----------------------------------------------------------------------
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
SVOP_RAT        ----------------------------------------------------------------------
SPNS1_BOVIN     ----------------------------------------------------------------------
YJA1_SCHPO      ----------------------------------------------------------------------
YTBD_BACSU      VTNSRLLLLFVITALGYGGTFVVFTYLSPLLQEVTGFKAGTVAVXXXXXXXXXXXXXXXXXK-----LSN
YHX6_SCHPO      ----------------------------------------------------------------------
SGE1_YEAST      LK--------------------------------------------------------------------
PLT3_ARATH      ----------------------------------------------------------------------
YWTG_BACSU      ----------------------------------------------------------------------
YCNB_BACSU      ----------------------------------------------------------------------
SPNS2_DANRE     ----------------------------------------------------------------------
S22A7_HUMAN     ----------------------------------------------------------------------
HXT10_YEAST     ----------------------------------------------------------------------
SVOPL_HUMAN     ----------------------------------------------------------------------
QACA_STAAU      IGLVWSIKEFSEGLADIIPWVVI-----------------------------------------------
QACA_STAAM      IGLVWSIKEFSEGLADIIPWVVI-----------------------------------------------
YNFM_ECOLI      ----------------------------------------------------------------------
YAAU_ECOLI      ----------------------------------------------------------------------
S22A7_PONAB     ----------------------------------------------------------------------
GUDP_ECOLI      ----------------------------------------------------------------------
YWFA_BACSU      ----------------------------------------------------------------------
YN43_SCHPO      ----------------------------------------------------------------------
YJJL_ECOLI      ----------------------------------------------------------------------
Y588_BUCAI      ----------------------------------------------------------------------
NEPI_SHISS      -GVMAGMIAIFMSFAGQF---AFFTYIRPVYMNLAGFSVDGLTLVLLSF---------------------
YGAY_ECOLI      ----------------------------------------------------------------------
YGAY_ECO57      ----------------------------------------------------------------------
MHPT_ECOLI      ----------------------------------------------------------------------
BMR1_BACSU      ----------------------------------------------------------------------
ATR1_YEAST      ----------------------------------------------------------------------
SOTB_ERWT9      ----------------------------------------------------------------------
YFHI_BACSU      ----------------------------------------------------------------------
Y1560_METJA     ----------------------------------------------------------------------
XYLT_LACBR      ----------------------------------------------------------------------
PHT42_ORYSJ     ----------------------------------------------------------------------
ARAJ_ECOLI      ----------------------------------------------------------------------
S22A1_HUMAN     ----------------------------------------------------------------------
S17A5_HUMAN     ----------------------------------------------------------------------
NEPI_ECO27      ----------------------------------------------------------------------
NASA_BACSU      ----------------------------------------------------------------------
SVOPL_MOUSE     ----------------------------------------------------------------------
HXT5_YEAST      VTLEMQSSIEAERLAGSASWGELVTGKPQMFRR-------------------------------------
EMRB_HAEIN      ----------------------------------------------------------------------
Y567_BUCAP      ----------------------------------------------------------------------
VACHT_TORCA     ----------------------------------------------------------------------
MSSP3_ARATH     ----------------------------------------------------------------------
MDTL_SHESA      ----------------------------------------------------------------------
YCR3_YEAST      ----------------------------------------------------------------------
VACHT_TOROC     ----------------------------------------------------------------------
VACHT_TORMA     ----------------------------------------------------------------------
YJHB_ECOLI      ----------------------------------------------------------------------
S22A2_MOUSE     ----------------------------------------------------------------------
NEPI_SHIDS      ----------------------------------------------------------------------
HXT2_YEAST      AEMDTIMAVETERLAGNASWGEL-----------------------------------------------
GTR12_XENLA     ----------------------------------------------------------------------
YDHC_ECOLI      KTYRGNVLIYAACSASFFAWTGSPFILSEYSPAVIGLSYVPQTIAFLI----------------------
YBCL_BACSU      -KVAMGLSITFFWLGG---YSVAYTYLSPYLLNISGINGKLLSGVLLIFGIASLVGSKFGG------YST
NEPI_ECOL5      ----------------------------------------------------------------------
YN2F_SCHPO      ----------------------------------------------------------------------
YHCA_BACSU      ----------------------------------------------------------------------
YCEJ_BACSU      ----------------------------------------------------------------------
UNC17_CAEEL     ----------------------------------------------------------------------
PLST1_ARATH     ----------------------------------------------------------------------
NEPI_SHIFL      ----------------------------------------------------------------------
NEPI_SHIF8      ----------------------------------------------------------------------
NEPI_ECOLI      ----------------------------------------------------------------------
NEPI_ECOBW      ----------------------------------------------------------------------
MSSP1_ARATH     ----------------------------------------------------------------------
MMLH_RALEJ      ----------------------------------------------------------------------
SOTB_ESCF3      ----------------------------------------------------------------------
S22A2_RAT       ----------------------------------------------------------------------
S17A5_SHEEP     ----------------------------------------------------------------------
PLT4_ARATH      ----------------------------------------------------------------------
MDTL_SHEON      ----------------------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
NART_STAES      ----------------------------------------------------------------------
NART_STAEQ      ----------------------------------------------------------------------
NANT_ENTS8      ----------------------------------------------------------------------
YN42_SCHPO      YLLVPMKLLFTEPICFLITLYAILYLLLEIFGEKRHFSMGVAELPYI-----------------------
PLT1_ARATH      ----------------------------------------------------------------------
NEPI_ECOUT      ----------------------------------------------------------------------
NEPI_ECOL6      ----------------------------------------------------------------------
NEPI_ECOK1      ----------------------------------------------------------------------
ANTR4_ARATH     KRISTSGIPPFGRLLSKMPTWAV-----------------------------------------------
OCTL_DROME      ----------------------------------------------------------------------
NANT_SALA4      ----------------------------------------------------------------------
YN41_SCHPO      ----------------------------------------------------------------------
SOTB_ERWCH      ----------------------------------------------------------------------
S22A1_RABIT     ----------------------------------------------------------------------
PMRA_LACLA      NKVSNKQILF--GLLVXXXXXXXXXXXXEPFVTLYIKTLTTSTNNLMFISGLIVSAVGLSAMLSSSFLGR
NORA_STAAW      ----------------------------------------------------------------------
NORA_STAAU      ----------------------------------------------------------------------
NORA_STAAS      ----------------------------------------------------------------------
NORA_STAAN      ----------------------------------------------------------------------
NORA_STAAM      ----------------------------------------------------------------------
NORA_STAAC      ----------------------------------------------------------------------
NEPI_SHIBS      ----------------------------------------------------------------------
ERDL4_ARATH     ----------------------------------------------------------------------
YFMO_BACSU      ----------------------------------------------------------------------
YAJR_ECOLI      ----------------------------------------------------------------------
NORA_STAAR      ----------------------------------------------------------------------
NEPI_ECO57      ----------------------------------------------------------------------
GUDP_PSEPU      ----------------------------------------------------------------------
SOTB_PSE14      ----------------------------------------------------------------------
S17A9_HUMAN     ----------------------------------------------------------------------
BAIG_EUBSP      VVVFFSLFLCIPSFGQNIGWSS------------------------------------------------
YB30_YEAST      ----------------------------------------------------------------------
MDTD_PECCP      ----------------------------------------------------------------------
ERDL6_ARATH     ----------------------------------------------------------------------
YCLF_BACSU      ----------------------------------------------------------------------
SOTB_ENT38      ----------------------------------------------------------------------
ITR2_SCHPO      AEIAYKVSLIQEGVKVDFPEG-------------------------------------------------
SVOPL_DANRE     ----------------------------------------------------------------------
SV2A_RAT        ----------------------------------------------------------------------
SV2A_PONAB      ----------------------------------------------------------------------
SV2A_MOUSE      ----------------------------------------------------------------------
SV2A_MACFA      ----------------------------------------------------------------------
SV2A_HUMAN      ----------------------------------------------------------------------
SV2A_BOVIN      ----------------------------------------------------------------------
S22A1_RAT       ----------------------------------------------------------------------
PBUE_BACAM      ----------------------------------------------------------------------
GTR10_XENLA     ----------------------------------------------------------------------
ARAE_ECOLI      ----------------------------------------------------------------------
ARAE_ECO57      ----------------------------------------------------------------------
YYBO_BACSU      ----------------------------------------------------------------------
NART_STAAW      ----------------------------------------------------------------------
NART_STAAT      ----------------------------------------------------------------------
NART_STAAS      ----------------------------------------------------------------------
NART_STAAN      ----------------------------------------------------------------------
NART_STAAM      ----------------------------------------------------------------------
NART_STAAE      ----------------------------------------------------------------------
NART_STAAC      ----------------------------------------------------------------------
NART_STAAB      ----------------------------------------------------------------------
NART_STAA9      ----------------------------------------------------------------------
NART_STAA8      ----------------------------------------------------------------------
NART_STAA3      ----------------------------------------------------------------------
NART_STAA2      ----------------------------------------------------------------------
NART_STAA1      ----------------------------------------------------------------------
YQO5_SCHPO      ----------------------------------------------------------------------
YFIU_BACSU      ----------------------------------------------------------------------
SV2B_RAT        ----------------------------------------------------------------------
SPX3_XENLA      ----------------------------------------------------------------------
SOTB_HAEIN      ----------------------------------------------------------------------
SOTB_HAEIG      ----------------------------------------------------------------------
SETB_ECOLI      ----------------------------------------------------------------------
PCAK_PSEPU      ----------------------------------------------------------------------
NART_STAAR      ----------------------------------------------------------------------
BSU1_SCHPO      ----------------------------------------------------------------------
SETB_SALTY      ---RDTLLLF---VICTLMWGTNSLYII------------------------------------------
EDL14_ARATH     ----------------------------------------------------------------------
YFKF_BACSU      ----------------------------------------------------------------------
YCT4_SCHPO      ----------------------------------------------------------------------
S22A1_MOUSE     ----------------------------------------------------------------------
ERDL7_ARATH     ----------------------------------------------------------------------
YLD2_CAEEL      ----------------------------------------------------------------------
YHM9_SCHPO      ----------------------------------------------------------------------
YDJE_ECOLI      ----------------------------------------------------------------------
XYLL3_ARATH     ----------------------------------------------------------------------
VBA2_YEAST      ----------------------------------------------------------------------
SPX2_DANRE      ----------------------------------------------------------------------
S22A4_HUMAN     ----------------------------------------------------------------------
NPT3_BOVIN      ----------------------------------------------------------------------
YFIG_BACSU      ----------------------------------------------------------------------
YDFJ_ECOLI      ----------------------------------------------------------------------
YD387_YEAST     ----------------------------------------------------------------------
S22A4_PAPAN     ----------------------------------------------------------------------
PHT47_ORYSJ     ----------------------------------------------------------------------
GTR1_PIG        ----------------------------------------------------------------------
EDL10_ARATH     IQVMTKML--------------------------------------------------------------
VACHT_DROME     ----------------------------------------------------------------------
TCMA_STRGA      ----------------------------------------------------------------------
S22A6_MOUSE     ----------------------------------------------------------------------
S22A2_HUMAN     ----------------------------------------------------------------------
PT113_ORYSJ     ----------------------------------------------------------------------
YMPB_CAEEL      IKTANRMVI------------SLVYFAISF------MSVELGGDQVQAFLYSSLIEIPAGLAVIPLMMKM
SOTB_HAEI8      ----------------------------------------------------------------------
S22A6_RAT       ----------------------------------------------------------------------
PLT2_ARATH      ----------------------------------------------------------------------
PHT19_ARATH     ----------------------------------------------------------------------
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
ERDL5_ARATH     ----------------------------------------------------------------------
YUXJ_BACSU      ----------------------------------------------------------------------
YDHP_ECOLI      ----------------------------------------------------------------------
YDHP_ECO57      ----------------------------------------------------------------------
Y1104_HAEIN     ----------------------------------------------------------------------
VGLU3_DANRE     ----------------------------------------------------------------------
SV2B_MOUSE      ----------------------------------------------------------------------
SOTB_PSESM      ----------------------------------------------------------------------
SOTB_PSEE4      ----------------------------------------------------------------------
S22A7_MOUSE     ----------------------------------------------------------------------
S17A5_MOUSE     ----------------------------------------------------------------------
PHT12_ORYSJ     ----------------------------------------------------------------------
ARAE_KLEOX      ----------------------------------------------------------------------
SOTB_PSEU2      ----------------------------------------------------------------------
MOT6_HUMAN      ----------------------------------------------------------------------
MDFA_ECOLI      ----------------------------------------------------------------------
MDFA_ECOL6      ----------------------------------------------------------------------
MDFA_ECO57      ----------------------------------------------------------------------
GTR1_HUMAN      ----------------------------------------------------------------------
GTR1_BOVIN      ----------------------------------------------------------------------
EMRY_ECOLI      ----------------------------------------------------------------------
EAT4_CAEEL      ----------------------------------------------------------------------
VGLU1_RAT       ----------------------------------------------------------------------
VGLU1_MOUSE     ----------------------------------------------------------------------
VGLU1_BOVIN     ----------------------------------------------------------------------
VGL2A_DANRE     ----------------------------------------------------------------------
TCR_STAES       ----------------------------------------------------------------------
TCR_STAAU       ----------------------------------------------------------------------
S17A9_MOUSE     ----------------------------------------------------------------------
MSSP2_ARATH     ----------------------------------------------------------------------
ITR1_YEAST      ----------------------------------------------------------------------
ERD6_ARATH      ----------------------------------------------------------------------
Y4XM_RHISN      ----------------------------------------------------------------------
UHPC_SALTY      ----------------------------------------------------------------------
S22A5_HUMAN     ----------------------------------------------------------------------
PHT15_ORYSJ     ----------------------------------------------------------------------
PHT14_ORYSJ     ----------------------------------------------------------------------
PHT14_ORYSI     ----------------------------------------------------------------------
MFS10_HUMAN     ----------------------------------------------------------------------
HXT17_YEAST     ----------------------------------------------------------------------
GTR2_BOVIN      ----------------------------------------------------------------------
GTR1_RAT        ----------------------------------------------------------------------
GTR1_MOUSE      ----------------------------------------------------------------------
ERDL8_ARATH     ----------------------------------------------------------------------
EDL16_ARATH     ----------------------------------------------------------------------
BCRH_RICPR      ----------------------------------------------------------------------
UHPC_ECOLI      ----------------------------------------------------------------------
S22A2_PONAB     ----------------------------------------------------------------------
QUTD_EMENI      ----------------------------------------------------------------------
PROP_SALTY      ----------------------------------------------------------------------
HXT13_YEAST     ----------------------------------------------------------------------
HIAT1_MOUSE     ----------------------------------------------------------------------
EDL11_ARATH     IQVMTKML--------------------------------------------------------------
YQEH_SCHPO      ----------------------------------------------------------------------
Y532_BUCBP      ----------------------------------------------------------------------
VMAT2_RAT       I-AAGSICFANMGIAMLEP--ALPIWMMETMKWQLGVAFLPASISYLI-----------GTNIFGILAHK
TCR2_ECOLX      ----------------------------------------------------------------------
S22A1_BOVIN     ----------------------------------------------------------------------
PROP_ECOLI      ----------------------------------------------------------------------
PROP_ECO57      ----------------------------------------------------------------------
MDTM_SALTY      ----------------------------------------------------------------------
MDTM_SALTI      ----------------------------------------------------------------------
ITR2_YEAST      ----------------------------------------------------------------------
GTR7_HUMAN      ----------------------------------------------------------------------
EDL13_ARATH     ----------------------------------------------------------------------
BCR_ECOLI       ----------------------------------------------------------------------
BCRH_RICTY      ----------------------------------------------------------------------
YBFB_BACSU      ----------------------------------------------------------------------
S22A6_RABIT     ----------------------------------------------------------------------
PT111_ORYSJ     ----------------------------------------------------------------------
PHT18_ORYSJ     ----------------------------------------------------------------------
NPT3_HUMAN      ----------------------------------------------------------------------
NART_STAHJ      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
MFS10_MOUSE     ----------------------------------------------------------------------
HXT1_YEAST      ELETIEASVEEMRAAGTASWGEL-----------------------------------------------
HIAT1_HUMAN     ----------------------------------------------------------------------
GTR7_RAT        ----------------------------------------------------------------------
GTR2_HUMAN      ----------------------------------------------------------------------
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
YCAD_SALEP      ----------------------------------------------------------------------
YCAD_ESCF3      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------
VGLU1_HUMAN     ----------------------------------------------------------------------
SPX2_BOVIN      ----------------------------------------------------------------------
SOTB_PASMU      ----------------------------------------------------------------------
S22A3_MOUSE     ----------------------------------------------------------------------
RAG1_KLULA      VKLKIQSSIELEKAAGNASWGELITGKPSMFRRTQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSI---
PT112_ORYSJ     V---------------------------------------------------------------------
ORCT_DROME      ----------------------------------------------------------------------
MDTD_YERE8      ----------------------------------------------------------------------
VGLU2_RAT       ----------------------------------------------------------------------
VGLU2_MOUSE     ----------------------------------------------------------------------
VGLU2_HUMAN     ----------------------------------------------------------------------
VGLU2_BOVIN     ----------------------------------------------------------------------
STP5_ARATH      ----------------------------------------------------------------------
S22AC_MOUSE     ----------------------------------------------------------------------
S22A3_RAT       ----------------------------------------------------------------------
S22A2_RABIT     ----------------------------------------------------------------------
S226B_XENLA     ----------------------------------------------------------------------
LPLT_PHOLL      ----------------------------------------------------------------------
HSRA_ECOLI      ----------------------------------------------------------------------
EDL15_ARATH     ----------------------------------------------------------------------
YCAD_SALG2      ----------------------------------------------------------------------
YCAD_SALDC      ----------------------------------------------------------------------
XYLL1_ARATH     ----------------------------------------------------------------------
UHPT_CHLPN      ----------------------------------------------------------------------
SPX2_MOUSE      ----------------------------------------------------------------------
SPX2_HUMAN      ----------------------------------------------------------------------
S22A7_PIG       ----------------------------------------------------------------------
MMR_STRCO       ----------------------------------------------------------------------
LMRB_BACSU      ----------------------------------------------------------------------
HXT9_YEAST      AEYDTKAGIELEKLAGNASWSELLSTKTKVFQR-------------------------------------
HXT11_YEAST     VEYDTKAGIELEKLAGNASWSELLSTKTKVFQR-------------------------------------
GTR1_RABIT      ----------------------------------------------------------------------
YMFD_BACSU      ----------------------------------------------------------------------
YJ94_YEAST      ----------------------------------------------------------------------
YHD3_SCHPO      ----------------------------------------------------------------------
YDER_BACSU      ----------------------------------------------------------------------
YCAD_SALPB      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
TCR8_PASMU      ----------------------------------------------------------------------
S22A7_BOVIN     ----------------------------------------------------------------------
S22A2_PIG       ----------------------------------------------------------------------
PHT16_ORYSJ     ----------------------------------------------------------------------
PHT11_ORYSJ     ----------------------------------------------------------------------
MDTD_SERP5      ----------------------------------------------------------------------
HXT3_YEAST      IEASVE----EARAAGSASWGEL-----------------------------------------------
YCAD_SALTY      ----------------------------------------------------------------------
YCAD_SALTI      ----------------------------------------------------------------------
YCAD_SALSV      ----------------------------------------------------------------------
YCAD_SALPK      ----------------------------------------------------------------------
YCAD_SALPC      ----------------------------------------------------------------------
YCAD_SALPA      ----------------------------------------------------------------------
YCAD_SALNS      ----------------------------------------------------------------------
YCAD_SALHS      ----------------------------------------------------------------------
YCAD_SALCH      ----------------------------------------------------------------------
YCAD_SALA4      ----------------------------------------------------------------------
Y2171_CITK8     ----------------------------------------------------------------------
VGL2B_DANRE     ----------------------------------------------------------------------
TUB3_AGRVI      ----------------------------------------------------------------------
S22FL_XENLA     ----------------------------------------------------------------------
PCFT_XENLA      ----------------------------------------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
GLPT_HUMAN      ----------------------------------------------------------------------
YCAD_SALAR      ----------------------------------------------------------------------
YBN1_SCHPO      ----------------------------------------------------------------------
YB91_YEAST      ----------------------------------------------------------------------
TUB4_AGRVI      ----------------------------------------------------------------------
SPX2_XENLA      ----------------------------------------------------------------------
S22A6_MACFA     ----------------------------------------------------------------------
PHT13_ORYSJ     ----------------------------------------------------------------------
PBUE_BACSU      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
HXT16_YEAST     ----------------------------------------------------------------------
HXT15_YEAST     ----------------------------------------------------------------------
GTR7_MOUSE      ----------------------------------------------------------------------
GTR2_MOUSE      ----------------------------------------------------------------------
GTR2_CHICK      ----------------------------------------------------------------------
YI32_SCHPO      ----------------------------------------------------------------------
SOTB_PSEA7      ----------------------------------------------------------------------
SETA_ECOLI      ---DSNVRMLF--VASTLMWTCNTMYIIDWISSELGLPDKLAG-----FLMGTAAGLEIPAMILAGYYVK
S22AL_MOUSE     ----------------------------------------------------------------------
S22A6_PONAB     ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
GTR2_RAT        ----------------------------------------------------------------------
Y1317_METJA     ----------------------------------------------------------------------
SPX3_CHICK      ----------------------------------------------------------------------
S22AA_HUMAN     ----------------------------------------------------------------------
QAY_NEUCR       ----------------------------------------------------------------------
GTR1_CHICK      ----------------------------------------------------------------------
CF192_HUMAN     ----------------------------------------------------------------------
VMAT2_HUMAN     I-AAGSICFANMGIAMLEP--ALPIWMMETMKWQLGVAFLPASISYLI-----------GTNIFGILAHK
VGLU1_XENLA     ----------------------------------------------------------------------
SPX2_XENTR      ----------------------------------------------------------------------
SOTB_PSEAE      ----------------------------------------------------------------------
SOTB_PSEAB      ----------------------------------------------------------------------
SOTB_PSEA8      ----------------------------------------------------------------------
SOTB_ERWCT      ----------------------------------------------------------------------
S22AC_RAT       ----------------------------------------------------------------------
S22A6_HUMAN     ----------------------------------------------------------------------
S226A_XENLA     ----------------------------------------------------------------------
PROP_STAAW      ----------------------------------------------------------------------
PROP_STAAS      ----------------------------------------------------------------------
PROP_STAAR      ----------------------------------------------------------------------
PROP_STAAN      ----------------------------------------------------------------------
PROP_STAAM      ----------------------------------------------------------------------
PROP_STAAC      ----------------------------------------------------------------------
PROP_STAA1      ----------------------------------------------------------------------
PLST3_ARATH     ----------------------------------------------------------------------
OXLT_OXAFO      ----------------------------------------------------------------------
NEPI_SALPK      ----------------------------------------------------------------------
NEPI_SALPA      ----------------------------------------------------------------------
MFSD9_MOUSE     ----------------------------------------------------------------------
ERDL2_ARATH     ----------------------------------------------------------------------
YHD1_SCHPO      ----------------------------------------------------------------------
SPX3_HUMAN      AQVKA--ISFYQ--ACCLP-GVIPYSL-------------------------------------------
S22A6_PIG       ----------------------------------------------------------------------
QAY_NEUTR       ----------------------------------------------------------------------
PHT17_ARATH     V---------------------------------------------------------------------
GTR11_HUMAN     ----------------------------------------------------------------------
GIT1_YEAST      ----------------------------------------------------------------------
ANTR5_ARATH     ----------------------------------------------------------------------
YBJJ_ECOLI      ----------------------------------------------------------------------
VMAT2_BOVIN     I-AAGSICFANMGIAMLEP--ALPIWMMETMKWQLGVAFLPASVSYLI----------GTNVFGILAHKM
TPPB_ECOLI      ----------------------------------------------------------------------
TPPB_ECOL6      ----------------------------------------------------------------------
TPPB_ECO57      ----------------------------------------------------------------------
PROP_STAHJ      ----------------------------------------------------------------------
PHT15_ARATH     ----------------------------------------------------------------------
YCAD_SHIFL      ----------------------------------------------------------------------
YCAD_SHIF8      ----------------------------------------------------------------------
PROP_STAEQ      ----------------------------------------------------------------------
NEPI_SALTY      ----------------------------------------------------------------------
NEPI_SALTI      ----------------------------------------------------------------------
NEPI_SALPC      ----------------------------------------------------------------------
NEPI_SALPB      ----------------------------------------------------------------------
NEPI_SALCH      ----------------------------------------------------------------------
MDTG_CITK8      ----------------------------------------------------------------------
HXT7_YEAST      ----------------------------------------------------------------------
HXT6_YEAST      ----------------------------------------------------------------------
HXT4_YEAST      ----------------------------------------------------------------------
EDL17_ARATH     ----------------------------------------------------------------------
YM8M_YEAST      ----------------------------------------------------------------------
YDJK_ECOLI      ----------------------------------------------------------------------
S22AO_PONAB     ----------------------------------------------------------------------
PHT11_ARATH     ----------------------------------------------------------------------
OCT1_CAEEL      ----------------------------------------------------------------------
NPT1_HUMAN      ----------------------------------------------------------------------
NEPI_SALG2      ----------------------------------------------------------------------
NEPI_SALEP      ----------------------------------------------------------------------
GTR3_MOUSE      ----------------------------------------------------------------------
ANTR6_ARATH     ----------------------------------------------------------------------
YCAD_ECOUT      ----------------------------------------------------------------------
YCAD_ECOL6      ----------------------------------------------------------------------
YCAD_ECOL5      ----------------------------------------------------------------------
YCAD_ECOK1      ----------------------------------------------------------------------
YCAD_ECO81      ----------------------------------------------------------------------
YCAD_ECO45      ----------------------------------------------------------------------
Y411_BUCBP      ----------------------------------------------------------------------
STP12_ARATH     ----------------------------------------------------------------------
SPX3_MOUSE      ----------------------------------------------------------------------
QAY_NEUAF       ----------------------------------------------------------------------
PHT13_ARATH     ----------------------------------------------------------------------
PHT12_ARATH     ----------------------------------------------------------------------
GTR14_HUMAN     ----------------------------------------------------------------------
BCRH_RICBR      ----------------------------------------------------------------------
YKH4_CAEEL      ----------------------------------------------------------------------
YJDL_ECOLI      ----------------------------------------------------------------------
YHA8_SCHPO      ----------------------------------------------------------------------
YFNC_BACSU      ----------------------------------------------------------------------
YCAD_SHISS      ----------------------------------------------------------------------
YCAD_SHIDS      ----------------------------------------------------------------------
YCAD_ECOSM      ----------------------------------------------------------------------
YCAD_ECOSE      ----------------------------------------------------------------------
YCAD_ECOLU      ----------------------------------------------------------------------
YCAD_ECOLI      ----------------------------------------------------------------------
YCAD_ECOLC      ----------------------------------------------------------------------
YCAD_ECOHS      ----------------------------------------------------------------------
YCAD_ECODH      ----------------------------------------------------------------------
YCAD_ECOBW      ----------------------------------------------------------------------
YCAD_ECO8A      ----------------------------------------------------------------------
YCAD_ECO7I      ----------------------------------------------------------------------
YCAD_ECO5E      ----------------------------------------------------------------------
YCAD_ECO57      ----------------------------------------------------------------------
YCAD_ECO55      ----------------------------------------------------------------------
YCAD_ECO27      ----------------------------------------------------------------------
YCAD_ECO24      ----------------------------------------------------------------------
VGLU3_HUMAN     ----------------------------------------------------------------------
SPX3_BOVIN      ----------------------------------------------------------------------
S22A5_MOUSE     ----------------------------------------------------------------------
MFS10_BOVIN     ----------------------------------------------------------------------
FTSK_CHLTE      -------------------------------------------------------------------YIV
ENB1_YEAST      ----------------------------------------------------------------------
EMRD_ECOLI      ----------------------------------------------------------------------
CMLR_STRLI      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SRPFLPLFCSITTALGTFFTVMTLDYMGSLLVLMLLGFIASFTASLTGPNVKFMLLNVNEPQERGRIFSI
SPNS1_XENTR     TNPRAPLVCAVGMISSAPFLYLSLAFADSLVATYAFIFIGETLLSLNWALVADILLYVVIPTRRSTAEAL
EXUT_BACSU      ----------------------------------------------------------------------
SPNS1_XENLA     ----------------------------------------------------------------------
YIM0_YEAST      ----------------------------------------------------------------------
SPIN_DROME      ----------------------------------------------------------------------
YOU1_CAEEL      ----------------------------------------------------------------------
SPNS3_DANRE     ----------------------------------------------------------------------
PCAK_ACIAD      ----------------------------------------------------------------------
MDTL_SALTY      ----------------------------------------------------------------------
MDTL_SALPB      ----------------------------------------------------------------------
MDTL_SALNS      ----------------------------------------------------------------------
MDTL_SALHS      ----------------------------------------------------------------------
MDTL_SALA4      ----------------------------------------------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
MDTL_SALEP      ----------------------------------------------------------------------
MDTL_SALDC      ----------------------------------------------------------------------
MDTL_SALAR      ----------------------------------------------------------------------
YITG_BACSU      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
MDTL_SALSV      ----------------------------------------------------------------------
MDTL_SALPK      ----------------------------------------------------------------------
MDTL_SALPA      ----------------------------------------------------------------------
MDTL_SALPC      ----------------------------------------------------------------------
MDTL_SALCH      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
SPNS1_DANRE     ----------------------------------------------------------------------
BMR3_BACSU      ----------------------------------------------------------------------
SVOP_PONAB      ----------------------------------------------------------------------
SVOP_HUMAN      ----------------------------------------------------------------------
SVOP_BOVIN      ----------------------------------------------------------------------
MDTL_KLEP3      ----------------------------------------------------------------------
MDTL_KLEP7      ----------------------------------------------------------------------
ANTR3_ARATH     SDFLIRTGHSVTSVRK---IMQSIGFMGPGLSLLCLNFAKSIALSLSSFSQAGFLLNMQDPQYAGFLHGI
NANT_YERPY      ----------------------------------------------------------------------
MDTL_VIBPA      ----------------------------------------------------------------------
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
GUDP_BACSU      ----------------------------------------------------------------------
SPNS3_MOUSE     ----------------------------------------------------------------------
SPNS3_HUMAN     ----------------------------------------------------------------------
MDTL_ECOSE      ----------------------------------------------------------------------
MDTL_ECOLI      ----------------------------------------------------------------------
MDTL_ECODH      ----------------------------------------------------------------------
MDTL_ECOBW      ----------------------------------------------------------------------
MDTL_ECO55      ----------------------------------------------------------------------
SV2C_HUMAN      ----------------------------------------------------------------------
MDTL_ESCF3      ----------------------------------------------------------------------
MDTL_SHISS      ----------------------------------------------------------------------
MDTL_SHIFL      ----------------------------------------------------------------------
MDTL_SHIDS      ----------------------------------------------------------------------
MDTL_SHIBS      ----------------------------------------------------------------------
MDTL_SHIB3      ----------------------------------------------------------------------
MDTL_ECOUT      ----------------------------------------------------------------------
MDTL_ECOLC      ----------------------------------------------------------------------
MDTL_ECOK1      ----------------------------------------------------------------------
MDTL_ECOHS      ----------------------------------------------------------------------
MDTL_ECO5E      ----------------------------------------------------------------------
MDTL_ECO57      ----------------------------------------------------------------------
MDTL_ECO45      ----------------------------------------------------------------------
VACHT_DANRE     ----------------------------------------------------------------------
TCRB_BACSU      ----------------------------------------------------------------------
SPNS2_XENTR     ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
MDTL_ECOL5      ----------------------------------------------------------------------
MDTL_ECO27      ----------------------------------------------------------------------
ANTR2_ARATH     ----------------------------------------------------------------------
PHT43_ORYSJ     ----------------------------------------------------------------------
MDTL_ECO7I      ----------------------------------------------------------------------
YIM1_YEAST      ----------------------------------------------------------------------
SVOP_XENLA      ----------------------------------------------------------------------
SOTB_SHISS      ----------------------------------------------------------------------
SOTB_SHIFL      ----------------------------------------------------------------------
SOTB_SHIF8      ----------------------------------------------------------------------
SOTB_SHIBS      ----------------------------------------------------------------------
SOTB_SHIB3      ----------------------------------------------------------------------
SOTB_ECOSM      ----------------------------------------------------------------------
SOTB_ECOSE      ----------------------------------------------------------------------
SOTB_ECOLU      ----------------------------------------------------------------------
SOTB_ECOLI      ----------------------------------------------------------------------
SOTB_ECOLC      ----------------------------------------------------------------------
SOTB_ECOHS      ----------------------------------------------------------------------
SOTB_ECODH      ----------------------------------------------------------------------
SOTB_ECOBW      ----------------------------------------------------------------------
SOTB_ECO8A      ----------------------------------------------------------------------
SOTB_ECO7I      ----------------------------------------------------------------------
SOTB_ECO5E      ----------------------------------------------------------------------
SOTB_ECO57      ----------------------------------------------------------------------
SOTB_ECO55      ----------------------------------------------------------------------
SOTB_ECO24      ----------------------------------------------------------------------
MDTL_ECOSM      ----------------------------------------------------------------------
MDTL_ECOLU      ----------------------------------------------------------------------
TPO3_YEAST      ----------------------------------------------------------------------
MDTL_ECOL6      ----------------------------------------------------------------------
MDTL_ECO8A      ----------------------------------------------------------------------
MDTL_ECO81      ----------------------------------------------------------------------
MDTL_ECO24      ----------------------------------------------------------------------
GARP_ECOLI      ----------------------------------------------------------------------
GARP_ECO57      ----------------------------------------------------------------------
SV2C_RAT        ----------------------------------------------------------------------
SV2B_HUMAN      ----------------------------------------------------------------------
MDTL_CITK8      ----------------------------------------------------------------------
VBA5_YEAST      ----------------------------------------------------------------------
SV2C_MOUSE      ----------------------------------------------------------------------
PHT41_ORYSJ     ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
NANT_SALTY      ----------------------------------------------------------------------
NANT_SALTI      ----------------------------------------------------------------------
NANT_SALSV      ----------------------------------------------------------------------
NANT_SALPK      ----------------------------------------------------------------------
NANT_SALPC      ----------------------------------------------------------------------
NANT_SALPB      ----------------------------------------------------------------------
NANT_SALPA      ----------------------------------------------------------------------
NANT_SALNS      ----------------------------------------------------------------------
NANT_SALHS      ----------------------------------------------------------------------
NANT_SALG2      ----------------------------------------------------------------------
NANT_SALEP      ----------------------------------------------------------------------
NANT_SALDC      ----------------------------------------------------------------------
NANT_SALCH      ----------------------------------------------------------------------
NANT_SALAR      ----------------------------------------------------------------------
ANTR1_ARATH     ----------------------------------------------------------------------
VACHT_RAT       ----------------------------------------------------------------------
TPO2_YEAST      ----------------------------------------------------------------------
SPNS1_HUMAN     ----------------------------------------------------------------------
MDTM_ECO57      ----------------------------------------------------------------------
MDTL_SHIF8      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
SPNS1_RAT       ----------------------------------------------------------------------
SPNS1_MOUSE     ----------------------------------------------------------------------
SOTB_ECOUT      ----------------------------------------------------------------------
SOTB_ECOL6      ----------------------------------------------------------------------
SOTB_ECOL5      ----------------------------------------------------------------------
SOTB_ECOK1      ----------------------------------------------------------------------
SOTB_ECO81      ----------------------------------------------------------------------
SOTB_ECO45      ----------------------------------------------------------------------
SOTB_ECO27      ----------------------------------------------------------------------
YWOD_BACSU      ----------------------------------------------------------------------
SOTB_SALTY      ----------------------------------------------------------------------
SOTB_SALNS      ----------------------------------------------------------------------
VACHT_HUMAN     ----------------------------------------------------------------------
NANT_CITK8      ----------------------------------------------------------------------
MDTM_ECOLI      ----------------------------------------------------------------------
VACHT_MOUSE     ----------------------------------------------------------------------
TCR_STRPN       ----------------------------------------------------------------------
TCR_BACSU       ----------------------------------------------------------------------
TCR_BACST       ----------------------------------------------------------------------
TCR_BACCE       ----------------------------------------------------------------------
SPNS2_MOUSE     ----------------------------------------------------------------------
SPNS2_HUMAN     ----------------------------------------------------------------------
NANT_ESCF3      ----------------------------------------------------------------------
BENK_ACIAD      ----------------------------------------------------------------------
YCEI_BACSU      ----------------------------------------------------------------------
TCR_STRAG       RGPLYVLNIGVTSFLTAFFLLETTSWFMTIIIVFVLGGL-SFTKTVIPTIVSSSL----KQQEAGAGMSL
PMRA_STRR6      ----------------------------------------------------------------------
PMRA_STRPN      ----------------------------------------------------------------------
YYAJ_BACSU      QRKWILAASAFLTAIAGLLYGMTF----IPIMIIVFGFIVNITERVFTSN---LYAYTSEPYPTEYRSSG
SOTB_CITK8      ----------------------------------------------------------------------
DGOT_ECOLI      ----------------------------------------------------------------------
DGOT_ECOL6      ----------------------------------------------------------------------
PLT6_ARATH      ----------------------------------------------------------------------
BCR_HAEIN       ----------------------------------------------------------------------
AZR1_YEAST      ----------------------------------------------------------------------
PLT5_ARATH      ----------------------------------------------------------------------
NANT_SHIFL      ----------------------------------------------------------------------
NANT_SHIF8      ----------------------------------------------------------------------
NANT_SHIB3      ----------------------------------------------------------------------
NANT_ECOSM      ----------------------------------------------------------------------
NANT_ECOSE      ----------------------------------------------------------------------
NANT_ECOLI      ----------------------------------------------------------------------
NANT_ECOLC      ----------------------------------------------------------------------
NANT_ECOL5      ----------------------------------------------------------------------
NANT_ECOHS      ----------------------------------------------------------------------
NANT_ECODH      ----------------------------------------------------------------------
NANT_ECOBW      ----------------------------------------------------------------------
NANT_ECO8A      ----------------------------------------------------------------------
NANT_ECO7I      ----------------------------------------------------------------------
NANT_ECO5E      ----------------------------------------------------------------------
NANT_ECO57      ----------------------------------------------------------------------
NANT_ECO55      ----------------------------------------------------------------------
NANT_ECO45      ----------------------------------------------------------------------
NANT_ECO27      ----------------------------------------------------------------------
NANT_ECO24      ----------------------------------------------------------------------
NANT1_ECOL6     ----------------------------------------------------------------------
YRT3_CAEEL      ----------------------------------------------------------------------
TCR_STAHY       ----------------------------------------------------------------------
SVOP_MOUSE      ----------------------------------------------------------------------
SOTB_SALTI      ----------------------------------------------------------------------
SOTB_SALSV      ----------------------------------------------------------------------
SOTB_SALPK      ----------------------------------------------------------------------
SOTB_SALPC      ----------------------------------------------------------------------
SOTB_SALPB      ----------------------------------------------------------------------
SOTB_SALPA      ----------------------------------------------------------------------
SOTB_SALHS      ----------------------------------------------------------------------
SOTB_SALG2      ----------------------------------------------------------------------
SOTB_SALEP      ----------------------------------------------------------------------
SOTB_SALDC      ----------------------------------------------------------------------
SOTB_SALCH      ----------------------------------------------------------------------
SOTB_SALAR      ----------------------------------------------------------------------
SOTB_SALA4      ----------------------------------------------------------------------
PHT44_ORYSJ     ----------------------------------------------------------------------
YQJV_BACSU      ----------------------------------------------------------------------
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
SVOP_RAT        ----------------------------------------------------------------------
SPNS1_BOVIN     ----------------------------------------------------------------------
YJA1_SCHPO      ----------------------------------------------------------------------
YTBD_BACSU      RNPIAALFMFIVQAIVLFVLTFTAPYQAALITILCMGLLAFM--NVPGLQVYVVMLAERFVPSAVDVASA
YHX6_SCHPO      ----------------------------------------------------------------------
SGE1_YEAST      ----------------------------------------------------------------------
PLT3_ARATH      ----------------------------------------------------------------------
YWTG_BACSU      ----------------------------------------------------------------------
YCNB_BACSU      ----------------------------------------------------------------------
SPNS2_DANRE     ----------------------------------------------------------------------
S22A7_HUMAN     ----------------------------------------------------------------------
HXT10_YEAST     ----------------------------------------------------------------------
SVOPL_HUMAN     ----------------------------------------------------------------------
QACA_STAAU      ----------------------------------------------------------------------
QACA_STAAM      ----------------------------------------------------------------------
YNFM_ECOLI      ----------------------------------------------------------------------
YAAU_ECOLI      ----------------------------------------------------------------------
S22A7_PONAB     ----------------------------------------------------------------------
GUDP_ECOLI      ----------------------------------------------------------------------
YWFA_BACSU      ----------------------------------------------------------------------
YN43_SCHPO      ----------------------------------------------------------------------
YJJL_ECOLI      ----------------------------------------------------------------------
Y588_BUCAI      ----------------------------------------------------------------------
NEPI_SHISS      ----------------------------------------------------------------------
YGAY_ECOLI      ----------------------------------------------------------------------
YGAY_ECO57      ----------------------------------------------------------------------
MHPT_ECOLI      ----------------------------------------------------------------------
BMR1_BACSU      ----------------------------------------------------------------------
ATR1_YEAST      ----------------------------------------------------------------------
SOTB_ERWT9      ----------------------------------------------------------------------
YFHI_BACSU      ----------------------------------------------------------------------
Y1560_METJA     ----------------------------------------------------------------------
XYLT_LACBR      ----------------------------------------------------------------------
PHT42_ORYSJ     ----------------------------------------------------------------------
ARAJ_ECOLI      ----------------------------------------------------------------------
S22A1_HUMAN     ----------------------------------------------------------------------
S17A5_HUMAN     ----------------------------------------------------------------------
NEPI_ECO27      ----------------------------------------------------------------------
NASA_BACSU      ----------------------------------------------------------------------
SVOPL_MOUSE     ----------------------------------------------------------------------
HXT5_YEAST      ----------------------------------------------------------------------
EMRB_HAEIN      ----------------------------------------------------------------------
Y567_BUCAP      ----------------------------------------------------------------------
VACHT_TORCA     ----------------------------------------------------------------------
MSSP3_ARATH     ----------------------------------------------------------------------
MDTL_SHESA      ----------------------------------------------------------------------
YCR3_YEAST      ----------------------------------------------------------------------
VACHT_TOROC     ----------------------------------------------------------------------
VACHT_TORMA     ----------------------------------------------------------------------
YJHB_ECOLI      ----------------------------------------------------------------------
S22A2_MOUSE     ----------------------------------------------------------------------
NEPI_SHIDS      ----------------------------------------------------------------------
HXT2_YEAST      ----------------------------------------------------------------------
GTR12_XENLA     ----------------------------------------------------------------------
YDHC_ECOLI      ----------------------------------------------------------------------
YBCL_BACSU      DKWGVPLVGGMTLHIVTLLSLVTHSYIGVLVILILW----SFAAWSTGPTQQFHLATI-EPEMSGVLLSM
NEPI_ECOL5      ----------------------------------------------------------------------
YN2F_SCHPO      ----------------------------------------------------------------------
YHCA_BACSU      ----------------------------------------------------------------------
YCEJ_BACSU      ----------------------------------------------------------------------
UNC17_CAEEL     ----------------------------------------------------------------------
PLST1_ARATH     ----------------------------------------------------------------------
NEPI_SHIFL      ----------------------------------------------------------------------
NEPI_SHIF8      ----------------------------------------------------------------------
NEPI_ECOLI      ----------------------------------------------------------------------
NEPI_ECOBW      ----------------------------------------------------------------------
MSSP1_ARATH     ----------------------------------------------------------------------
MMLH_RALEJ      ----------------------------------------------------------------------
SOTB_ESCF3      ----------------------------------------------------------------------
S22A2_RAT       ----------------------------------------------------------------------
S17A5_SHEEP     ----------------------------------------------------------------------
PLT4_ARATH      ----------------------------------------------------------------------
MDTL_SHEON      ----------------------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
NART_STAES      ----------------------------------------------------------------------
NART_STAEQ      ----------------------------------------------------------------------
NANT_ENTS8      ----------------------------------------------------------------------
YN42_SCHPO      ----------------------------------------------------------------------
PLT1_ARATH      ----------------------------------------------------------------------
NEPI_ECOUT      ----------------------------------------------------------------------
NEPI_ECOL6      ----------------------------------------------------------------------
NEPI_ECOK1      ----------------------------------------------------------------------
ANTR4_ARATH     ----------------------------------------------------------------------
OCTL_DROME      ----------------------------------------------------------------------
NANT_SALA4      ----------------------------------------------------------------------
YN41_SCHPO      ----------------------------------------------------------------------
SOTB_ERWCH      ----------------------------------------------------------------------
S22A1_RABIT     ----------------------------------------------------------------------
PMRA_LACLA      LGDKYGSHRLILIGLVFTFIILPMAFVQSPLQLGILRFLLGFGTGALTPSVNSLLSKITPKEGVSRIFAY
NORA_STAAW      ----------------------------------------------------------------------
NORA_STAAU      ----------------------------------------------------------------------
NORA_STAAS      ----------------------------------------------------------------------
NORA_STAAN      ----------------------------------------------------------------------
NORA_STAAM      ----------------------------------------------------------------------
NORA_STAAC      ----------------------------------------------------------------------
NEPI_SHIBS      ----------------------------------------------------------------------
ERDL4_ARATH     ----------------------------------------------------------------------
YFMO_BACSU      ----------------------------------------------------------------------
YAJR_ECOLI      ----------------------------------------------------------------------
NORA_STAAR      ----------------------------------------------------------------------
NEPI_ECO57      ----------------------------------------------------------------------
GUDP_PSEPU      ----------------------------------------------------------------------
SOTB_PSE14      ----------------------------------------------------------------------
S17A9_HUMAN     ----------------------------------------------------------------------
BAIG_EUBSP      ----------------------------------------------------------------------
YB30_YEAST      ----------------------------------------------------------------------
MDTD_PECCP      ----------------------------------------------------------------------
ERDL6_ARATH     ----------------------------------------------------------------------
YCLF_BACSU      ----------------------------------------------------------------------
SOTB_ENT38      ----------------------------------------------------------------------
ITR2_SCHPO      ----------------------------------------------------------------------
SVOPL_DANRE     ----------------------------------------------------------------------
SV2A_RAT        ----------------------------------------------------------------------
SV2A_PONAB      ----------------------------------------------------------------------
SV2A_MOUSE      ----------------------------------------------------------------------
SV2A_MACFA      ----------------------------------------------------------------------
SV2A_HUMAN      ----------------------------------------------------------------------
SV2A_BOVIN      ----------------------------------------------------------------------
S22A1_RAT       ----------------------------------------------------------------------
PBUE_BACAM      ----------------------------------------------------------------------
GTR10_XENLA     ----------------------------------------------------------------------
ARAE_ECOLI      ----------------------------------------------------------------------
ARAE_ECO57      ----------------------------------------------------------------------
YYBO_BACSU      ----------------------------------------------------------------------
NART_STAAW      ----------------------------------------------------------------------
NART_STAAT      ----------------------------------------------------------------------
NART_STAAS      ----------------------------------------------------------------------
NART_STAAN      ----------------------------------------------------------------------
NART_STAAM      ----------------------------------------------------------------------
NART_STAAE      ----------------------------------------------------------------------
NART_STAAC      ----------------------------------------------------------------------
NART_STAAB      ----------------------------------------------------------------------
NART_STAA9      ----------------------------------------------------------------------
NART_STAA8      ----------------------------------------------------------------------
NART_STAA3      ----------------------------------------------------------------------
NART_STAA2      ----------------------------------------------------------------------
NART_STAA1      ----------------------------------------------------------------------
YQO5_SCHPO      ----------------------------------------------------------------------
YFIU_BACSU      ----------------------------------------------------------------------
SV2B_RAT        ----------------------------------------------------------------------
SPX3_XENLA      ----------------------------------------------------------------------
SOTB_HAEIN      ----------------------------------------------------------------------
SOTB_HAEIG      ----------------------------------------------------------------------
SETB_ECOLI      ----------------------------------------------------------------------
PCAK_PSEPU      ----------------------------------------------------------------------
NART_STAAR      ----------------------------------------------------------------------
BSU1_SCHPO      ----------------------------------------------------------------------
SETB_SALTY      ----------------------------------------------------------------------
EDL14_ARATH     ----------------------------------------------------------------------
YFKF_BACSU      ----------------------------------------------------------------------
YCT4_SCHPO      ----------------------------------------------------------------------
S22A1_MOUSE     ----------------------------------------------------------------------
ERDL7_ARATH     ----------------------------------------------------------------------
YLD2_CAEEL      ----------------------------------------------------------------------
YHM9_SCHPO      ----------------------------------------------------------------------
YDJE_ECOLI      ----------------------------------------------------------------------
XYLL3_ARATH     ----------------------------------------------------------------------
VBA2_YEAST      ----------------------------------------------------------------------
SPX2_DANRE      ----------------------------------------------------------------------
S22A4_HUMAN     ----------------------------------------------------------------------
NPT3_BOVIN      ----------------------------------------------------------------------
YFIG_BACSU      ----------------------------------------------------------------------
YDFJ_ECOLI      ----------------------------------------------------------------------
YD387_YEAST     ----------------------------------------------------------------------
S22A4_PAPAN     ----------------------------------------------------------------------
PHT47_ORYSJ     ----------------------------------------------------------------------
GTR1_PIG        ----------------------------------------------------------------------
EDL10_ARATH     ----------------------------------------------------------------------
VACHT_DROME     ----------------------------------------------------------------------
TCMA_STRGA      ----------------------------------------------------------------------
S22A6_MOUSE     ----------------------------------------------------------------------
S22A2_HUMAN     ----------------------------------------------------------------------
PT113_ORYSJ     ----------------------------------------------------------------------
YMPB_CAEEL      GRKMIVIWCLVFQTLALIGVTVFLDSYEFKLVIML---VAKVMATIIYSVHPIWATEQFPTSVRSLCFSL
SOTB_HAEI8      ----------------------------------------------------------------------
S22A6_RAT       ----------------------------------------------------------------------
PLT2_ARATH      ----------------------------------------------------------------------
PHT19_ARATH     ----------------------------------------------------------------------
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
ERDL5_ARATH     ----------------------------------------------------------------------
YUXJ_BACSU      ----------------------------------------------------------------------
YDHP_ECOLI      ----------------------------------------------------------------------
YDHP_ECO57      ----------------------------------------------------------------------
Y1104_HAEIN     ----------------------------------------------------------------------
VGLU3_DANRE     ----------------------------------------------------------------------
SV2B_MOUSE      ----------------------------------------------------------------------
SOTB_PSESM      ----------------------------------------------------------------------
SOTB_PSEE4      ----------------------------------------------------------------------
S22A7_MOUSE     ----------------------------------------------------------------------
S17A5_MOUSE     ----------------------------------------------------------------------
PHT12_ORYSJ     ----------------------------------------------------------------------
ARAE_KLEOX      ----------------------------------------------------------------------
SOTB_PSEU2      ----------------------------------------------------------------------
MOT6_HUMAN      ----------------------------------------------------------------------
MDFA_ECOLI      ----------------------------------------------------------------------
MDFA_ECOL6      ----------------------------------------------------------------------
MDFA_ECO57      ----------------------------------------------------------------------
GTR1_HUMAN      ----------------------------------------------------------------------
GTR1_BOVIN      ----------------------------------------------------------------------
EMRY_ECOLI      ----------------------------------------------------------------------
EAT4_CAEEL      ----------------------------------------------------------------------
VGLU1_RAT       ----------------------------------------------------------------------
VGLU1_MOUSE     ----------------------------------------------------------------------
VGLU1_BOVIN     ----------------------------------------------------------------------
VGL2A_DANRE     ----------------------------------------------------------------------
TCR_STAES       ----------------------------------------------------------------------
TCR_STAAU       ----------------------------------------------------------------------
S17A9_MOUSE     ----------------------------------------------------------------------
MSSP2_ARATH     ----------------------------------------------------------------------
ITR1_YEAST      ----------------------------------------------------------------------
ERD6_ARATH      ----------------------------------------------------------------------
Y4XM_RHISN      ----------------------------------------------------------------------
UHPC_SALTY      ----------------------------------------------------------------------
S22A5_HUMAN     ----------------------------------------------------------------------
PHT15_ORYSJ     ----------------------------------------------------------------------
PHT14_ORYSJ     ----------------------------------------------------------------------
PHT14_ORYSI     ----------------------------------------------------------------------
MFS10_HUMAN     ----------------------------------------------------------------------
HXT17_YEAST     ----------------------------------------------------------------------
GTR2_BOVIN      ----------------------------------------------------------------------
GTR1_RAT        ----------------------------------------------------------------------
GTR1_MOUSE      ----------------------------------------------------------------------
ERDL8_ARATH     ----------------------------------------------------------------------
EDL16_ARATH     ----------------------------------------------------------------------
BCRH_RICPR      ----------------------------------------------------------------------
UHPC_ECOLI      ----------------------------------------------------------------------
S22A2_PONAB     ----------------------------------------------------------------------
QUTD_EMENI      ----------------------------------------------------------------------
PROP_SALTY      ----------------------------------------------------------------------
HXT13_YEAST     ----------------------------------------------------------------------
HIAT1_MOUSE     ----------------------------------------------------------------------
EDL11_ARATH     ----------------------------------------------------------------------
YQEH_SCHPO      ----------------------------------------------------------------------
Y532_BUCBP      ----------------------------------------------------------------------
VMAT2_RAT       MGRWL---CALLGMVIVGISILCIPFAKNIYGLIAPNFGVGFAIGMVDSSIMGYLVDLRHVSVYGSVYAI
TCR2_ECOLX      ----------------------------------------------------------------------
S22A1_BOVIN     ----------------------------------------------------------------------
PROP_ECOLI      ----------------------------------------------------------------------
PROP_ECO57      ----------------------------------------------------------------------
MDTM_SALTY      ----------------------------------------------------------------------
MDTM_SALTI      ----------------------------------------------------------------------
ITR2_YEAST      ----------------------------------------------------------------------
GTR7_HUMAN      ----------------------------------------------------------------------
EDL13_ARATH     ----------------------------------------------------------------------
BCR_ECOLI       ----------------------------------------------------------------------
BCRH_RICTY      ----------------------------------------------------------------------
YBFB_BACSU      ----------------------------------------------------------------------
S22A6_RABIT     ----------------------------------------------------------------------
PT111_ORYSJ     ----------------------------------------------------------------------
PHT18_ORYSJ     ----------------------------------------------------------------------
NPT3_HUMAN      ----------------------------------------------------------------------
NART_STAHJ      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
MFS10_MOUSE     ----------------------------------------------------------------------
HXT1_YEAST      ----------------------------------------------------------------------
HIAT1_HUMAN     ----------------------------------------------------------------------
GTR7_RAT        ----------------------------------------------------------------------
GTR2_HUMAN      ----------------------------------------------------------------------
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
YCAD_SALEP      ----------------------------------------------------------------------
YCAD_ESCF3      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------
VGLU1_HUMAN     ----------------------------------------------------------------------
SPX2_BOVIN      ----------------------------------------------------------------------
SOTB_PASMU      ----------------------------------------------------------------------
S22A3_MOUSE     ----------------------------------------------------------------------
RAG1_KLULA      -------VLGIVNFASTFFALYTVDHFGNCLLYGCVGMVACY----------------------------
PT112_ORYSJ     ----------------------------------------------------------------------
ORCT_DROME      ----------------------------------------------------------------------
MDTD_YERE8      ----------------------------------------------------------------------
VGLU2_RAT       ----------------------------------------------------------------------
VGLU2_MOUSE     ----------------------------------------------------------------------
VGLU2_HUMAN     ----------------------------------------------------------------------
VGLU2_BOVIN     ----------------------------------------------------------------------
STP5_ARATH      ----------------------------------------------------------------------
S22AC_MOUSE     ----------------------------------------------------------------------
S22A3_RAT       ----------------------------------------------------------------------
S22A2_RABIT     ----------------------------------------------------------------------
S226B_XENLA     ----------------------------------------------------------------------
LPLT_PHOLL      ----------------------------------------------------------------------
HSRA_ECOLI      ----------------------------------------------------------------------
EDL15_ARATH     ----------------------------------------------------------------------
YCAD_SALG2      ----------------------------------------------------------------------
YCAD_SALDC      ----------------------------------------------------------------------
XYLL1_ARATH     ----------------------------------------------------------------------
UHPT_CHLPN      ----------------------------------------------------------------------
SPX2_MOUSE      ----------------------------------------------------------------------
SPX2_HUMAN      ----------------------------------------------------------------------
S22A7_PIG       ----------------------------------------------------------------------
MMR_STRCO       ----------------------------------------------------------------------
LMRB_BACSU      ----------------------------------------------------------------------
HXT9_YEAST      ----------------------------------------------------------------------
HXT11_YEAST     ----------------------------------------------------------------------
GTR1_RABIT      ----------------------------------------------------------------------
YMFD_BACSU      ----------------------------------------------------------------------
YJ94_YEAST      ----------------------------------------------------------------------
YHD3_SCHPO      ----------------------------------------------------------------------
YDER_BACSU      ----------------------------------------------------------------------
YCAD_SALPB      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
TCR8_PASMU      ----------------------------------------------------------------------
S22A7_BOVIN     ----------------------------------------------------------------------
S22A2_PIG       ----------------------------------------------------------------------
PHT16_ORYSJ     ----------------------------------------------------------------------
PHT11_ORYSJ     ----------------------------------------------------------------------
MDTD_SERP5      ----------------------------------------------------------------------
HXT3_YEAST      ----------------------------------------------------------------------
YCAD_SALTY      ----------------------------------------------------------------------
YCAD_SALTI      ----------------------------------------------------------------------
YCAD_SALSV      ----------------------------------------------------------------------
YCAD_SALPK      ----------------------------------------------------------------------
YCAD_SALPC      ----------------------------------------------------------------------
YCAD_SALPA      ----------------------------------------------------------------------
YCAD_SALNS      ----------------------------------------------------------------------
YCAD_SALHS      ----------------------------------------------------------------------
YCAD_SALCH      ----------------------------------------------------------------------
YCAD_SALA4      ----------------------------------------------------------------------
Y2171_CITK8     ----------------------------------------------------------------------
VGL2B_DANRE     ----------------------------------------------------------------------
TUB3_AGRVI      ----------------------------------------------------------------------
S22FL_XENLA     ----------------------------------------------------------------------
PCFT_XENLA      ----------------------------------------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
GLPT_HUMAN      ----------------------------------------------------------------------
YCAD_SALAR      ----------------------------------------------------------------------
YBN1_SCHPO      ----------------------------------------------------------------------
YB91_YEAST      ----------------------------------------------------------------------
TUB4_AGRVI      ----------------------------------------------------------------------
SPX2_XENLA      ----------------------------------------------------------------------
S22A6_MACFA     ----------------------------------------------------------------------
PHT13_ORYSJ     ----------------------------------------------------------------------
PBUE_BACSU      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
HXT16_YEAST     ----------------------------------------------------------------------
HXT15_YEAST     ----------------------------------------------------------------------
GTR7_MOUSE      ----------------------------------------------------------------------
GTR2_MOUSE      ----------------------------------------------------------------------
GTR2_CHICK      ----------------------------------------------------------------------
YI32_SCHPO      ----------------------------------------------------------------------
SOTB_PSEA7      ----------------------------------------------------------------------
SETA_ECOLI      -RYGKRRMMVIAVAAGVLFYTGLIFFNSRMALMTLQLFNAVFIGIVAG--IGMLWFQDLMPGRAGAATTL
S22AL_MOUSE     ----------------------------------------------------------------------
S22A6_PONAB     ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
GTR2_RAT        ----------------------------------------------------------------------
Y1317_METJA     ----------------------------------------------------------------------
SPX3_CHICK      ----------------------------------------------------------------------
S22AA_HUMAN     ----------------------------------------------------------------------
QAY_NEUCR       ----------------------------------------------------------------------
GTR1_CHICK      ----------------------------------------------------------------------
CF192_HUMAN     ----------------------------------------------------------------------
VMAT2_HUMAN     MGRWL---CALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSIMGYLVDLRHVSVYGSVYAI
VGLU1_XENLA     ----------------------------------------------------------------------
SPX2_XENTR      ----------------------------------------------------------------------
SOTB_PSEAE      ----------------------------------------------------------------------
SOTB_PSEAB      ----------------------------------------------------------------------
SOTB_PSEA8      ----------------------------------------------------------------------
SOTB_ERWCT      ----------------------------------------------------------------------
S22AC_RAT       ----------------------------------------------------------------------
S22A6_HUMAN     ----------------------------------------------------------------------
S226A_XENLA     ----------------------------------------------------------------------
PROP_STAAW      ----------------------------------------------------------------------
PROP_STAAS      ----------------------------------------------------------------------
PROP_STAAR      ----------------------------------------------------------------------
PROP_STAAN      ----------------------------------------------------------------------
PROP_STAAM      ----------------------------------------------------------------------
PROP_STAAC      ----------------------------------------------------------------------
PROP_STAA1      ----------------------------------------------------------------------
PLST3_ARATH     ----------------------------------------------------------------------
OXLT_OXAFO      ----------------------------------------------------------------------
NEPI_SALPK      ----------------------------------------------------------------------
NEPI_SALPA      ----------------------------------------------------------------------
MFSD9_MOUSE     ----------------------------------------------------------------------
ERDL2_ARATH     ----------------------------------------------------------------------
YHD1_SCHPO      ----------------------------------------------------------------------
SPX3_HUMAN      ----------------------------------------------------------------------
S22A6_PIG       ----------------------------------------------------------------------
QAY_NEUTR       ----------------------------------------------------------------------
PHT17_ARATH     ----------------------------------------------------------------------
GTR11_HUMAN     ----------------------------------------------------------------------
GIT1_YEAST      ----------------------------------------------------------------------
ANTR5_ARATH     ----------------------------------------------------------------------
YBJJ_ECOLI      ----------------------------------------------------------------------
VMAT2_BOVIN     GRWLCALLGMIIVGMSILCIPLAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGY-LVDLRHVSVYGSVYAI
TPPB_ECOLI      ----------------------------------------------------------------------
TPPB_ECOL6      ----------------------------------------------------------------------
TPPB_ECO57      ----------------------------------------------------------------------
PROP_STAHJ      ----------------------------------------------------------------------
PHT15_ARATH     ----------------------------------------------------------------------
YCAD_SHIFL      ----------------------------------------------------------------------
YCAD_SHIF8      ----------------------------------------------------------------------
PROP_STAEQ      ----------------------------------------------------------------------
NEPI_SALTY      ----------------------------------------------------------------------
NEPI_SALTI      ----------------------------------------------------------------------
NEPI_SALPC      ----------------------------------------------------------------------
NEPI_SALPB      ----------------------------------------------------------------------
NEPI_SALCH      ----------------------------------------------------------------------
MDTG_CITK8      ----------------------------------------------------------------------
HXT7_YEAST      ----------------------------------------------------------------------
HXT6_YEAST      ----------------------------------------------------------------------
HXT4_YEAST      ----------------------------------------------------------------------
EDL17_ARATH     ----------------------------------------------------------------------
YM8M_YEAST      ----------------------------------------------------------------------
YDJK_ECOLI      ----------------------------------------------------------------------
S22AO_PONAB     ----------------------------------------------------------------------
PHT11_ARATH     ----------------------------------------------------------------------
OCT1_CAEEL      ----------------------------------------------------------------------
NPT1_HUMAN      ----------------------------------------------------------------------
NEPI_SALG2      ----------------------------------------------------------------------
NEPI_SALEP      ----------------------------------------------------------------------
GTR3_MOUSE      ----------------------------------------------------------------------
ANTR6_ARATH     ----------------------------------------------------------------------
YCAD_ECOUT      ----------------------------------------------------------------------
YCAD_ECOL6      ----------------------------------------------------------------------
YCAD_ECOL5      ----------------------------------------------------------------------
YCAD_ECOK1      ----------------------------------------------------------------------
YCAD_ECO81      ----------------------------------------------------------------------
YCAD_ECO45      ----------------------------------------------------------------------
Y411_BUCBP      ----------------------------------------------------------------------
STP12_ARATH     ----------------------------------------------------------------------
SPX3_MOUSE      ----------------------------------------------------------------------
QAY_NEUAF       ----------------------------------------------------------------------
PHT13_ARATH     ----------------------------------------------------------------------
PHT12_ARATH     ----------------------------------------------------------------------
GTR14_HUMAN     ----------------------------------------------------------------------
BCRH_RICBR      ----------------------------------------------------------------------
YKH4_CAEEL      ----------------------------------------------------------------------
YJDL_ECOLI      ----------------------------------------------------------------------
YHA8_SCHPO      ----------------------------------------------------------------------
YFNC_BACSU      ----------------------------------------------------------------------
YCAD_SHISS      ----------------------------------------------------------------------
YCAD_SHIDS      ----------------------------------------------------------------------
YCAD_ECOSM      ----------------------------------------------------------------------
YCAD_ECOSE      ----------------------------------------------------------------------
YCAD_ECOLU      ----------------------------------------------------------------------
YCAD_ECOLI      ----------------------------------------------------------------------
YCAD_ECOLC      ----------------------------------------------------------------------
YCAD_ECOHS      ----------------------------------------------------------------------
YCAD_ECODH      ----------------------------------------------------------------------
YCAD_ECOBW      ----------------------------------------------------------------------
YCAD_ECO8A      ----------------------------------------------------------------------
YCAD_ECO7I      ----------------------------------------------------------------------
YCAD_ECO5E      ----------------------------------------------------------------------
YCAD_ECO57      ----------------------------------------------------------------------
YCAD_ECO55      ----------------------------------------------------------------------
YCAD_ECO27      ----------------------------------------------------------------------
YCAD_ECO24      ----------------------------------------------------------------------
VGLU3_HUMAN     ----------------------------------------------------------------------
SPX3_BOVIN      ----------------------------------------------------------------------
S22A5_MOUSE     ----------------------------------------------------------------------
MFS10_BOVIN     ----------------------------------------------------------------------
FTSK_CHLTE      TLPWYELFSSAAKAVGLFGARVSVFFIRVLLVMPLFGFLVLFRAKPLGPGLFFLVYTLLMALDLSAMFSM
ENB1_YEAST      ----------------------------------------------------------------------
EMRD_ECOLI      ----------------------------------------------------------------------
CMLR_STRLI      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FNLTDSLGTGFGKFAGGVMSVALGSLGAALKVSAYFWLICAVLLFVLVFYFAKDVERLQxxxxxxxxxxx
SPNS1_XENTR     IVVSHLLGDAGSPYLIGVISIQMRSLEYALMICAFVGVIGGGFFLATALFIEKDRKRAE-----------
EXUT_BACSU      ----------------------------------------------------------------------
SPNS1_XENLA     ----------------------------------------------------------------------
YIM0_YEAST      ----------------------------------------------------------------------
SPIN_DROME      ----------------------------------------------------------------------
YOU1_CAEEL      ----------------------------------------------------------------------
SPNS3_DANRE     ----------------------------------------------------------------------
PCAK_ACIAD      ----------------------------------------------------------------------
MDTL_SALTY      ----------------------------------------------------------------------
MDTL_SALPB      ----------------------------------------------------------------------
MDTL_SALNS      ----------------------------------------------------------------------
MDTL_SALHS      ----------------------------------------------------------------------
MDTL_SALA4      ----------------------------------------------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
MDTL_SALEP      ----------------------------------------------------------------------
MDTL_SALDC      ----------------------------------------------------------------------
MDTL_SALAR      ----------------------------------------------------------------------
YITG_BACSU      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
MDTL_SALSV      ----------------------------------------------------------------------
MDTL_SALPK      ----------------------------------------------------------------------
MDTL_SALPA      ----------------------------------------------------------------------
MDTL_SALPC      ----------------------------------------------------------------------
MDTL_SALCH      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
SPNS1_DANRE     ----------------------------------------------------------------------
BMR3_BACSU      ----------------------------------------------------------------------
SVOP_PONAB      ----------------------------------------------------------------------
SVOP_HUMAN      ----------------------------------------------------------------------
SVOP_BOVIN      ----------------------------------------------------------------------
MDTL_KLEP3      ----------------------------------------------------------------------
MDTL_KLEP7      ----------------------------------------------------------------------
ANTR3_ARATH     SNCAGTLAAIVSTIGTGYFVQWLGSFQAFLTVTAFFWLLFA-----------------------------
NANT_YERPY      ----------------------------------------------------------------------
MDTL_VIBPA      ----------------------------------------------------------------------
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
GUDP_BACSU      ----------------------------------------------------------------------
SPNS3_MOUSE     ----------------------------------------------------------------------
SPNS3_HUMAN     ----------------------------------------------------------------------
MDTL_ECOSE      ----------------------------------------------------------------------
MDTL_ECOLI      ----------------------------------------------------------------------
MDTL_ECODH      ----------------------------------------------------------------------
MDTL_ECOBW      ----------------------------------------------------------------------
MDTL_ECO55      ----------------------------------------------------------------------
SV2C_HUMAN      ----------------------------------------------------------------------
MDTL_ESCF3      ----------------------------------------------------------------------
MDTL_SHISS      ----------------------------------------------------------------------
MDTL_SHIFL      ----------------------------------------------------------------------
MDTL_SHIDS      ----------------------------------------------------------------------
MDTL_SHIBS      ----------------------------------------------------------------------
MDTL_SHIB3      ----------------------------------------------------------------------
MDTL_ECOUT      ----------------------------------------------------------------------
MDTL_ECOLC      ----------------------------------------------------------------------
MDTL_ECOK1      ----------------------------------------------------------------------
MDTL_ECOHS      ----------------------------------------------------------------------
MDTL_ECO5E      ----------------------------------------------------------------------
MDTL_ECO57      ----------------------------------------------------------------------
MDTL_ECO45      ----------------------------------------------------------------------
VACHT_DANRE     ----------------------------------------------------------------------
TCRB_BACSU      ----------------------------------------------------------------------
SPNS2_XENTR     ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
MDTL_ECOL5      ----------------------------------------------------------------------
MDTL_ECO27      ----------------------------------------------------------------------
ANTR2_ARATH     ----------------------------------------------------------------------
PHT43_ORYSJ     ----------------------------------------------------------------------
MDTL_ECO7I      ----------------------------------------------------------------------
YIM1_YEAST      ----------------------------------------------------------------------
SVOP_XENLA      ----------------------------------------------------------------------
SOTB_SHISS      ----------------------------------------------------------------------
SOTB_SHIFL      ----------------------------------------------------------------------
SOTB_SHIF8      ----------------------------------------------------------------------
SOTB_SHIBS      ----------------------------------------------------------------------
SOTB_SHIB3      ----------------------------------------------------------------------
SOTB_ECOSM      ----------------------------------------------------------------------
SOTB_ECOSE      ----------------------------------------------------------------------
SOTB_ECOLU      ----------------------------------------------------------------------
SOTB_ECOLI      ----------------------------------------------------------------------
SOTB_ECOLC      ----------------------------------------------------------------------
SOTB_ECOHS      ----------------------------------------------------------------------
SOTB_ECODH      ----------------------------------------------------------------------
SOTB_ECOBW      ----------------------------------------------------------------------
SOTB_ECO8A      ----------------------------------------------------------------------
SOTB_ECO7I      ----------------------------------------------------------------------
SOTB_ECO5E      ----------------------------------------------------------------------
SOTB_ECO57      ----------------------------------------------------------------------
SOTB_ECO55      ----------------------------------------------------------------------
SOTB_ECO24      ----------------------------------------------------------------------
MDTL_ECOSM      ----------------------------------------------------------------------
MDTL_ECOLU      ----------------------------------------------------------------------
TPO3_YEAST      ----------------------------------------------------------------------
MDTL_ECOL6      ----------------------------------------------------------------------
MDTL_ECO8A      ----------------------------------------------------------------------
MDTL_ECO81      ----------------------------------------------------------------------
MDTL_ECO24      ----------------------------------------------------------------------
GARP_ECOLI      ----------------------------------------------------------------------
GARP_ECO57      ----------------------------------------------------------------------
SV2C_RAT        ----------------------------------------------------------------------
SV2B_HUMAN      ----------------------------------------------------------------------
MDTL_CITK8      ----------------------------------------------------------------------
VBA5_YEAST      ----------------------------------------------------------------------
SV2C_MOUSE      ----------------------------------------------------------------------
PHT41_ORYSJ     ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
NANT_SALTY      ----------------------------------------------------------------------
NANT_SALTI      ----------------------------------------------------------------------
NANT_SALSV      ----------------------------------------------------------------------
NANT_SALPK      ----------------------------------------------------------------------
NANT_SALPC      ----------------------------------------------------------------------
NANT_SALPB      ----------------------------------------------------------------------
NANT_SALPA      ----------------------------------------------------------------------
NANT_SALNS      ----------------------------------------------------------------------
NANT_SALHS      ----------------------------------------------------------------------
NANT_SALG2      ----------------------------------------------------------------------
NANT_SALEP      ----------------------------------------------------------------------
NANT_SALDC      ----------------------------------------------------------------------
NANT_SALCH      ----------------------------------------------------------------------
NANT_SALAR      ----------------------------------------------------------------------
ANTR1_ARATH     ----------------------------------------------------------------------
VACHT_RAT       ----------------------------------------------------------------------
TPO2_YEAST      ----------------------------------------------------------------------
SPNS1_HUMAN     ----------------------------------------------------------------------
MDTM_ECO57      ----------------------------------------------------------------------
MDTL_SHIF8      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
SPNS1_RAT       ----------------------------------------------------------------------
SPNS1_MOUSE     ----------------------------------------------------------------------
SOTB_ECOUT      ----------------------------------------------------------------------
SOTB_ECOL6      ----------------------------------------------------------------------
SOTB_ECOL5      ----------------------------------------------------------------------
SOTB_ECOK1      ----------------------------------------------------------------------
SOTB_ECO81      ----------------------------------------------------------------------
SOTB_ECO45      ----------------------------------------------------------------------
SOTB_ECO27      ----------------------------------------------------------------------
YWOD_BACSU      ----------------------------------------------------------------------
SOTB_SALTY      ----------------------------------------------------------------------
SOTB_SALNS      ----------------------------------------------------------------------
VACHT_HUMAN     ----------------------------------------------------------------------
NANT_CITK8      ----------------------------------------------------------------------
MDTM_ECOLI      ----------------------------------------------------------------------
VACHT_MOUSE     ---------------------