[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tmar0:AAD36465.1

[Show Plain Result]


## Summary of Sequence Search
    1::290
    1::290     e-159 100%  290 aa  HSLO_THEMA RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    1::290     e-154  96%  290 aa  HSLO_THEP1 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    1::290     e-154  96%  290 aa  HSLO_THESQ RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    1::271     5e-65  44%  287 aa  HSLO_THEM4 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   24::279     8e-58  45%  292 aa  HSLO_CLOCE RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   10::278     8e-57  41%  291 aa  HSLO_BACA2 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   10::278     2e-55  41%  291 aa  HSLO_BACSU RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     6e-55  41%  295 aa  HSLO_GEOSW RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    9::280     8e-55  43%  295 aa  HSLO_BACSK RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     2e-54  42%  291 aa  HSLO_BACCN RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    5::281     7e-54  42%  293 aa  HSLO_CLOB8 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     6e-53  41%  296 aa  HSLO_BACST RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   10::278     3e-52  40%  289 aa  HSLO_BACLD RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::282     8e-52  44%  319 aa  HSLO_CLOPE RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::282     8e-52  44%  319 aa  HSLO_CLOP1 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   60::281     1e-51  47%  295 aa  HSLO_CLOBB RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    8::279     1e-51  42%  298 aa  HSLO_SYNP2 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::282     1e-51  44%  316 aa  HSLO_CLOPS RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   60::281     1e-51  47%  295 aa  HSLO_CLOBA RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     3e-51  40%  294 aa  HSLO_STAHJ RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   34::302     7e-51  43%  325 aa  HSLO_AQUAE RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     1e-50  42%  296 aa  HSLO_CLOBL RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     1e-50  42%  296 aa  HSLO_CLOBK RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     2e-50  42%  296 aa  HSLO_CLOBH RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     2e-50  42%  296 aa  HSLO_CLOB1 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::280     3e-50  40%  289 aa  HSLO_OCEIH RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    9::280     3e-50  41%  294 aa  HSLO_CLOTE RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     3e-50  41%  296 aa  HSLO_CLOB6 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    5::279     6e-50  39%  294 aa  HSLO_THEPX RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    5::279     6e-50  39%  294 aa  HSLO_THEP3 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::293     1e-49  38%  296 aa  HSLO_LACAC RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   16::281     2e-49  41%  295 aa  HSLO_LACBA RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     3e-49  41%  296 aa  HSLO_CLOBJ RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   20::282     4e-49  42%  293 aa  HSLO_LACF3 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    9::279     4e-49  40%  299 aa  HSLO_ACAM1 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     5e-49  38%  292 aa  HSLO_LACSS RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    5::280     5e-49  39%  288 aa  HSLO_EUBR3 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     5e-49  38%  291 aa  HSLO_BACHK RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     5e-49  38%  291 aa  HSLO_BACCZ RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     5e-49  38%  291 aa  HSLO_BACCQ RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     5e-49  38%  291 aa  HSLO_BACC7 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     5e-49  38%  291 aa  HSLO_BACC3 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     5e-49  38%  291 aa  HSLO_BACC1 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     5e-49  38%  291 aa  HSLO_BACC0 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     5e-49  38%  291 aa  HSLO_BACAN RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     5e-49  38%  291 aa  HSLO_BACAH RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     5e-49  38%  291 aa  HSLO_BACAC RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     5e-49  38%  291 aa  HSLO_BACAA RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     6e-49  41%  296 aa  HSLO_CLOBM RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   10::278     6e-49  37%  291 aa  HSLO_BACP2 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     8e-49  38%  291 aa  HSLO_BACCR RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     8e-49  38%  291 aa  HSLO_BACC4 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::280     1e-48  39%  298 aa  HSLO_ENTFA RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     1e-48  39%  291 aa  HSLO_BACC2 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     3e-48  38%  291 aa  HSLO_BACWK RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::279     5e-48  39%  296 aa  HSLO_LACH4 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   25::280     5e-48  41%  296 aa  HSLO_CLOTH RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::282     5e-48  41%  297 aa  HSLO_CLOAB RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::282     7e-48  39%  294 aa  HSLO_LACC3 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   25::280     9e-48  41%  311 aa  HSLO_TRIEI RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     9e-48  38%  294 aa  HSLO_STACT RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::282     1e-47  39%  294 aa  HSLO_LACCB RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::279     1e-47  40%  294 aa  HSLO_GEOKA RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::282     2e-47  38%  294 aa  HSLO_LISIN RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::282     2e-47  38%  294 aa  HSLO_LISMO RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::282     2e-47  38%  294 aa  HSLO_LISMH RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::282     2e-47  38%  294 aa  HSLO_LISMF RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::282     3e-47  38%  294 aa  HSLO_LISMC RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   25::279     6e-47  41%  294 aa  HSLO_DESPS RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    6::281     1e-46  36%  293 aa  HSLO_STAES RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    6::281     1e-46  36%  293 aa  HSLO_STAEQ RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    5::278     2e-46  39%  294 aa  HSLO_THETN RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    9::279     4e-46  40%  301 aa  HSLO_ANASP RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   23::273     9e-46  40%  287 aa  HSLO_THEYD RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   25::280     1e-45  41%  300 aa  HSLO_CYAP4 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::280     1e-45  38%  291 aa  HSLO_CLOD6 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     2e-45  37%  290 aa  HSLO_STRSV RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   24::280     3e-45  39%  299 aa  HSLO_THEEB RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     4e-45  37%  290 aa  HSLO_STRGC RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::279     6e-45  36%  291 aa  HSLO_LACJO RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::278     1e-44  37%  294 aa  HSLO_DESRM RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    5::280     1e-44  37%  292 aa  HSLO_CLOPH RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   23::278     2e-44  38%  288 aa  HSLO_STRTD RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     3e-44  36%  293 aa  HSLO_STAAW RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     3e-44  36%  293 aa  HSLO_STAAT RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     3e-44  36%  293 aa  HSLO_STAAS RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     3e-44  36%  293 aa  HSLO_STAAR RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     3e-44  36%  293 aa  HSLO_STAAE RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     3e-44  36%  293 aa  HSLO_STAAC RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     3e-44  36%  293 aa  HSLO_STAAB RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     3e-44  36%  293 aa  HSLO_STAA8 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     3e-44  36%  293 aa  HSLO_STAA3 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   25::280     3e-44  39%  295 aa  HSLO_LACPL RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   23::278     5e-44  38%  288 aa  HSLO_STRT1 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     5e-44  36%  293 aa  HSLO_STAAN RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     5e-44  36%  293 aa  HSLO_STAAM RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     5e-44  36%  293 aa  HSLO_STAA9 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     5e-44  36%  293 aa  HSLO_STAA2 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     5e-44  36%  293 aa  HSLO_STAA1 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   65::279     5e-44  44%  293 aa  HSLO_LACDA RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     5e-44  36%  294 aa  HSLO_CLONN RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   23::278     6e-44  38%  288 aa  HSLO_STRT2 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   65::279     6e-44  44%  293 aa  HSLO_LACDB RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   25::279     1e-43  39%  288 aa  HSLO_LACLA RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    9::280     1e-43  40%  302 aa  HSLO_SYNY3 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::281     2e-43  37%  293 aa  HSLO_STAS1 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::280     2e-43  38%  291 aa  HSLO_BACHD RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   25::279     2e-43  39%  288 aa  HSLO_LACLM RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   33::286     2e-43  40%  301 aa  HSLO_GEOMG RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   25::279     3e-43  39%  288 aa  HSLO_LACLS RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::290     5e-43  39%  300 aa  HSLO_PROM2 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    9::280     5e-43  39%  299 aa  HSLO_CYAP7 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    5::281     7e-43  37%  292 aa  HSLO_ALKMQ RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    9::280     9e-43  40%  301 aa  HSLO_CYAP8 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    9::276     1e-42  38%  290 aa  HSLO_BREBN RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    5::281     2e-42  35%  292 aa  HSLO_FINM2 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::282     4e-42  36%  294 aa  HSLO_LISW6 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::290     6e-42  38%  302 aa  HSLO_PROMS RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     8e-42  35%  290 aa  HSLO_STRPS RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     1e-41  35%  290 aa  HSLO_STRZT RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     1e-41  35%  290 aa  HSLO_STRZP RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     1e-41  35%  290 aa  HSLO_STRZJ RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     1e-41  35%  290 aa  HSLO_STRR6 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     1e-41  35%  290 aa  HSLO_STRPN RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     1e-41  35%  290 aa  HSLO_STRPJ RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     1e-41  35%  290 aa  HSLO_STRPI RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     1e-41  35%  290 aa  HSLO_STRP7 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     1e-41  35%  290 aa  HSLO_STRP4 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     1e-41  35%  290 aa  HSLO_STRP2 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   32::278     1e-41  40%  295 aa  HSLO_GEOBB RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     1e-41  35%  290 aa  HSLO_STRMU RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     2e-41  36%  290 aa  HSLO_STREM RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::290     2e-41  38%  302 aa  HSLO_PROM0 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     4e-41  39%  295 aa  HSLO_GEOSM RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::290     6e-41  38%  300 aa  HSLO_PROM9 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     1e-40  36%  290 aa  HSLO_STRE4 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     2e-40  35%  290 aa  HSLO_STRP9 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::290     2e-40  36%  300 aa  HSLO_PROM5 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   33::305     3e-40  38%  320 aa  HSLO_SYNJA RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::290     4e-40  37%  300 aa  HSLO_PROMP RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     5e-40  34%  290 aa  HSLO_STRS7 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     5e-40  35%  290 aa  HSLO_STRPC RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     5e-40  35%  290 aa  HSLO_STRPB RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     7e-40  34%  291 aa  HSLO_STRA1 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::288     9e-40  39%  305 aa  HSLO_SYNS9 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     9e-40  35%  290 aa  HSLO_STRPZ RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   23::288     1e-39  40%  341 aa  HSLO_THET2 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     2e-39  35%  290 aa  HSLO_STRPM RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     2e-39  35%  290 aa  HSLO_STRPG RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     2e-39  35%  290 aa  HSLO_STRPF RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     2e-39  35%  290 aa  HSLO_STRP8 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     2e-39  35%  290 aa  HSLO_STRP1 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::274     2e-39  39%  286 aa  HSLO_CARHZ RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     2e-39  35%  290 aa  HSLO_STRPD RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     3e-39  34%  290 aa  HSLO_STRU0 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   33::287     3e-39  38%  301 aa  HSLO_GEOSL RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::279     3e-39  36%  290 aa  HSLO_ACHLI RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     4e-39  34%  291 aa  HSLO_STRA5 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     4e-39  34%  291 aa  HSLO_STRA3 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   24::279     5e-39  35%  297 aa  HSLO_SYNP6 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   24::279     5e-39  35%  297 aa  HSLO_SYNE7 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     5e-39  34%  290 aa  HSLO_STRP3 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::287     6e-39  38%  305 aa  HSLO_SYNSC RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::278     6e-39  35%  290 aa  HSLO_STRP6 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   32::304     8e-39  37%  319 aa  HSLO_SYNJB RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     1e-38  34%  288 aa  HSLO_STRSY RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::277     1e-38  34%  288 aa  HSLO_STRS2 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    8::280     4e-38  34%  299 aa  HSLO_ALKOO RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   61::278     5e-38  44%  304 aa  HSLO_PELPD RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   12::279     7e-38  37%  288 aa  HSLO_PELCD RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   36::272     2e-37  40%  284 aa  HSLO_GEOLS RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    9::279     3e-37  35%  301 aa  HSLO_ANAVT RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   29::288     4e-37  39%  341 aa  HSLO_THET8 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::288     4e-37  35%  299 aa  HSLO_PROM1 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::282     6e-37  35%  306 aa  HSLO_GLOVI RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::288     1e-36  35%  299 aa  HSLO_PROMT RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    4::274     6e-36  35%  293 aa  HSLO_DEIRA RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   33::287     2e-34  39%  301 aa  HSLO_SYNS3 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::287     2e-33  38%  302 aa  HSLO_SYNPW RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   62::280     3e-32  36%  295 aa  HSLO_SYMTH RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   26::287     3e-31  34%  300 aa  HSLO_PROM4 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   32::287     1e-30  35%  302 aa  HSLO_SYNR3 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   25::279     1e-30  32%  301 aa  HSLO_NOSP7 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   24::287     3e-27  33%  301 aa  HSLO_PROMA RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::290     1e-26  32%  305 aa  HSLO_SYNPX RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    9::285     3e-24  32%  304 aa  HSLO_MICAN RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   42::276     9e-19  31%  290 aa  HSLO_TERTT RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::276     3e-18  29%  297 aa  HSLO_HAEDU RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   19::272     2e-17  29%  294 aa  HSLO_CHRVO RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    5::267     2e-16  26%  286 aa  HSLO_SHESW RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    5::267     2e-16  26%  286 aa  HSLO_SHEPC RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   13::272     2e-16  26%  289 aa  HSLO_PECCP RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   17::276     2e-16  26%  286 aa  HSLO_HAES2 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::281     2e-16  26%  293 aa  HSLO_HAEIN RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::281     2e-16  26%  293 aa  HSLO_HAEIG RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::281     2e-16  26%  293 aa  HSLO_HAEI8 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   13::272     2e-16  25%  289 aa  HSLO_ERWCT RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   17::276     4e-16  26%  286 aa  HSLO_HAES1 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   15::281     5e-16  26%  293 aa  HSLO_HAEIE RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::276     9e-16  27%  296 aa  HSLO_ACTP7 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   10::267     2e-15  26%  286 aa  HSLO_SHELP RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     2e-15  29%  292 aa  HSLO_SALTI RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   65::267     2e-15  30%  286 aa  HSLO_SHESA RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::276     3e-15  27%  296 aa  HSLO_ACTPJ RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    5::267     4e-15  27%  288 aa  HSLO_SHEDO RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     4e-15  28%  292 aa  HSLO_SALPK RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     4e-15  28%  292 aa  HSLO_SALPA RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     4e-15  27%  290 aa  HSLO_PHOLL RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::276     4e-15  27%  296 aa  HSLO_ACTP2 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   10::267     5e-15  28%  286 aa  HSLO_SHEB9 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   10::267     5e-15  28%  286 aa  HSLO_SHEB8 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   10::267     5e-15  28%  286 aa  HSLO_SHEB5 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   10::267     5e-15  28%  286 aa  HSLO_SHEB2 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     6e-15  28%  292 aa  HSLO_SALTY RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     6e-15  28%  292 aa  HSLO_SALCH RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   65::271     8e-15  29%  291 aa  HSLO_ALISL RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   65::267     1e-14  31%  286 aa  HSLO_SHESR RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   65::267     1e-14  31%  286 aa  HSLO_SHESM RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     1e-14  29%  292 aa  HSLO_ENT38 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-14  30%  294 aa  HSLO_AERS4 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   65::267     9e-14  30%  286 aa  HSLO_SHEON RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     9e-14  27%  292 aa  HSLO_ESCF3 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   65::271     1e-13  30%  292 aa  HSLO_PHOPR RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    9::272     1e-13  27%  291 aa  HSLO_CHRSD RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::272     2e-13  25%  292 aa  HSLO_SERP5 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-13  26%  292 aa  HSLO_SHISS RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-13  26%  289 aa  HSLO_SHIFL RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-13  26%  289 aa  HSLO_SHIF8 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-13  26%  292 aa  HSLO_SHIDS RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   65::267     3e-13  28%  286 aa  HSLO_SHEWM RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::278     3e-13  26%  300 aa  HSLO_PSEF5 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-13  26%  292 aa  HSLO_ECOSM RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-13  26%  292 aa  HSLO_ECOLU RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-13  26%  292 aa  HSLO_ECOLI RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-13  26%  292 aa  HSLO_ECOL6 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-13  26%  292 aa  HSLO_ECODH RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-13  26%  292 aa  HSLO_ECOBW RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-13  26%  292 aa  HSLO_ECO8A RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-13  26%  292 aa  HSLO_ECO81 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-13  26%  292 aa  HSLO_ECO57 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-13  26%  292 aa  HSLO_ECO55 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-13  26%  292 aa  HSLO_ECO45 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-13  26%  292 aa  HSLO_ECO27 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   25::295     3e-13  28%  302 aa  HSLO_CAUCR RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   25::295     3e-13  28%  302 aa  HSLO_CAUCN RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   65::271     3e-13  28%  291 aa  HSLO_VIBFM RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   65::271     3e-13  28%  291 aa  HSLO_VIBF1 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     3e-13  26%  292 aa  HSLO_ECO7I RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   11::277     3e-13  26%  288 aa  HSLO_ACTSZ RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    7::267     4e-13  26%  286 aa  HSLO_SHEPW RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::272     4e-13  25%  292 aa  HSLO_ENTS8 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::273     6e-13  26%  292 aa  HSLO_SHIBS RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   17::278     6e-13  25%  300 aa  HSLO_PSEPF RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::275     7e-13  27%  297 aa  HSLO_PSEA7 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   16::276     7e-13  24%  297 aa  HSLO_PSEA6 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   16::267     2e-12  25%  286 aa  HSLO_SHESH RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   67::267     2e-12  28%  289 aa  HSLO_NITOC RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   65::271     4e-12  28%  291 aa  HSLO_VIBPA RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::272     5e-12  25%  292 aa  HSLO_SODGM RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   72::276     8e-12  29%  302 aa  HSLO_NEIG2 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   72::276     8e-12  29%  302 aa  HSLO_NEIG1 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::278     1e-11  26%  294 aa  HSLO_PROMH RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::273     1e-11  27%  293 aa  HSLO_YERPS RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::273     1e-11  27%  293 aa  HSLO_YERPP RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::273     1e-11  27%  293 aa  HSLO_YERPN RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::273     1e-11  27%  293 aa  HSLO_YERPG RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::273     1e-11  27%  293 aa  HSLO_YERPE RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::273     1e-11  27%  293 aa  HSLO_YERPB RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::273     1e-11  27%  293 aa  HSLO_YERPA RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::273     1e-11  27%  293 aa  HSLO_YERP3 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   10::271     1e-11  25%  281 aa  HSLO_PSEHT RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
    5::267     2e-11  23%  286 aa  HSLO_SHEFN RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::275     2e-11  24%  297 aa  HSLO_PSEAB RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   65::271     3e-11  26%  291 aa  HSLO_VIBVY RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   65::271     3e-11  26%  291 aa  HSLO_VIBVU RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   17::278     3e-11  22%  300 aa  HSLO_PSEFS RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::275     3e-11  24%  297 aa  HSLO_PSEAE RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::275     3e-11  24%  297 aa  HSLO_PSEA8 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   17::277     4e-11  23%  299 aa  HSLO_PSEPW RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::273     7e-11  27%  293 aa  HSLO_YERPY RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   65::271     7e-11  26%  291 aa  HSLO_VIBHB RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   65::271     9e-11  27%  291 aa  HSLO_VIBCH RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   17::277     1e-10  22%  288 aa  HSLO_PASMU RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::276     1e-10  24%  290 aa  HSLO_COLP3 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   70::271     2e-10  28%  293 aa  HSLO_METFK RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   67::275     3e-10  28%  297 aa  HSLO_AZOVD RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::272     4e-10  23%  292 aa  HSLO_ERWT9 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   70::278     8e-10  27%  300 aa  HSLO_PSE14 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   70::278     1e-09  27%  300 aa  HSLO_PSEU2 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   70::278     2e-09  28%  300 aa  HSLO_PSESM RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   17::277     2e-09  23%  295 aa  HSLO_MANSM RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::277     5e-09  22%  299 aa  HSLO_PSEPG RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::277     6e-09  23%  299 aa  HSLO_PSEPK RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   60::265     3e-08  27%  284 aa  HSLO_ALCBS RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   14::277     4e-08  23%  299 aa  HSLO_PSEP1 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   72::276     9e-08  28%  302 aa  HSLO_NEIMB RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   70::278     1e-07  28%  300 aa  HSLO_PSEE4 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   72::276     2e-07  28%  302 aa  HSLO_NEIMA RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   66::272     6e-07  23%  293 aa  HSLO_EDWI9 RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
   16::270     2e-06  24%  285 aa  HSLO_HAHCH RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock
  319::402     8e-04  41%  540 aa  COPD_DICDI RecName: Full=Coatomer subunit delta;AltName:
    1::290

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIYYGTMFDHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAALVTPWLAEKERWTLDIEGNGPI
HSLO_THEMA      MIYYGTMFDHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAALVTPWLAEKERWTLDIEGNGPI
HSLO_THEP1      MIYYGTMFDHKVRFSIVRMREVVEEARNRHSLSYLATVVLGRALIGAALVTPWLAEKERWTLDIEGNGPI
HSLO_THESQ      MIYYGTMFDHKVRFSIVRMREVVEEARNRHVLSYLATVVLGRALIGAALVTPWLAEKERWTLDIEGSGPI
HSLO_THEM4      MVINGIAYKALVRFSVIDSTDLVKTATKKHNLSPITSVALGRLLTGIALMVPWLSKNDTLTYIIEGSNKI
HSLO_CLOCE      --------------------EMVGQAAEIHGLSPIATAALGRTMTAAGMMSKMLGENDKLTIQLKGDGPL
HSLO_BACA2      -------YDGKVRAYAARTTDMVNEAQRRHDTWPTASAAIGRTMTASLMLGAMLKGEDKLTVKIEGGGPI
HSLO_BACSU      -------YDGKVRAYAARTTDMVNEGQRRHGTWPTASAALGRTMTASLMLGAMLKGDDKLTVKIEGGGPI
HSLO_GEOSW      -------YDGQVRAYAARTTDTVSEAQRRHQTWPTASAALGRAITAGVMMGAMLKGDDKLTIKIDGGGPI
HSLO_BACSK      -----TAYDGEVRAIALRATEMVKEACKRQGTWPTASAALGRTMMGGALMASMLKGKDKLTVRIQGNGPI
HSLO_BACCN      -------FDGEVRAYSVRTTNMVSEAQRRHDTWRTASAALGRSLTAGAMMGAMLKGEQKLTIKVEGNGPI
HSLO_CLOB8      -IVRATAKDGMVRIIAGITTNLVNEGCKIHECTPVASAALGRMLTAGTLITTLKSEKEVVTLKINGNGEI
HSLO_BACST      -------YDGQVRACAARTTETVGEAPRRHQTWPTASAALGRALTAGSMMGAMLKGDETLTIKIDGGGPI
HSLO_BACLD      -------YDGKVRAYAANTTETIHEAQRRHNTWPTASAALGRTMTAAVMLGAMLKGEDKLTVKIEGGGPI
HSLO_CLOPE      --------DGMIRIFATETTELVDEASKIHDCTPTAAAALGRMLTAGTMMGAMLSDKEVVTLQINGGGMA
HSLO_CLOP1      --------DGMIRIFATETTELVDEASKIHDCTPTAAAALGRMLTAGTMMGAMLSDKEVVTLQINGGGMA
HSLO_CLOBB      -------------------------------------------------------EKEALTLKINGGGEA
HSLO_SYNP2      ----GTAADNGIRVVGVISTNLTEEARQRHKLSYVATAALGRTMASALLISSSMKKQERLNLRIKGDGPL
HSLO_CLOPS      --------DGMIRIFATETTELVNEASKIHDCTPTAAAALGRMLTAGTMMGAMLSDKEVVTLQINGGGMA
HSLO_CLOBA      -------------------------------------------------------EKESLTLKINGGGEA
HSLO_STAHJ      -------FDGEIRAYAALTTESVQEAQTRHYTWPTASAAMGRTMTATLLMGSMLKGEQKLTVTVDGKGPI
HSLO_AQUAE      -----------VRVYVVKATNTVETARRIHNLSPSATVAMGRAIVGALLLTSLLKHNQKLLLKIEGDGPI
HSLO_CLOBL      --------DGQVRIIGAITTELVNEGVKLHNCAPTAAAALGRMLTAGALMTTLKSEKDTLTLQIHGGGIA
HSLO_CLOBK      --------DGQVRIIGAITTELVNEGVKLHNCAPTAAAALGRMLTAGALMTTLKSEKDTLTLQIHGGGIA
HSLO_CLOBH      --------DGQVRIIGAITTELVNEGVRLHNCAPTAAAALGRMLTAGALMTTLKSEKDTLTLQIHGGGIA
HSLO_CLOB1      --------DGQVRIIGAITTELVNEGVRLHNCAPTAAAALGRMLTAGALMTTLKSEKDTLTLQIHGGGIA
HSLO_OCEIH      ----------KIRAYAVQSTNTIEEARRRQDTFATASAALGRTITITAMMGAMLKGDDSITTKVMGNGPL
HSLO_CLOTE      -----TAKDGQVRIIGAITTELVNKGIEVHKCSPTGAAALGRMLTAGSLMGSMLSEKDTITIKIDGGGEA
HSLO_CLOB6      --------DGQVRIIGAITTELVNEGVKLHNCAPTAAAALGRMLTAGALMTTLKSEKDTLTLQIHGGGIA
HSLO_THEPX      -IVRATAYNNKILAIAAFSTQTAQKAKEIHNLTPTTCAALGRALTAVAMMRVMMGEKDKVTLVIKGDGPI
HSLO_THEP3      -IVRATAYNNKILAIAAFSTQTAQKAKEIHNLTPTTCAALGRALTAVAMMRVMMGEKDKVTLVIKGDGPI
HSLO_LACAC      -----------LRLLTITAKGVVSEAQKRHDLWSASSAVLGRTLVGSLLLAAELTDKEELTVRLLGNGPV
HSLO_LACBA      ------------RAYVVDATETVAEAQQRHDTWSAATAALGRTLIGTMLLTSLLKGDEKLTVKVNGHGPV
HSLO_CLOBJ      --------DGQVRIIGAITTELVNEGVRLHNCAPTAAAALGRMLTAGALMTTLKSEKDTLTLQIHGGGIA
HSLO_LACF3      ----------------VNATALVEEAHQIHDTWSAASAALGRAMVGTLLLTSGLQGEAGMTVKIQGDGPV
HSLO_ACAM1      -----TAADDGIRAVGVITTRLTEDARQRHGLSYVATAALGRTMSAGLLLASSMKQAERINLRIRGDGPL
HSLO_LACSS      --------DGQLRAYAVNATQVVTEAQEKHDTWPTSSAAFGRTIVGTLLLSAGLKGDTKMTVKVDGDGPV
HSLO_EUBR3      -IVRATAADANIRAFAVTSKEMVENAREDHMTTPVMTXXXXXXXXXXXXXXXXXXDKDIITLQIQCSGPA
HSLO_BACHK      -------FDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGRSLTAGTMMGAMLKGDQKLTIKVEGNGPI
HSLO_BACCZ      -------FDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGRSLTAGTMMGAMLKGDQKLTIKVEGNGPI
HSLO_BACCQ      -------FDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGRSLTAGTMMGAMLKGDQKLTIKVEGNGPI
HSLO_BACC7      -------FDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGRSLTAGTMMGAMLKGDQKLTIKVEGNGPI
HSLO_BACC3      -------FDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGRSLTAGTMMGAMLKGDQKLTIKVEGNGPI
HSLO_BACC1      -------FDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGRSLTAGTMMGAMLKGDQKLTIKVEGNGPI
HSLO_BACC0      -------FDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGRSLTAGTMMGAMLKGDQKLTIKVEGNGPI
HSLO_BACAN      -------FDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGRSLTAGTMMGAMLKGDQKLTIKVEGNGPI
HSLO_BACAH      -------FDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGRSLTAGTMMGAMLKGDQKLTIKVEGNGPI
HSLO_BACAC      -------FDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGRSLTAGTMMGAMLKGDQKLTIKVEGNGPI
HSLO_BACAA      -------FDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGRSLTAGTMMGAMLKGDQKLTIKVEGNGPI
HSLO_CLOBM      --------DGQVRIIGAITTELVNEGVKLHNCAPTAAAALGRMLTAGALMTTLKSGKDTLTLQIHGGGIA
HSLO_BACP2      -------YDGKVRAYAANTTDTINEAQRRHHTWPTASAAIGRTMTATVMMGAMLKGENKLTVKIEXXXXX
HSLO_BACCR      -------FDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGRSLTAGTMMGAMLKGEQKLTIKVEGNGPI
HSLO_BACC4      -------FDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGRSLTAGTMMGAMLKGEQKLTIKVEGNGPI
HSLO_ENTFA      -----------IRAYAISATETVSEAQRRHDTWSSSXXXXXXXXXXXXXXXXXXKGDDKLTVKVQGNGPA
HSLO_BACC2      -------FDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGRSLTAGTMMGAMLKGDQKLTIKVEGNGPI
HSLO_BACWK      -------FNGEVRAYSVRTTNTVSEAQKRHDTWRTASAALGRSLTAGTMMGAMLKGEQKLTIKVEGNGPI
HSLO_LACH4      -----------LRLLTITAKDVVGEAQKRHDLWSASAAVLGRTLVGSLLLAAELTDKEELTVRLLGNGPV
HSLO_CLOTH      ---------------------MVKEAQKVHGLSPLATVALGRXXXXXXXXXXXLKEENAVTLQIKXXXXX
HSLO_CLOAB      -----------VRIIAAITTDMVNEGVKTHKCAPTAAAALGRMLTAGVLMGAQLAESDSITLKINGGGIA
HSLO_LACC3      --------DEHFRIFAADATQTVREAQRRHDTWSASSAALGRALVATALLAASGLKNDMLTVRIKGDGPV
HSLO_TRIEI      ---------------------LTEEARQRHKLSWVASVVLGRTMAGLLLASSMKTPESRVNIRVQGNGPL
HSLO_STACT      -------FDGDIRAYAAVTTNAVQEAQTRHYTWPTASXXXXXXXXXXXXXXXXXKGDQKLTVTVDGHGPI
HSLO_LACCB      --------DEHFRIFAADATQTVREAQRRHDTWSASSAALGRTLVATALLAASGLKNDMLTVRIKGDGPV
HSLO_GEOKA      -------YNGQVRAYAARTTETVAEAQRRHQTWPTASAALGRALTAGVMMGAMLKGEETLTIKIDGGGPI
HSLO_LISIN      -------YDGMARVYAAVTTETIKEAQRRHDTWSVSSAALGRTMTGTLFLGAMQKEDQKITVKIEGDGPI
HSLO_LISMO      -------YDGMARVYAAVTTETIKEAQRRHDTWSVSSAALGRTMTGTLFLGAMQKEDQKITVKIEGDGPI
HSLO_LISMH      -------YDGMARVYAAVTTETIKEAQRRHDTWSVSSAALGRTMTGTLFLGAMQKEDQKITVKIEGDGPI
HSLO_LISMF      -------YDGMARVYAAVTTETIKEAQRRHDTWSVSSAALGRTMTGTLFLGAMQKEDQKITVKIEGDGPI
HSLO_LISMC      -------YDGMARVYAAVTTETIKEAQRRHDTWSVSSAALGRTMTGTLFLGAMQKEDQKITVKIEGDGPI
HSLO_DESPS      ---------------------LVNEACRKHDVGPLAAVALGRALTGSILMGALLKGDQYLQLKFEGNGPL
HSLO_STAES      -IVRGLAYGGEIRAYAAITTESVQEAQTRHYTWPTASAAMGRTMTATVMMGAMLKGNQKLTVTVDGKGPI
HSLO_STAEQ      -IVRGLAYGGEIRAYAAITTESVQEAQTRHYTWPTASAAMGRTMTATVMMGAMLKGNQKLTVTVDGKGPI
HSLO_THETN      -IVKATAYEDNVLAFAALSKDTVNRAKEIHSLTPTACAALGRSLTAVAMMTMMKGEKDKVTLVIKGDGPI
HSLO_ANASP      -----TAADGGIRAVGVITTRLTEEARQRHKLSYVATAALGRTMAAGLLMASGMKRVSRVNVRVKGDGPL
HSLO_THEYD      --------------------ETVEYARKIHDTWPTATAAMGRVIAGSVLLASTLKDRQKIMVQIKGDGPL
HSLO_CYAP4      ---------------------LTEEARQRHKLSYVATAALGRTMAAGLLLASSMKQPQRVNIRIKGDGPL
HSLO_CLOD6      ----------QVRAFVATTRNTVEEARRLHETTKVXXXXXXXXXXXXSIMGLMMKDSDKLTVXXXXXXXX
HSLO_STRSV      ------------RAYVLDSTETVRTAQEKHQTQASSTVALGRTLIASQILAANEKGQTKITVKVLGTSSL
HSLO_THEEB      --------------------QLTDEARKRHQLSYVATAALGRTMAGLILASSFKQPQARVNVRIQGNGPL
HSLO_STRGC      ------------RAYVLDSTETVRTAQEKHQTQASSTVALGRTLIASQILAANEKGQTKITVKVLGTSSL
HSLO_LACJO      -----------LRLITVDAKDLVSEAQKRHDTWSASSAVLGRTXXXXXXXXXXXXXXXXXTVRLLGNGPV
HSLO_DESRM      --------DGNFRIFSARTTNTVEEARTRHNSWPVATAALGRTMTAALLMGANLKGEDTLSIRVLGDGPL
HSLO_CLOPH      -IIRATAANSQIRAFACISTEIVETARQAHNTSPVVTAALGRLLTGGAMMGSMMGEKDLLTLKIACSGPI
HSLO_STRTD      --------------------ETVRTAQEKHNTLSSSTVALGRTLIANQILAANQKGDSKITVKVIGNGSF
HSLO_STAAW      -------FDGEIRAYAALTTETVQEAQTRHYTWPXXXXXXXXXXXXXXXXXXXLKGDQKLTVTVDGQGPI
HSLO_STAAT      -------FDGEIRAYAALTTETVQEAQTRHYTWPXXXXXXXXXXXXXXXXXXXLKGDQKLTVTVDGQGPI
HSLO_STAAS      -------FDGEIRAYAALTTETVQEAQTRHYTWPXXXXXXXXXXXXXXXXXXXLKGDQKLTVTVDGQGPI
HSLO_STAAR      -------FDGEIRAYAALTTETVQEAQTRHYTWPXXXXXXXXXXXXXXXXXXXLKGDQKLTVTVDGQGPI
HSLO_STAAE      -------FDGEIRAYAALTTETVQEAQTRHYTWPXXXXXXXXXXXXXXXXXXXLKGDQKLTVTVDGQGPI
HSLO_STAAC      -------FDGEIRAYAALTTETVQEAQTRHYTWPXXXXXXXXXXXXXXXXXXXLKGDQKLTVTVDGQGPI
HSLO_STAAB      -------FDGEIRAYAALTTETVQEAQTRHYTWPXXXXXXXXXXXXXXXXXXXLKGDQKLTVTVDGQGPI
HSLO_STAA8      -------FDGEIRAYAALTTETVQEAQTRHYTWPXXXXXXXXXXXXXXXXXXXLKGDQKLTVTVDGQGPI
HSLO_STAA3      -------FDGEIRAYAALTTETVQEAQTRHYTWPXXXXXXXXXXXXXXXXXXXLKGDQKLTVTVDGQGPI
HSLO_LACPL      ---------------------VVAEAQRRHDTWSAASAALGRSLVGTLLLSSVLKGEEQMTVKIXXXXXX
HSLO_STRT1      --------------------ETVRTAQEKHNTLSSSTVALGRTLIANQILAANQKGDSKITVKVIGNGSF
HSLO_STAAN      -------FDGEIRAYAALTTETVQEAQTRHYTWPXXXXXXXXXXXXXXXXXXXLKGDQKLTVTVDGQGPI
HSLO_STAAM      -------FDGEIRAYAALTTETVQEAQTRHYTWPXXXXXXXXXXXXXXXXXXXLKGDQKLTVTVDGQGPI
HSLO_STAA9      -------FDGEIRAYAALTTETVQEAQTRHYTWPXXXXXXXXXXXXXXXXXXXLKGDQKLTVTVDGQGPI
HSLO_STAA2      -------FDGEIRAYAALTTETVQEAQTRHYTWPXXXXXXXXXXXXXXXXXXXLKGDQKLTVTVDGQGPI
HSLO_STAA1      -------FDGEIRAYAALTTETVQEAQTRHYTWPXXXXXXXXXXXXXXXXXXXLKGDQKLTVTVDGQGPI
HSLO_LACDA      ------------------------------------------------------------TLRLLGDGPV
HSLO_CLONN      --------DGQVRIIVADTRELVNKGIKIHNCAPTAAAALGRMLTAGVIMGSMLSDKDVITLKIDGGGEA
HSLO_STRT2      --------------------ETVRTAQEKHNTLSSSTVALGRTLIANQILAANQKGDSKITVKVIGNGSF
HSLO_LACDB      ------------------------------------------------------------TLRLLGDGPV
HSLO_LACLA      ----------------------VKEAQERHQTWPTSTVALGRTLIAGQILGANEKGDTKITVKVLGDGAM
HSLO_SYNY3      -----TAADGGIRAVGVITTNLTEEARQRHRLSYVATAALGRTMAGLLLASSMKQEKSRVNIRIRGNXXX
HSLO_STAS1      -------FGGQIRAYSALTTESVQEAQTRHYTWPTASXXXXXXXXXXXXXXXXXKGNQKLTVTVDGQGPI
HSLO_BACHD      -------FEGKVRAYALKATEMVNEAVRRQDTWPTASXXXXXXXXXXXXXXXXXKGDAKLTVKVEGDGPI
HSLO_LACLM      ----------------------VREAQERHQTWPTSTVALGRTLIAAQILGANEKGDTKITVKVLGDGAM
HSLO_GEOMG      ---------------------LVGELCRRHGTWPTASAALGRAVTGGALMGALLKTGQRVALRFEGNGPL
HSLO_LACLS      ----------------------VREAQERHQTWPTSTVALGRTLIAAQVLGANEKGDTKITVKVLGDGAM
HSLO_PROM2      -----------IRLVAVLTTESSLEAKKRHGLSYLATCILGRXXXXXXXXXXXMKIMHRVTLRVRSDGPL
HSLO_CYAP7      -----TAADGGIRAVGVISTRLTEEARVRHKLSYVATAALGRAMTGLLLASSMKREGSRVNIRIKXXXXX
HSLO_ALKMQ      -IIRATAANSSIRAFVANTTNLVEKARGFHQTSPVASAALGRTLTATSMMGVMLGEKQKITTKINXXXXX
HSLO_CYAP8      -----TAADGGIRAVGVISTRLTEEARARHKLSYVATAALGRAMTGLLLASNMKREGSRVNLRIKGNXXX
HSLO_BREBN      -----TGFNGHVRAFAARTTESVEDMRRRHDMWNTATAAAGRTLTITLMMGAMLKGNESLHVKVKGGGPI
HSLO_FINM2      -LYIATDSTESFRFNIVDSTDLVQSVRDIHNTSATASAALGRLSTMAAIMSHELKESHNITXXXXXXXXX
HSLO_LISW6      -------YDGMARVYAAVTTETIKEAQRRHDTWSVSSAALGRTMTGTLFLGAMQKEDQKITVKIEGDGPI
HSLO_PROMS      -----------IRLVAVLTTESSLEAKKRHGLSYLTTCILGRXXXXXXXXXXXMKIMHRVTLRVRSDGPL
HSLO_STRPS      ------------RAFVLDSTETVRTAQEKHQTQASSTVALGRTLIASQILAANEKGNTKLTVKVLGSSSL
HSLO_STRZT      ------------RAFVLDSTETVRTAQEKHQTQASSTVALGRTLIASQILAANEKGNTKLTVKVLGSSSL
HSLO_STRZP      ------------RAFVLDSTETVRTAQEKHQTQASSTVALGRTLIASQILAANEKGNTKLTVKVLGSSSL
HSLO_STRZJ      ------------RAFVLDSTETVRTAQEKHQTQASSTVALGRTLIASQILAANEKGNTKLTVKVLGSSSL
HSLO_STRR6      ------------RAFVLDSTETVRTAQEKHQTQASSTVALGRTLIASQILAANEKGNTKLTVKVLGSSSL
HSLO_STRPN      ------------RAFVLDSTETVRTAQEKHQTQASSTVALGRTLIASQILAANEKGNTKLTVKVLGSSSL
HSLO_STRPJ      ------------RAFVLDSTETVRTAQEKHQTQASSTVALGRTLIASQILAANEKGNTKLTVKVLGSSSL
HSLO_STRPI      ------------RAFVLDSTETVRTAQEKHQTQASSTVALGRTLIASQILAANEKGNTKLTVKVLGSSSL
HSLO_STRP7      ------------RAFVLDSTETVRTAQEKHQTQASSTVALGRTLIASQILAANEKGNTKLTVKVLGSSSL
HSLO_STRP4      ------------RAFVLDSTETVRTAQEKHQTQASSTVALGRTLIASQILAANEKGNTKLTVKVLGSSSL
HSLO_STRP2      ------------RAFVLDSTETVRTAQEKHQTQASSTVALGRTLIASQILAANEKGNTKLTVKVLGSSSL
HSLO_GEOBB      ----------------------------RHDTLPTATAALGRGITAGALMGALLKTGQRVAMRFEGNGPL
HSLO_STRMU      ------------RAYVLDSTETVRTAQEEHQSLSSSTVALGRTLIANQILAANQKGDSKVTVKVIGDSSF
HSLO_STREM      ------------RAYVLDCTETVRAAQERHHTLSSSTVALGRTLIANQILAANQKGDSKVTVKVIGDSSF
HSLO_PROM0      -----------IRLVAVLTTESSLEAKKRHDLSYLTTCILGRXXXXXXXXXXXMKIMHRVTLRVRSDGPL
HSLO_GEOSM      -----------VRALVCVTTATVGEICKRHDTLPTATAALGRGITAGALMGSLVKTGQRVALRFEGNGPL
HSLO_PROM9      -----------IRLVAVLTTESSLEAKKRHGLSYITTCILGRXXXXXXXXXXXMKIMHRVTLRVRSDGPL
HSLO_STRE4      ------------RAYVLDCTETVRYAQERHHTLSSSTVALGRTLIANQILAANQKGDSKVTVKVIGDSSF
HSLO_STRP9      ------------RAYVLDSTETVALAQEKHNTLSSSTVALGRTLIANQILAANQKGDSKITVKVIGDSSF
HSLO_PROM5      -----------IRLVAVLTTNATREAKKRHGLSYLTSSILGRXXXXXXXXXXXMKIMHRVTLRVRSDGPL
HSLO_SYNJA      -----TAAEGKIRVVGLVSTQAVQEARERHKLSYVATVXXXXXXXXXXXXXXXXXXXXXXNLQLKGNGPL
HSLO_PROMP      -----------IRLVAVLTTDSSMEAKERHGLSYLTTSILGRXXXXXXXXXXXMKVMHRVTLRVRSDGPL
HSLO_STRS7      ------------RAYVLDCTETVRYAQERHHTLSSSTVALGRTLIANQILAANQKGDSKVTVKVIGDSSF
HSLO_STRPC      ------------RAYVLDSTETVALAQEKHNTLSSSTVALGRTLIANQILAANQKGDSRITVKVIGDSSF
HSLO_STRPB      ------------RAYVLDSTETVALAQEKHNTLSSSTVALGRTLIANQILAANQKGDSRITVKVIGDSSF
HSLO_STRA1      ------------RAYVLDCTETVRTAQEKHQTLSSSTVALGRTLIANQILAANQKGNSKVTVKVIGDSSF
HSLO_SYNS9      -----------IRLVAVSTTETLREAQARHGLSLLTAVMLGRAMAGLMLASSMKVRHGRVNLRLGSDGPI
HSLO_STRPZ      ------------RAYVLDSTETVALAQEKHNTLSSSTVALGRTLIANQILAANQKGDSKITVKVIGDSSF
HSLO_THET2      --------------------DIVEEARRRHGLSPTATAALGRAMTGXXXXXXXXXKKERITLRVEGTGPL
HSLO_STRPM      ------------RAYVLDSTETVALAQEKHNTLSSSTVALGRTLIANQILAANQKGDSKITVKVIGDSSF
HSLO_STRPG      ------------RAYVLDSTETVALAQEKHNTLSSSTVALGRTLIANQILAANQKGDSKITVKVIGDSSF
HSLO_STRPF      ------------RAYVLDSTETVALAQEKHNTLSSSTVALGRTLIANQILAANQKGDSKITVKVIGDSSF
HSLO_STRP8      ------------RAYVLDSTETVALAQEKHNTLSSSTVALGRTLIANQILAANQKGDSKITVKVIGDSSF
HSLO_STRP1      ------------RAYVLDSTETVALAQEKHNTLSSSTVALGRTLIANQILAANQKGDSKITVKVIGDSSF
HSLO_CARHZ      -----------IRFTGVSSRQTVEEARKRHNLSXXXXXXXXXXXXXXXXXXSDLKNPDLLTLRIFGDGPL
HSLO_STRPD      ------------RAYVLDSTETVALAQEKHNTLSSSTVALGRTLIANQILAANQKGDSKITVKVIGDSSF
HSLO_STRU0      ------------RAFVLDSTQTVKTAQEKHQTLSSSTVALGRTLIANQILAANQKGDSKITVKVIGDSSF
HSLO_GEOSL      ---------------------LVGDACRRHGTLPTASAALGRALTGGVLMGALLKTGQRIALTFEGNGPL
HSLO_ACHLI      -------YNQEIRIYTSVSTNLVEKSRKLHKTLPTASAAMGRFLTASAMMSLMYKDGERLTLKIDGDGPI
HSLO_STRA5      ------------RAYVLDCTETVRTAQEKHQTLSSSTVALGRTLIANQILAANQKGNSKVTVKVIGDSSF
HSLO_STRA3      ------------RAYVLDCTETVRTAQEKHQTLSSSTVALGRTLIANQILAANQKGNSKVTVKVIGDSSF
HSLO_SYNP6      --------------------DLTAEAQRKHGLSFVATTALGRSMAGLLLASSMKKEGSRVNLRIRSAGPL
HSLO_SYNE7      --------------------DLTAEAQRKHGLSFVATTALGRSMAGLLLASSMKKEGSRVNLRIRSAGPL
HSLO_STRP3      ------------RAYVLDSTETVALAQEKHNTLSSSTVALGRTLIANQILAANQKGDSKITVKVIGDSSF
HSLO_SYNSC      -----------IRLVAVSTTNIVREARERHGLSFLTSVMLGRAMTGLMLASSMKVRHGRVNLRLGSDGPI
HSLO_STRP6      ------------RAYVLDSTETVALAQEKHNTLSSSTVALGRTLIANQILAANQKGDSKITVKVIGDSSF
HSLO_SYNJB      -----TAAEGKIRVVGLVATQAVQEARERHKLSYVATVXXXXXXXXXXXXXXXXXXXXXXNLQLKGNGPL
HSLO_STRSY      ------------RAFVLDSTETVKTAQEKHDTMASSTVALGRTLIANQILAVNEKGDTKITLKILASGAV
HSLO_STRS2      ------------RAFVLDSTETVKTAQEKHDTMASSTVALGRTLIANQILAVNEKGDTKITLKILASGAV
HSLO_ALKOO      ----GTAASNQIRVFVANTTEMVAKAQELQMATPVAIAALGRTLTATSMMGLMSSEKEKITXXXXXXXXX
HSLO_PELPD      ---------------------------------------------------------QRLALKFEANGPL
HSLO_PELCD      --------DGTLRATAAVTTELVDAICRRQGTDPTASVALGRLVTGTALMGSLLKGDQRLALMIEGNGPV
HSLO_GEOLS      --------------------------------SPIASIALGRALSGAALVGSTLKQGQRTAIKFEGGGPL
HSLO_ANAVT      -----TAADGGIRAVGVITTRLTEEARQRHKLSYVATAALGRTMAAGLLMASSMKRASRVNVRVKGDGPL
HSLO_THET8      --------------------------RLRHGLSPTATAALGRAMTGXXXXXXXXXKKERITLRVEGTGPL
HSLO_PROM1      -----------IRLVAVSTTESTKEAKERHSLSYLTSAIVGRXXXXXXXXXXXXKVNHRVTLRISSNGPL
HSLO_GLOVI      ----------RIRAVGVLSTRLTEEARGRHKLSYVATAALGRTMAAGLLIASNFKQTERVNLRLQGDGPL
HSLO_PROMT      -----------IRLVAVSTTESTKEAKERHSLSYLTSAIVGRXXXXXXXXXXXXKVNHRVTLRISSNGPL
HSLO_DEIRA      ----GTAAGGTLRLVGIEASKVVEEARRRHNLSKTATAALGRTMAASALLAVVLGKRSRVTVRVDGGGPV
HSLO_SYNS3      -----------------------------HRLSYLTTVMLGRAMAGLLLASSMKVRHGRVNLRIGSDGPI
HSLO_SYNPW      -----------IRIVAVTTGETTRYAQSRHGLSYLTTVMLGRAMAGLLLASSMKVSHGRVNLRLGSDGPI
HSLO_SYMTH      ---------------------------------------------------------ESLTLRVAGDGPL
HSLO_PROM4      ----------------------LKEAKSRHKLSYLTXXXXXXXXXXXXXXXXXXKVLHRVTLKIQSDGPI
HSLO_SYNR3      ----------------------------RHQLSFLASALLGRAMTGLLLASSMKVAHGRVTLRTQSDGLL
HSLO_NOSP7      ---------------------LTEEARQRHKLSYVATAALGRTMAAGLLMASSMKRSSRVNVRVKGDGPL
HSLO_PROMA      --------------------ESTKEARRRHSLSYLTTIMLSRAMSAGLLLASSMKVKQRVTIKIQSDGPL
HSLO_SYNPX      -----------IRLVAVSTTETVREARRRHDLSFLSTVXXXXXXXXXXXXXXXXKVRHRVNLRLGSDGPL
HSLO_MICAN      -----TAADGGIRVVGVITTRLTEEARQRHKLSNVATAALGRTMXXXXXXXXXXKKPSRVNIRIKXXXXX
HSLO_TERTT      --------------------------------------LLGEFVAAVALLSETLKYDGILTLQVRGNGPV
HSLO_HAEDU      ---YRYLFQHRVRGEWVRLNETFSQTLNTHQYPKAVQHLLGEMLVATSLLTAIMKFEGNITVQIQGDGPL
HSLO_CHRVO      -----------VRGALVRLDGAWQQVLARRAYPQALKTVLGEMMAASVLMAANLKFDGSLILQIHGTGAL
HSLO_SHESW      -ILHRYLFDNAVRGELVQLQESYQQVLDAQAYPPVLQILLGELMXXXXXXXXXXKFSGDISVQLQGNGPV
HSLO_SHEPC      -ILHRYLFDNAVRGELVQLQESYQQVLDAQAYPPVLQILLGELMXXXXXXXXXXKFSGDISVQLQGNGPV
HSLO_PECCP      --------NYAVRGELVTVNETYQRILTNHDYPSAVQTLLGEMLVATSLLTATLKFSGDITVQLQGDGPL
HSLO_HAES2      --------DRAVRGEWVRLNKTFTDTLNSHEYPRIVRNLLGEMMVATNLLTATLKFKGNITIQIQGNGPL
HSLO_HAEIN      ---YRYLFQHRVRGEWVRLNKTFTDTLNTHQYPKAVQDLLGEMMVATNLLTATLKFAGNITVQIQGDGPL
HSLO_HAEIG      ---YRYLFQHRVRGEWVRLNKTFTDTLNTHQYPKAVQDLLGEMMVATNLLTATLKFDGNITVQIQGDGPL
HSLO_HAEI8      ---YRYLFQHRVRGEWVRLNKTFTDTLNTHQYPKAVQDLLGEMMVATNLLTATLKFAGNITVQIQGDGPL
HSLO_ERWCT      --------NYAVRGELVTVNETYQRILTNHDYPAAVQTLLGEMLVATSLLTATLKFSGDITVQLQGDGPL
HSLO_HAES1      --------DRAVRGEWVRLNKTFTDTLNSHEYPRIVRNLLGEMMVATNLLTATLKFKGNITIQIQGNGPL
HSLO_HAEIE      ---YRYLFQHRVRGEWVRLNKTFTDTLNTHQYPKAVQDLLGEMMVATNLLTATLKFDGNITVQIQGDGPL
HSLO_ACTP7      ---YRYLFQNRVRGEWVRLNDTFTETLNTHQYPKAVQNLLGEMLVATSLLTAIMKFEGTITVQIQGDGPL
HSLO_SHELP      ------LFDNAVRGQIVQLEKSYQEILSAHTYPEAIARLLGELMXXXXXXXXXXKFDGDISVQVQGNGPV
HSLO_SALTI      ------------------------------------------------------------TVQLQGDGPL
HSLO_SHESA      ------------------------------------------------------------SVQLQGNGPV
HSLO_ACTPJ      ---YRYLFQNRVRGEWVRLNDTFTETLNTHQYPKAVQNLLGEMLVATSLLTAIMKFEGTITVQIQGDGPL
HSLO_SHEDO      -ILHRYLFDNAVRGQLVQLEDSFQAMLAAQDYPKALQVLLGELMAATSLLTATIKFSGDISVQLQGDGPV
HSLO_SALPK      ------------------------------------------------------------TVQLQGDGPL
HSLO_SALPA      ------------------------------------------------------------TVQLQGDGPL
HSLO_PHOLL      ------------------------------------------------------------TVQIQGDGPV
HSLO_ACTP2      ---YRYLFQNRVRGEWVRLNDTFTETLNTHQYPKAVQNLLGEMLVATSLLTAIMKFEGTITVQIQGDGPL
HSLO_SHEB9      ------LFDNAVRGELVQLQDSYQQVISAQEYPAVLQVLLGELMXXXXXXXXXXKFSGDISVQLQGNGPV
HSLO_SHEB8      ------LFDNAVRGELVQLQDSYQQVISAQEYPAVLQVLLGELMXXXXXXXXXXKFSGDISVQLQGNGPV
HSLO_SHEB5      ------LFDNAVRGELVQLQDSYQQVISAQEYPAVLQVLLGELMXXXXXXXXXXKFSGDISVQLQGNGPV
HSLO_SHEB2      ------LFDNAVRGELVQLQDSYQQVISAQEYPAVLQVLLGELMXXXXXXXXXXKFSGDISVQLQGNGPV
HSLO_SALTY      ------------------------------------------------------------TVQLQGDGPL
HSLO_SALCH      ------------------------------------------------------------TVQLQGDGPL
HSLO_ALISL      ------------------------------------------------------------TLQLQGNGPV
HSLO_SHESR      ------------------------------------------------------------SVQLQGNGPV
HSLO_SHESM      ------------------------------------------------------------SVQLQGNGPV
HSLO_ENT38      ------------------------------------------------------------TVQLQGDGPM
HSLO_AERS4      ------------------------------------------------------------TVQLQGDGPV
HSLO_SHEON      ------------------------------------------------------------SVQLQGNGPV
HSLO_ESCF3      ------------------------------------------------------------TVQLQGDGPM
HSLO_PHOPR      ------------------------------------------------------------TVQLQGDGPV
HSLO_CHRSD      ------LFDENVRGEIVGLQQAYADVLDKHAYPAAVRRQLGELLGAVALLTETVKLDGTVSLEVRGQGAV
HSLO_SERP5      --------NYAVRGELVTVSETYQQVLNNHDYPAPVKKLLGEXXXXXXXXXXXXKFDGDITVQLQGDGPL
HSLO_SHISS      ------------------------------------------------------------TVQLQGDGPM
HSLO_SHIFL      ------------------------------------------------------------TVQLQGDGPM
HSLO_SHIF8      ------------------------------------------------------------TVQLQGDGPM
HSLO_SHIDS      ------------------------------------------------------------TVQLQGDGPM
HSLO_SHEWM      ------------------------------------------------------------SVQLQGDGPV
HSLO_PSEF5      ------IFDESTRGELVALERSYAEVLAKHPYPEPVAQLLGELMAAASLLVGTLKFDGLLILQARSEGPV
HSLO_ECOSM      ------------------------------------------------------------TVQLQGDGPM
HSLO_ECOLU      ------------------------------------------------------------TVQLQGDGPM
HSLO_ECOLI      ------------------------------------------------------------TVQLQGDGPM
HSLO_ECOL6      ------------------------------------------------------------TVQLQGDGPM
HSLO_ECODH      ------------------------------------------------------------TVQLQGDGPM
HSLO_ECOBW      ------------------------------------------------------------TVQLQGDGPM
HSLO_ECO8A      ------------------------------------------------------------TVQLQGDGPM
HSLO_ECO81      ------------------------------------------------------------TVQLQGDGPM
HSLO_ECO57      ------------------------------------------------------------TVQLQGDGPM
HSLO_ECO55      ------------------------------------------------------------TVQLQGDGPM
HSLO_ECO45      ------------------------------------------------------------TVQLQGDGPM
HSLO_ECO27      ------------------------------------------------------------TVQLQGDGPM
HSLO_CAUCR      -----------VRGRVVRLGAAIDEVLTRHDYPEPVANLLGEACALAALVGSSLKFEGRLIVQAQGDGPV
HSLO_CAUCN      -----------VRGRVVRLGAAIDEVLTRHDYPEPVANLLGEACALAALVGSSLKFEGRLIVQAQGDGPV
HSLO_VIBFM      ------------------------------------------------------------TLQLQGDGPV
HSLO_VIBF1      ------------------------------------------------------------TLQLQGDGPV
HSLO_ECO7I      ------------------------------------------------------------TVQLQGDGPM
HSLO_ACTSZ      ---YRYLFQNRVRGEWVRMNKSFSETLNTHHYPIAVQNLLGEMMVATGLLTATLKFTGHITVQIQGDGPL
HSLO_SHEPW      ---YRYLFDNSVRGELVQLEKSYQEVIAAHDYPVAIQHLLGELMXXXXXXXXXXKFSGDISIQLQGDGPV
HSLO_ENTS8      --------NYAVRGELVTVSETWKQILENHDYPMPVKTLLGEXXXXXXXXXXXXKFAGDITVQLQGDGPM
HSLO_SHIBS      ------------------------------------------------------------TVQLQGDGPM
HSLO_PSEPF      --------DSDTRGELVSLERSYAEVLAKHPYPEPVAQLLGELMAAASLLVGTLKFDGLLILQARSEGPI
HSLO_PSEA7      --------DTDVRGEMVDLERSYSEVLAKHPYPEPVAQLLGEMLAAASLLCGTLKFDGLLVLQARSSGAV
HSLO_PSEA6      -----------VRGELVRLENSYQSILDSYAYPPVIQKLLGELMXXXXXXXXXXKFEGDIALQLQSDGPV
HSLO_SHESH      -----------VRGELVQLEQSYQEILSAHTYPTQIQELLGELMXXXXXXXXXXKFSGDISVQLQGDGPI
HSLO_NITOC      -------------------------------------------------------------LQTQSEGPL
HSLO_VIBPA      ------------------------------------------------------------TIQLQGDGPV
HSLO_SODGM      --------DYAVRGELVSLQETYRQVLGQHNYPPAVKTLLGEXXXXXXXXXXXXKFTSEITVQLQGDGPL
HSLO_NEIG2      -------------------------------------------------------------VQVQGQGKL
HSLO_NEIG1      -------------------------------------------------------------VQVQGQGKL
HSLO_PROMH      ------------------------------------------------------------TVQLQGDGPV
HSLO_YERPS      --------NHAVRGELVSVNETYQQVLANHDYPPAVQKLLGEMLVATSLLTATLKFDGDITVQLQGDGPL
HSLO_YERPP      --------NHAVRGELVSVNETYQQVLANHDYPPAVQKLLGEMLVATSLLTATLKFDGDITVQLQGDGPL
HSLO_YERPN      --------NHAVRGELVSVNETYQQVLANHDYPPAVQKLLGEMLVATSLLTATLKFDGDITVQLQGDGPL
HSLO_YERPG      --------NHAVRGELVSVNETYQQVLANHDYPPAVQKLLGEMLVATSLLTATLKFDGDITVQLQGDGPL
HSLO_YERPE      --------NHAVRGELVSVNETYQQVLANHDYPPAVQKLLGEMLVATSLLTATLKFDGDITVQLQGDGPL
HSLO_YERPB      --------NHAVRGELVSVNETYQQVLANHDYPPAVQKLLGEMLVATSLLTATLKFDGDITVQLQGDGPL
HSLO_YERPA      --------NHAVRGELVSVNETYQQVLANHDYPPAVQKLLGEMLVATSLLTATLKFDGDITVQLQGDGPL
HSLO_YERP3      --------NHAVRGELVSVNETYQQVLANHDYPPAVQKLLGEMLVATSLLTATLKFDGDITVQLQGDGPL
HSLO_PSEHT      ------LFDNDVRGELVQIENAYNEMIANHNYPDAVKALLGEXXXXXXXXXXXXKFEGEIAVQLQGDGPV
HSLO_SHEFN      -ILHRYIFDNAVRGEIVQLESSYQEVLSAHIYPVALQALIGEXXXXXXXXXXXIKFSGDISVQLQGDGPV
HSLO_PSEAB      --------DTDVRGEMVDLERSYSEVLAKHPYPEPVAQLLGEMLAAASLLCGTLKFDGLLVLQARSSGAV
HSLO_VIBVY      ------------------------------------------------------------TIQLQGDGPV
HSLO_VIBVU      ------------------------------------------------------------TIQLQGDGPV
HSLO_PSEFS      --------ENDARGELVSLERSYAEVLAKHPYPEPVAQLLGELMAAASLLVGTMKFDGLLILQARSEGPV
HSLO_PSEAE      --------DTDVRGEMVDLERSYSEVLAKHPYPEPVAQLLGEMLAAASLLCGTLKFDGLLVLQARSSGAV
HSLO_PSEA8      --------DTDVRGEMVDLERSYSEVLAKHPYPEPVAQLLGEMLAAASLLCGTLKFDGLLVLQARSSGAV
HSLO_PSEPW      --------DRDIRGEWVALDDSYAAVLARHAYPQPVATLLGELMAATSLLVGALKFDGLLILQARSAGPI
HSLO_YERPY      --------NHAVRGELVSVNETYQQVLANHDYPPAVQKLLGEMLVATSLLTATLKFDGDITVQLQGDSPL
HSLO_VIBHB      ------------------------------------------------------------TIQLQGDGPV
HSLO_VIBCH      ------------------------------------------------------------TLQLQGNGPV
HSLO_PASMU      --------DRAVRGEWVRLNQTFTDTLNTHQYPKVIQNLLGEMMVATSLLTATLKFEGDITVQVQGDGPL
HSLO_COLP3      ------------------------------------------------------------TVQLQGDGPV
HSLO_METFK      ---------------------------------------------------------------VQGKGPL
HSLO_AZOVD      -------------------------------------------------------------LQARSPGPI
HSLO_ERWT9      --------NHAVRGELVTVSQTWNEIIQGHDYPQPVQQILGEXXXXXXXXXXXXKFDGDITVQLQGDGPL
HSLO_PSE14      -------------------------------------------------------------LQARSSGAV
HSLO_PSEU2      -------------------------------------------------------------LQARSSGAV
HSLO_PSESM      -------------------------------------------------------------LQARSSGAV
HSLO_MANSM      --------DRAVRGEWVRLNQTFIDTLNTHHYPNVVRNLLGEMMVATNLLTATLKFNGDITVQIQGDGPL
HSLO_PSEPG      ------IFDERVRGEWVSLDDSYAAVLARHEYPQPVKALLGELMAATALLVGAMKFDGLLILQARSAGPI
HSLO_PSEPK      ------IFDERVRGEWVSLDDSYAAVLARHEYPQPVQVLLGELMAATALLVGAMKFDGLLILQARSAGPI
HSLO_ALCBS      --------------------------------------------------------KGRLALQAQGKGPV
HSLO_PSEP1      ------IFDERVRGEWVSLDDSYAAVLARHEYPQPVKVLLGELMAATALLVGAMKFDGLLILQARSAGPI
HSLO_NEIMB      -------------------------------------------------------------VQVQGRGRL
HSLO_PSEE4      -------------------------------------------------------------LQAQSQGPV
HSLO_NEIMA      -------------------------------------------------------------VQVQGQGRL
HSLO_EDWI9      ------------------------------------------------------------TVQLQGDGPL
HSLO_HAHCH      -----------IRGELLVLKKTVQDALSRHDYPQAIXXXXXXXXXXXXXXXXTLKIKGDTTLQATGEGEL
COPD_DICDI      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIGQGVLRVVRDLGLKTPFVSQVPLVSGEIAEDL
HSLO_THEMA      RRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIGQGVLRVVRDLGLKTPFVSQVPLVSGEIAEDL
HSLO_THEP1      RRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIGQGVLRVVRDLGLKTPFVSQLPLVSGEIAEDL
HSLO_THESQ      RRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIGQGVLRVVRDLGLKTPFVSQVPLVSGEIAEDL
HSLO_THEM4      KYIAAQSKNNGNVRGYILPKIVDTITNEKGKFDLKSAIGNGTLKVVRDLGLKTPYVTPIKLISGEIAEDL
HSLO_CLOCE      GGIVVVSDSKANVRGYVHNPNVYLPLNERGKLDIRTAMGYGYINVIRDMGLKEPYIGLSQLVSGEIADDL
HSLO_BACA2      GAIVADANAKGEVRAYVSNPHVHFDLNEQGKLDVRRAVGDGTLSVVKDLGLRDYFTGQVEIVSGELGDDF
HSLO_BACSU      GAIVADANAKGEVRAYVSNPQVHFDLNEQGKLDVRRAVGNGTLSVVKDLGLREFFTGQVEIVSGELGDDF
HSLO_GEOSW      GTILVDSNAKGEVRGYVTNPHVHFDLNEHGKLDVAKAVGKGMLTVVKDLGLRDFFTGQVPIISGELGEDF
HSLO_BACSK      GEIIVDAHASGATRGTVTNPHVSPELNSKGKLDVARVVGEGTLSVVKDLGMKEPFTGSVPIVSGEIGDDF
HSLO_BACCN      GPIVIDAHANGDVRGYVTNPHVDFESTEQGKLRVYQAVGEGNVTVIKDIGMREPFIGQSPIVSGELGEDF
HSLO_CLOB8      NGITVTAHSDASVKGFIGNPYVDRPLNEKGKLDVGGAIGDGILYVIKDLGLRDPYIGQVPIQTGEIAEDF
HSLO_BACST      GTILVDSNAKGEVRGYVTNPHVHFELNEHGKLDVARAVGKGMLTFVKDLGLRDFFTGQVPIISGELGEDF
HSLO_BACLD      GAIVADGNAKGDVRGYVSNPHVHFDLNEHGKLDVRRAVGSGTLSVVKDLGLRDLFTGQVEIVSGEIGEDF
HSLO_CLOPE      KGVTVTAYSDCSVKGYIGNPHVDLPLNENGKLNVGEAIGKGGLTVIKDLGLKDPYVGQVPIYSGEIAEDL
HSLO_CLOP1      KGVTVTAYSDCSVKGYIGNPHVDLPLNENGKLNVGEAIGKGGLTVIKDLGLKDPYVGQVPIYSGEIAEDL
HSLO_CLOBB      KGITVTAHNDASVKGFIGNPYVTRELNDKGKLDVGGAIGKGLLYVIKDLGLKEPYVGQVPIYSGEIAEDF
HSLO_SYNP2      GGLLVDAGPDGTVRGYVQNPGVELPPNAKGKLDVGGAVGKGFLYAVKDFGRGYPYSSTVELVSGEIGDDV
HSLO_CLOPS      KGVTVTAYSDCSVKGYIGNPHVDLPLNENGKLNVGEAIGKGGLTVIKDLGLKDPYVGQVPIYSGEIAEDL
HSLO_CLOBA      KGITITAHNDASVKGFIGNPYVTRELNDKGKLDVGGAIGKGLLYVIKDLGLKEPYVGQVPIYSGEIAEDF
HSLO_STAHJ      GRIIADADAEGNVRAYVDKPQTHFPLNEQGKLDVRRAVGDGSIQVVKDVGMKDYFSGASPIVSGELGEDF
HSLO_AQUAE      GTIVVEADAKGRVRGFVGNPNVDTYTKEKKKFDVAKIVGKGTLTVVKDLGMGKPYTSVVPLISGEIGQDI
HSLO_CLOBL      KGVVVTSYADGHVKGYIGNPTADIEPNSKGKLDVSGIIGKGNLLVIRDMGLKEPYIGQVPIYTGEIGEDL
HSLO_CLOBK      KGVVVTSYADGHVKGYIGNPTADIEPNSKGKLDVSGIIGKGNLLVIRDMGLKEPYIGQVPIYTGEIGEDL
HSLO_CLOBH      KGVVITSYADGHVKGYIGNPTADIEPNSKGKLDVSGIIGKGNLLVIRDMGLKEPYIGQVPIYTGEIGEDL
HSLO_CLOB1      KGVVITSYADGHVKGYIGNPTADIEPNSKGKLDVSGIIGKGNLLVIRDMGLKEPYIGQVPIYTGEIGEDL
HSLO_OCEIH      GAIVADADADGHVRGYVTNPHVDFDLNDKGKLDVARAVGEGNISVIKDLGLKDFFTGETPIVSGEISEDF
HSLO_CLOTE      KGVLVTAYPEGKVKGYIGNPLVHLPLNQNGKLDVGGAIGKGNITVIKDLGLKDPYIGQVPIYSGEIGDDL
HSLO_CLOB6      KGVVVTSYADGHVKGYIGNPTADIEPNSKGKLDVSGIIGKGNLLVIRDMGLKEPYIGQVPIYTGEIGEDL
HSLO_THEPX      GNIVVVSNYPGIVKGYVGNPTVDLPLSEKGKLDVGKAVGKGYVTVIKDIGLKEPYVGTVELQTGEIGEDI
HSLO_THEP3      GNIVVVSNYPGIVKGYVGNPTVDLPLSEKGKLDVGKAVGKGYVTVIKDIGLKEPYVGTVELQTGEIGEDI
HSLO_LACAC      GPAIVTATADLKVKGYVKNPHIALPPKENGHIDVKKAVGQGWFEVTKDLGLKEPYTGQVPIVSGEIAEDF
HSLO_LACBA      GAIVVDGNANGTVKGYLQYPHTSLPLNEKHKIDVKKAVGNGMLTVTKDQGLGQPYTGQVPLVSGELGEDF
HSLO_CLOBJ      KGVVVTSYADGHVKGYIGNPTADIEPNSKGKLDVSGIIGKGNLLVIRDMGLKEPYIGQVPIYTGEIGEDL
HSLO_LACF3      GFIVVDGTAQGTVKAYMQNPHVHLPLNAKGKIDVAGAVGKGTLSVTKMAGDKTPYTGEVNLVSGELGDDF
HSLO_ACAM1      QGILVDAGLDGTVRGYVTNPGVELPPNAKGKLDVGGAVGKGFLYVIRDMGYGYPYSSTVELVSGEIGEDV
HSLO_LACSS      GKIVVDGNAQGTVKGYVTNPHVNLPSNEKNKIDVKAGVGTGTLSVTKDLGLKEPFTGQVPLVSGELGEDF
HSLO_EUBR3      KGLTVTADSHGNVKGFAMNPQVELPLNAAGKLDVGGALDLGILTVIKDMGLKEPYSGQCELKTGEIAEDL
HSLO_BACHK      GPILVDAHANGDVRGYVTNPHVDFEGTEQGKLRVYQAVGEGFVTVIKDIGMREPFIGQSPIVSGELGEDF
HSLO_BACCZ      GPILVDAHANGDVRGYVTNPHVDFEGTEQGKLRVYQAVGEGFVTVIKDIGMREPFIGQSPIVSGELGEDF
HSLO_BACCQ      GPILVDAHANGDVRGYVTNPHVDFEGTEQGKLRVYQAVGEGFVTVIKDIGMREPFIGQSPIVSGELGEDF
HSLO_BACC7      GPILVDAHANGDVRGYVTNPHVDFEGTEQGKLRVYQAVGEGFVTVIKDIGMREPFIGQSPIVSGELGEDF
HSLO_BACC3      GPILVDAHANGDVRGYVTNPHVDFEGTEQGKLRVYQAVGEGFVTVIKDIGMREPFIGQSPIVSGELGEDF
HSLO_BACC1      GPILVDAHANGDVRGYVTNPHVDFEGTEQGKLRVYQAVGEGFVTVIKDIGMREPFIGQSPIVSGELGEDF
HSLO_BACC0      GPILVDAHANGDVRGYVTNPHVDFEGTEQGKLRVYQAVGEGFVTVIKDIGMREPFIGQSPIVSGELGEDF
HSLO_BACAN      GPILVDAHANGDVRGYVTNPHVDFEGTEQGKLRVYQAVGEGFVTVIKDIGMREPFIGQSPIVSGELGEDF
HSLO_BACAH      GPILVDAHANGDVRGYVTNPHVDFEGTEQGKLRVYQAVGEGFVTVIKDIGMREPFIGQSPIVSGELGEDF
HSLO_BACAC      GPILVDAHANGDVRGYVTNPHVDFEGTEQGKLRVYQAVGEGFVTVIKDIGMREPFIGQSPIVSGELGEDF
HSLO_BACAA      GPILVDAHANGDVRGYVTNPHVDFEGTEQGKLRVYQAVGEGFVTVIKDIGMREPFIGQSPIVSGELGEDF
HSLO_CLOBM      KGVVVTSYADGHVKGYIGNPTADIDPNSKGKLDVSGIIGKGNLLVIRDMGLKEPYIGQVPIYTGEIGEDL
HSLO_BACP2      XXXXXXXXXKGQVRGYVSNPQVHFDLNEHGKLDVRRAVGSGTLSVVKDIGLKDHFTGQTEIVSGEIGDDF
HSLO_BACCR      GPILVDAHANGDVRGYVTNPHVDFEGTEQGKLRVYQAVGEGFVTVIKDIGMREPFIGQSPIVSGELGEDF
HSLO_BACC4      GPILVDAHANGDVRGYVTNPHVDFEGTEQGKLRVYQAVGEGFVTVIKDIGMREPFIGQSPIVSGELGEDF
HSLO_ENTFA      GAIIVDSNGRGETKGYIKNPHVSLKLNATGKIDVRGAVGEGIFTVIKDLGLKETFSGQTPIVSGEIGEDF
HSLO_BACC2      GPILVDAHANGDVRGYVTNPHVDFEGTEQGKLRVYQAVGEGFVTVIKDIGMREPFIGQSPIVSGELGEDF
HSLO_BACWK      GPILVDAHANGDVRGYVTNPHVDFEGTEQGKLRVYQAVGEGFVTVIKDIGMREPFIGQSPIVSGELGEDF
HSLO_LACH4      GPTIVTAMSDLKVKGYVKNPHIALSPKKNGHIDVKKAVGQGMLEVTKDLGLKEPYTGQVPIVSGEIAEDF
HSLO_CLOTH      XXXXXXXXSSANVKGYVHNPLVYLPLNSQGKYDVAGAVGNGYLNVIKDLGLREPYVGHVDLVSGEIAEDI
HSLO_CLOAB      KSVTVTSYSDAHVKGYIANPNADLPVNSQGKLDVGGIIGKGNLLVIRDMGLKEPYVGQVPIYTGEIGDDI
HSLO_LACC3      GALVTDGTNVGTVRGYVEEPHVNLPLNLVGKIDVARAVGKGLLAVTKDIGVGDPFTGQVPLVSGELAEDF
HSLO_TRIEI      GEVLVDAGLDGTVRGYVNNPTIELLPNKIGKHDIGKAVGQGYLYIVRDIGYGYPYSGTVELVSGEIGDDI
HSLO_STACT      GRIVADADAKGDIRGYVTNPQTHFPLNDQGKLDVRRAVGDGTLTVVKDVGLKDYFSGSSPIVSGELGDDF
HSLO_LACCB      GALVTDGTNVGTVRGYVEEPHVNLPLNLVGKIDVARAVGKGLLAVTKDIGVGDPFTGQVPLVSGELAEDF
HSLO_GEOKA      GVILVDSNARGEVRGYVTNPHVHFELNEHGKLDVARAVGKGMLTVVKDLGLRDFFTGQVPLISGELGDDF
HSLO_LISIN      GPIVADSNAQGQIRGYVTNPHVHFSLNEAGKLDVRRGVGSGMLSVVKDLGFGENFTGQTPIVSGEIGEDF
HSLO_LISMO      GPIVADSNAQGQIRGYVTNPHVHFSLNEAGKLDVRRGVGSGMLSVVKDLGFGENFTGQTPIVSGEIGEDF
HSLO_LISMH      GPIVADSNAQGQIRGYVTNPHVHFSLNEAGKLDVRRGVGSGMLSVVKDLGFGENFTGQTPIVSGEIGEDF
HSLO_LISMF      GPIVADSNAQGQIRGYVTNPHVHFSLNEAGKLDVRRGVGSGMLSVVKDLGFGENFTGQTPIVSGEIGEDF
HSLO_LISMC      GPIVADSNAQGQIRGYVTNPHVHFSLNEAGKLDVRRGVGSGMLSVVKDLGFGENFTGQTPIISGEIGEDF
HSLO_DESPS      GKIITEASPDGWCRGYIANPHAELPL-LNGRLDVAGGVGHGLLSVTKDIGMKQKYQGTSHLVSSEIGEDI
HSLO_STAES      GRIIADADAQGNVRAYVDHPQTHFPLNDQGKLDVRRAVGDGSIQVVKDVGMKDYFSGASPIVSGELGDDF
HSLO_STAEQ      GRIIADADAQGNVRAYVDHPQTHFPLNDQGKLDVRRAVGDGSIQVVKDVGMKDYFSGASPIVSGELGDDF
HSLO_THETN      GSIVVVSNFPGIVKGYVGNPFVDLPLSEKGKLDVGRAVGKGYVTVIKDIGLKEPYIGTVEIQTGEIGDDI
HSLO_ANASP      AGILVDAGLDGTVRGYVGNPHIELPPNAKGKLDVGGAVGNGYLYVVRDIGYGYPYSSTVELVSGEIGDDV
HSLO_THEYD      NEVVAEADSFYRVRAYVKRPHIYMGLKNE-KIDVGRGVGKGFLNVIRDLGLREYYQSSVELQTGEIARDL
HSLO_CYAP4      EGLFVDAGCDGTVRGYVYNPAIELPPNAKGKLDVGGAVGQGYLYVIRDLGYGYPYSSTVELVSGEIAEDI
HSLO_CLOD6      XXXXATSDSKGMVKGYVGNPQVEVEDYPNGKLNVAAAVGEGVVKVIKDLGLREPYNGTYPLVSGEIAEDF
HSLO_STRSV      GAIITVADTEGNVKGYVQNPGVDIKKTATGEVLVGPFVGQGEFLVITDYGTGNPYNSMTPLISGEIGEDL
HSLO_THEEB      GTIFADAGADGTVRGYVQYPSVELPPNAKGKLDVGAAVGQGYLYVIHDLGYGYPYSSTVELVSGEIAEDI
HSLO_STRGC      GAIITVADTEGNVKGYVQNPGVDIKKTATGEVLVGPFVGQGEFLVITDYGTGNPYNSMTPLISGEIGEDL
HSLO_LACJO      GATIVTAKADLTIKGYIQNPHIALPPKKDGHIDVAKAVGKDWLEVTKDQGLKEPYTGQVPIVSGEIAEDF
HSLO_DESRM      GAIIVTSNAKGEVRGYVQEPQIHLPSTPEXXXXXXXXXXXXXXXITKDLGLKEPFTGSVELVSGEIAEDF
HSLO_CLOPH      GGLTVTADAGANVKGYANQNVVNLPPSPKGKLDVGKALDIGVLSVIKDMGLKEPYVGQTDLVTGEIAEDL
HSLO_STRTD      GHIISVADTKGHVKGYIQNPGVDIKKTATGEVLVGPFMGQGQFVSIIDYGTGNPYTSSTPLISGEIGEDF
HSLO_STAAW      GRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGNGSIMVVKDVGMKDYFSGASPIVSGELGEDF
HSLO_STAAT      GRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGNGSIMVVKDVGMKDYFSGASPIVSGELGEDF
HSLO_STAAS      GRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGNGSIMVVKDVGMKDYFSGASPIVSGELGEDF
HSLO_STAAR      GRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGNGSIMVVKDVGMKDYFSGASPIVSGELGEDF
HSLO_STAAE      GRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGNGSIMVVKDVGMKDYFSGASPIVSGELGEDF
HSLO_STAAC      GRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGNGSIMVVKDVGMKDYFSGASPIVSGELGEDF
HSLO_STAAB      GRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGNGSIMVVKDVGMKDYFSGASPIVSGELGEDF
HSLO_STAA8      GRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGNGSIMVVKDVGMKDYFSGASPIVSGELGEDF
HSLO_STAA3      GRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGNGSIMVVKDVGMKDYFSGASPIVSGELGEDF
HSLO_LACPL      XXXXXXXXAKGTVKGYLQHPHVHLPLNDKHKIDVKAAVGDGFLSVTKDQGVGDPFTGTVALVSGELGEDF
HSLO_STRT1      GHIISVADTKGHVKGYIQNPGVDIKKTATGEVLVGPFMGQGQFVSIIDYGTGNPYTSSTPLISGEIGEDF
HSLO_STAAN      GRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGNGSIIVVKDVGMKDYFSGASPIVSGELGEDF
HSLO_STAAM      GRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGNGSIIVVKDVGMKDYFSGASPIVSGELGEDF
HSLO_STAA9      GRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGNGSIIVVKDVGMKDYFSGASPIVSGELGEDF
HSLO_STAA2      GRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGNGSIIVVKDVGMKDYFSGASPIVSGELGEDF
HSLO_STAA1      GRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGNGSIIVVKDVGMKDYFSGASPIVSGELGEDF
HSLO_LACDA      GAAVVTAKSDLTVKGYVQNNHVALPAREDGHIDVKKAVGKGWLQVTKDLGLKQPYTGEVPIVSGEIAEDL
HSLO_CLONN      KGVTVTSYANANVKGYIGNPSVDLEANALGKLDVGGAIGKGSLLVIRDFGLKEPYVGNVPIYTGEVGDDI
HSLO_STRT2      GHIISVADTKGHVKGYIQNPGVDIKKTATGEVLVGPFMGHGQFVSIIDYGTGNPYTSSTPLISGEIGEDF
HSLO_LACDB      GAAVVTAKSDLTVKGYVQNNHVALPAREDGHIDVKKAVGKGWLQVTKDLGLKQPYTGEVPIVSGEIAEDL
HSLO_LACLA      GPIIAVADSRGHVKGYVKNRKLDYKKASTGEVLVAPFVGNGFLVVVKDMGLKQPYSGQVDLITGEIGEDL
HSLO_SYNY3      XXXXXXXXXXXTVRGYVQNPSVELAPNAQGKLDVGGAVGQGFLYVVRDVGFGYPYSSTVELVSGEIGEDV
HSLO_STAS1      GKVIADADAKGNVRGYVTNPQTHFPLNDHGKLDVSRAVGNGSLTVVKDVGLKDYFSGSSPLVSGELGDDF
HSLO_BACHD      GAIIVDSQANGQTRGYVKNPHVHFELNEHGKLDVARAVGNGSLSVVKDIGLRDHFTGSVPLVSGELGEDF
HSLO_LACLM      GPIIAVADSKGHVKGYVKNRELDYKKASTGEVLVAPFVGNGFLVVVKDMGLKQPYSGQVDLITGEIGEDL
HSLO_GEOMG      KNILVEADANGAVRGCVGNPEAN-PLREDGKLDVAAAIGQGLLTVTKDLGLKEPYTGTVLLYTSEIAEDL
HSLO_LACLS      GPIIAVADSKGHVKGYVKNRELDYKKASTGEVLVAPFVGNGFLVVVKDMGLKQPYSGQVDLITGEIGEDL
HSLO_PROM2      KGLLVDAGRDGKVRGYVGNPDLELDLSNKYSFDFKNALGTGYLNVIRDSGIGEPFTSTVELVNGNIAEDL
HSLO_CYAP7      XXXXXXXXXXXTVRGYVGNPSVELPPNAKGKLDVGGAVGRGYLYVVRDVGYGYPYSSTVELVSGEVGDDV
HSLO_ALKMQ      XXXXXXXDSEGNVKGYVGNPQVESTNIRPGKLDVGAAVGSGEITVIKDLGMKKPYVGTAPLVSGEIGEDF
HSLO_CYAP8      XXXXXXXXXXXTVRGYVDCPFVELPPNARGKLDVGGAIGEGYLYVVRDVGYGYPYSSTVELISGEVGDDV
HSLO_BREBN      GQIMAEANAHGEGIAYVSNPHVHFELNDKGKLDVARAVGDGFVYVTKDLGLKEPYQGSAPIVSGEIGEDF
HSLO_FINM2      XMLISTVNGRGEVKSYVSHPEVDLPTKSNKKLDVGSFVGEGLLTVIKDFKLKEPYIGQTSLVSGEIAEDF
HSLO_LISW6      GPIVADSNAQGQIRGFVTNPHVHFELNEAGKLDVRRGVGSGMLSVVKDLGFGENFTGQTPIVSGEIGEDF
HSLO_PROMS      KGLLVDAGRDGKVRGYVGNPNLELDLNDKYSFDFTKALGTGYLNVIRDSGFGEPFTSTVELVNGNIAEDL
HSLO_STRPS      GAIITVADTKGNVKGYVQNPGVDIKKTATGEVLVGPFVGNGQFLVITDYGTGNPYNSITPLISGEIGEDL
HSLO_STRZT      GAIITVADTKGNVKGYVQNPGVDIKKTATGEVLVGPFVGNGQFLVITDYGTGNPYNSITPLISGEIGEDL
HSLO_STRZP      GAIITVADTKGNVKGYVQNPGVDIKKTATGEVLVGPFVGNGQFLVITDYGTGNPYNSITPLISGEIGEDL
HSLO_STRZJ      GAIITVADTKGNVKGYVQNPGVDIKKTATGEVLVGPFVGNGQFLVITDYGAGNPYNSITPLISGEIGEDL
HSLO_STRR6      GAIITVADTKGNVKGYVQNPGVDIKKTATGEVLVGPFVGNGQFLVITDYGTGNPYNSITPLISGEIGEDL
HSLO_STRPN      GAIITVADTKGNVKGYVQNPGVDIKKTATGEVLVGPFVGNGQFLVITDYGTGNPYNSITPLISGEIGEDL
HSLO_STRPJ      GAIITVADTKGNVKGYVQNPGVDIKKTATGEVLVGPFVGNGQFLVITDYGTGNPYNSITPLISGEIGEDL
HSLO_STRPI      GAIITVADTKGNVKGYVQNPGVDIKKTATGEVLVGPFVGNGQFLVITDYGTGNPYNSITPLISGEIGEDL
HSLO_STRP7      GAIITVADTKGNVKGYVQNPGVDIKKTATGEVLVGPFVGNGQFLVITDYGTGNPYNSITPLISGEIGEDL
HSLO_STRP4      GAIITVADTKGNVKGYVQNPGVDIKKTATGEVLVGPFVGNGQFLVITDYGAGNPYNSITPLISGEIGEDL
HSLO_STRP2      GAIITVADTKGNVKGYVQNPGVDIKKTATGEVLVGPFVGNGQFLVITDYGTGNPYNSITPLISGEIGEDL
HSLO_GEOBB      KKIVIEADANGSVRGYVGDPKVHL-LRPDGALDVNNALGRGFLTVAKDLGLKEPYRGTVQLYTSGIAEDL
HSLO_STRMU      GHIISVADTKGNVKGYIQNAGVDVKKTASGEVIVGPFMGNGQFVVITDYGTGNPYTSSTPLVSGEIGEDL
HSLO_STREM      GHIISVADTKGHVKGYIQNPGVDIKKTATGEVLVGPFMGQGHFVTITDYGTGNPYTSTTPLITGEIGEDL
HSLO_PROM0      KGLLVDAGRDGKVRGYVGNPDLELDLSNKYSFDFTKALGTGYLNVIRDSGIGEPFTSTVELVNGNIAEDL
HSLO_GEOSM      KKIVIEADANGSVRGYVGDPKVHL-LRPDGALDVNNALGRGFLTVAKDLGLKEPYRGTVQLYTSGIAEDL
HSLO_PROM9      KGLLVDAGRDGKVRGYVGNPDLELDLNNKYSFDFTKALGTGYLNVIRDSGIGEPFTSTVELVNGNIAEDL
HSLO_STRE4      GHIISVADTKGHVKGYIQNPGVDIKKTATGEVLVGPFMGQGHFVTITDYGTGNPYTSTTPLITGEIGEDL
HSLO_STRP9      GHIISVADTKGHVKGYIQNTGVDIKKTETGEVLVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDF
HSLO_PROM5      KGLLVDAGRDGKVRGYVGNPNLELDLSNKYSFDFTKALGTGYLNIIRDNGFGEPFTSTVELVNGNIAEDL
HSLO_SYNJA      GGIYVDAGMDGTVRGYVSNPAIELPLTPESKLDVGQAVGRGYLHVLRDLGYGQPYTSAVELVSGEVGDDI
HSLO_PROMP      KGLLVDAGRDGKVRGYVGNPNLELDLQNQYSFDFTKALGTGYLNVIRDNGFGEPFTSTVELVNGNIAEDL
HSLO_STRS7      GHIISVADTKGHVKGYIQNPGVDIKKTATGEVLVGPFMGQGHFVTITDYGTGNPYTSTTPLITGEIGEDL
HSLO_STRPC      GHIISVADTKGHVKGYIQNTGVDIKKTATGEVLVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDF
HSLO_STRPB      GHIISVADTKGHVKGYIQNTGVDIKKTATGEVLVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDF
HSLO_STRA1      GHIISVADTKGNVKGYIQNTGVDIKKTATGEVLVGPFMGNGHFVVITDYGTGQPYTSTTPLITGEIGEDF
HSLO_SYNS9      KGLMVDAGRDGTVRGYVGEPALELPISEKGNFNFKAAAGTGYLHVMRDDGKGEPFNSTVELVGGAIGEDV
HSLO_STRPZ      GHIISVADTKGHVKGYIQNTGVDIKKTATGEVLVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDF
HSLO_THET2      GGLVVEADAFGHVRGYVKNPRAEVPLREDGKLNVGELVGAGALRVDRSLPSGEVYTSTVPLVSGEIAEDL
HSLO_STRPM      GHIISVADTKGHVKGYIQNTGVDIKKTATGEVLVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDF
HSLO_STRPG      GHIISVADTKGHVKGYIQNTGVDIKKTATGEVLVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDF
HSLO_STRPF      GHIISVADTKGHVKGYIQNTGVDIKKTATGEVLVGPFMGNGHFVTIIDYGTGNPYASTTPLITGEIGEDF
HSLO_STRP8      GHIISVADTKGHVKGYIQNTGVDIKKTATGEVLVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDF
HSLO_STRP1      GHIISVADTKGHVKGYIQNTGVDIKKTATGEVLVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDF
HSLO_CARHZ      GGIVCSAGNDGMVRGYLFNPEVELPLNDANKLDVGRGIGKGHLYVTKDLGLKEPYTGTVQLVSGEIAEDV
HSLO_STRPD      GHIISVADTKGHVKGYIQNTGVDIKKTATGEVLVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDF
HSLO_STRU0      GHIISVADTKGHVKGYIQNTGVDIKKTATGEVLVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDF
HSLO_GEOSL      KKIIVEADANGAVRGLVRNPAVSL-LRDDGKLDVAGALGKGFLTVSRDLGLKEPYTGTVMLYTSEIAEDL
HSLO_ACHLI      GQMTVEAKNG-VVRSTILNPNVYLVYGEMGKLNVGAAVGAGTLSVTKDWK-ENYFTSSSPLQTGEIGDDF
HSLO_STRA5      GHIISVADTKGNVKGYIQNTGVDIKKTATGEVLVGPFMGNGHFVVITDYATGQPYTSTTPLITGEIGEDF
HSLO_STRA3      GHIISVADTKGNVKGYIQNTGVDIKKTATGEVLVGPFMGNGHFVVITDYATGQPYTSTTPLITGEIGEDF
HSLO_SYNP6      GGLMVDAGLDGTVRGYVEHPAIEIEPNTQGLPDVGRAIGPGYLHVMRDVGYGQPYTSTVELVNGEIGDDV
HSLO_SYNE7      GGLMVDAGLDGTVRGYVEHPAIEIEPNTQGLPDVGRAIGPGYLHVMRDVGYGQPYTSTVELVNGEIGDDV
HSLO_STRP3      GHIISVADTKGHVKGYIQNTGVDIKKTATGEVLVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDF
HSLO_SYNSC      KNLMVDAGRNGTVRGYVGEPALELPIQDEASFNFKEAAGTGYLHVMRDDGKGEPFNSTVELVSGGIGEDV
HSLO_STRP6      GHIISVADTKGHVKGYIQNTGVDIKKTATGEVLVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDF
HSLO_SYNJB      GNIWVDAGLDGTVRGYVSNPAIELPLTAESKLDVGQAVGRGYLHVLRDLGYGQPYTSAVELVSGEVGDDI
HSLO_STRSY      GAIISVANTKGQVKGYIQNPDLDYKRTATGEVIVGPLVGNGQFLVITDYGTGHPYNSMTPLISGEIGEDF
HSLO_STRS2      GAIISVANTKGQVKGYIQNPDLDYKRTATGEVIVGPLVGNGQFLVITDYGTGHPYNSMTPLISGEIGEDF
HSLO_ALKOO      XXXXXXXXSKGIVKGYVSHPHVEGSNLYPGKLDVGSAVGDGTITVVKDLGLKEPYIGTYPLSTGEIAEDF
HSLO_PELPD      RKMIVEADSDGAVRASVANPTAEAPL--EGRWNVAGVLGRGFLTVSKDLGLGQPYQGTVQLCSSEIGDDL
HSLO_PELCD      KKLHAETDALGQVRGSVKEPISGIAPTETG-FDVPAAIGRGFLHVVKDLGLKEPYRGMVQLYSSEVAEDL
HSLO_GEOLS      KKLIAEVEWDGAIRGTVAVPDAVAE-------SVPAALGRGFLTVTRDLGMKDPYTGMVQLYTSEIAEDL
HSLO_ANAVT      AGILVDAGLDGTVRGYVGNPHIELPPNARGKLDVGGAVGNGYLYVVRDIGYGYPYSSTVELVSGEIGDDV
HSLO_THET8      GGLVVEADAFGHVRGYVKNPRAEVPLREDGKLNVGELVGAGALRVDRSLPSGEVYTSTVPLVSGEIAEDL
HSLO_PROM1      KGLTIDAGRDGSVRGYVGDPSLELDLIKNKSFDFKKATGIGYLHVIRDDGKGEPHNSTVELINGGIGEDI
HSLO_GLOVI      GGILVDAGADGTVRGYVKNPQVELPPSPKGKLDVGRAVGNGFLYVVKDLGYGYPFSGTTELVSGEIGDDV
HSLO_PROMT      KGLTIDAGRDGSVRGYVGDPSLELDLIKNKSFDFKKATGIGYLHVIRDDGKGEPHNSTVELINGGIGEDI
HSLO_DEIRA      GWIVAEGSTDGRLRGYVRQPEADLPPRESGKLDVRGIVGDGELAVTRLLDNGEPYTGSVRLQSGEIAEDV
HSLO_SYNS3      GGLFVDAGRDGRVRGYVGHPELELPIEDEASFDFNAAAGTGYLHVVRDEGKGEPFSSTVELVRGGIGEDV
HSLO_SYNPW      RGLSVDAGRDGRVRGYVGNPGLELDANGQAGFDFTSAAGTGYLHVVRDEGKGEPFSSTVELVSGCIGDDV
HSLO_SYMTH      RGILCDADEQGHVRGYVTEPHVDLEPAARGKLNVGAAVGTGMLYVTRQLALQGIYTGSSELVSGEIAEDL
HSLO_PROM4      KGLTVDACRDGSVRGFLGNPSLELDLVKSKEFDFANATGKGYLHVIRDIGEGDPYSSTVELVGGGIGEDI
HSLO_SYNR3      KGLSVDAGRDGRVRGYVGNPSLELDLGDPASFDFKQALGTGYLNVMRDEGQGPPYSSTVELVSGCIGEDV
HSLO_NOSP7      GGILVDAGLDGTVRGYVGNPSIELPPNXXXXXXXXXXXXXXXXXXXRDVGYGYPYSSTVELVSGEIGDDV
HSLO_PROMA      QGLNVDAGRDGTVRGYVGNPSLELDLIKTSQFDFKKATGKGYLHVTRDIGKGEPFTSTVXXXXXXXXXXX
HSLO_SYNPX      RGLMVDAGRDGTVRGYVGDNTLELDADGNHSFNFKAAAGTGYLHVMRDDGKGEPFNSTVELVSGGIGDDV
HSLO_MICAN      XXXXXXXXXXXXXRGYVDYPQVELLPNAQGKLDVGRAVGKGYVRVLREEGRNELQESIVEIVSGEVGEDI
HSLO_TERTT      PLIVADCTNDGDLRGIIELGEHQ-PLPDYSGLTLPELIGDGVLSLTVDPEHGQRYQGLVPLEGDTLADCL
HSLO_HAEDU      KLAVVNGNEKQQLR---ALARVQAEIDDQAS--LAEMVGNGVLVISIIPTEGERYQGVIQLDKPTIRECL
HSLO_CHRVO      KLAVVECNNDRTVR---ATAKWDGDLDGKPLKALLGEGGKFVLTLEPRLDKNQTWQGIVALEGDSVGQML
HSLO_SHESW      SLAVINGNNLQQLRG-VARWNGELTDNAS----LADLFGQGYMVITLTPDEGERYQGVVALDKPTLAACV
HSLO_SHEPC      SLAVINGNNLQQLRG-VARWNGELTDNAS----LADLFGQGYMVITLTPDEGERYQGVVALDKPTLAACV
HSLO_PECCP      KLAVINGNHQQQMRG-VARLQGDIAPGSSLK----EMVGNGYLVITITPTEGERYQGVVGLEGETVAECL
HSLO_HAES2      KLLLVNGSDSQQIRAL-----ARLQDDVYDDITLSELVGNGILVITIAPTNGERYQGVIALDKPTIAECL
HSLO_HAEIN      RLALVNGNDQQQIR---ALARVDGNITEN--MSLHNMIGKGVLVITIAPKEGERYQGVISLDKPTITECL
HSLO_HAEIG      RLALVNGNDQQQIR---ALARVDGNITEN--MSLHNMIGKGVLVITIAPKEGERYQGVISLDKPTITECL
HSLO_HAEI8      RLALVNGNDQQQIR---ALARVDGNITEN--MSLHNMIGKGVLVITIAPKEGERYQGVISLDKPTITECL
HSLO_ERWCT      KLAVINGNHLQQMRG-VARLQGDIAPGSSLK----EMVGNGYLVITITPTDGERYQGVVGLEGETVAECL
HSLO_HAES1      KLLLVNGSDSQQIRAL-----ARLQDDVYDDMTLSELVGNGILVITIAPTNGERYQGVIALDKPTIAECL
HSLO_HAEIE      RLALVNGNDQQQIR---ALARVDGNITEN--MSLHNMIGKGVLVITIAPKEGERYQGVISLDKPTITECL
HSLO_ACTP7      KLAVVNGNEKQQLRA-LARTQAEIADNAS----LSEMIGNGVLVISIMPNDGERYQGVIALDKPTIRECL
HSLO_SHELP      SLAVINGNNLQQLRG-VARWEGEVAKDAS----LQQLMGQGHMVITLTPNNGERYQGVVALEKETLAECL
HSLO_SALTI      SLAVINGNNQQQMRG-VARVQGDIPDNA----DLKTLVGNGYLVITITPEEGERYQGVVGLEGDTLAACL
HSLO_SHESA      SLAVINGNNQQQLRG-IARWEGELADDAS----LADLFGQGYMVITLTPDEGERYQGVVALDKPTLAACV
HSLO_ACTPJ      KLAVVNGNEKQQLRA-LARTQAEIADNA----SLSEMIGNGVLVISIMPNDGERYQGVIALDKPTIRECL
HSLO_SHEDO      SLAVINGNNELQLRG-VARWKGELAKDAS----LPTLLGKGYMVITLTPDEGERYQGIVSLEHGTLAACL
HSLO_SALPK      SLAVINGNNQQQMRG-VARVQGDIPDNA----DLKTLVGNGYLVITITPEEGERYQGVVGLEGDTLAACL
HSLO_SALPA      SLAVINGNNQQQMRG-VARVQGDIPDNA----DLKTLVGNGYLVITITPEEGERYQGVVGLEGDTLAACL
HSLO_PHOLL      KLAVINGNHQQQMRGVA---RIDGLVAENSSLKQMVGTGYMVITITPTHGER--YQGVVALEGETLADCL
HSLO_ACTP2      KLAVVNGNEKQQLRA-LARTQAEIADNA----SLSEMIGNGVLVISIMPNDGERYQGVIALDKPTIRECL
HSLO_SHEB9      SLAVINGNNLQELRG-VARWNAELA-DDASLTDLFGQ-GYMVITLTPDEGER--YQGVVALDKPTLAACV
HSLO_SHEB8      SLAVINGNNLQELRG-VARWNAELA-DDASLTDLFGQ-GYMVITLTPDEGER--YQGVVALDKPTLAACV
HSLO_SHEB5      SLAVINGNNLQELRG-VARWNAELA-DDASLTDLFGQ-GYMVITLTPDEGER--YQGVVALDKPTLAACV
HSLO_SHEB2      SLAVINGNNLQELRG-VARWNAELA-DDASLTDLFGQ-GYMVITLTPDEGER--YQGVVALDKPTLAACV
HSLO_SALTY      SLAVINGNNQQQMRG-VARVQGDIPDNA----DLKTLVGNGYLVITITPEEGERYQGVVGLEGDTLAACL
HSLO_SALCH      SLAVINGNNQQQMRG-VARVQGDIPDNA----DLKTLVGNGYLVITITPEEGERYQGVVGLEGDTLAACL
HSLO_ALISL      SLVVINGDNDQKVRG-VARFEGEIADDAT----LHQLMGKGYLVITISPKDGERYQGVVALEGKDLAECF
HSLO_SHESR      SLAVINGSNQQQLRG-IARWDGELADDAS----LADLFGQGYMVITLTPDEGERYQGVVALDKPTLAACV
HSLO_SHESM      SLAVINGSNQQQLRG-IARWDGELADDAS----LADLFGQGYMVITLTPDEGERYQGVVALDKPTLAACV
HSLO_ENT38      NMAVINGNNQQQMRG-VARVQGEVPEGA----DLKTLVGNGVITITPDEGER--YQGVVGLEGDTLAECL
HSLO_AERS4      RLAVINGDNNQQLRG-VARYEGELPSD--GKLQSLIGNGQLIITITPEQGER--YQGIIALDADTLAGCL
HSLO_SHEON      SLAVINGNNLQQLRG-IARWDGELADDAS----LADLFGQGYMVITLTPDEGERYQGVVALDKPTLAACV
HSLO_ESCF3      SLAVINGNNKQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_PHOPR      RLAVINGDHEQKMRG-VARWEGEVPTDGT----IHDVIGKGHLVITITPTKGDRYQGVVGLEGDTLAESL
HSLO_CHRSD      RLLMAESNPGGELRA-IARLDDEAALPEENA-SLTALVGEAQIVITLDPRDGQRYQGIVAVEADTLAACL
HSLO_SERP5      KLAVINGNNRQEMRG-VARVQSEIADDST----LHQMIGNGVMVITIAPTEGERYQGVVALEGETLAECL
HSLO_SHISS      NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_SHIFL      NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_SHIF8      NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_SHIDS      NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_SHEWM      SLAVINGNNLQQLRG-VARFKGELSSDG----DLQQLFGKGHMVITLTPTEGERYQGVVALDKPTLAGCL
HSLO_PSEF5      PLLMIECSSEREIRGLARYDAEQIAPDAT----LADLMPNGVLALTVDPTNGQRYQGIVDLDGTNLAECF
HSLO_ECOSM      NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_ECOLU      NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_ECOLI      NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_ECOL6      NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_ECODH      NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_ECOBW      NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_ECO8A      NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_ECO81      NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_ECO57      NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_ECO55      NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_ECO45      NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_ECO27      NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_CAUCR      RYVVVDYDTSGGLRGYCRFDPEEVAAVSEG-FVRPGALGGGVFIMTLDQGPDMDRYQGVTPIEGELALCA
HSLO_CAUCN      RYVVVDYDTSGGLRGYCRFDPEEVAAVSEG-FVRPGALGGGVFIMTLDQGPDMDRYQGVTPIEGELALCA
HSLO_VIBFM      SLAVINGDNNQKVRGVA---RFEGDIAEDATLHQLMGRGYLVITITPKDGER--YQGVVALEGENLAQCF
HSLO_VIBF1      SLAVINGDNNQKVRGVA---RFEGDIAEDATLHQLMGRGYLVITITPKDGER--YQGVVALEGENLAQCF
HSLO_ECO7I      SLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_ACTSZ      KLALVNGTDSQQIRA-LARLQGEI----SDDMTLHQMIGKGVLVITIAPEEGERYQGVVTLDKPTITECL
HSLO_SHEPW      SLAVINGNNLQQLRGV---SRWDGDIAADAQLQSLFGKGHMVITLTPDDGER--YQGVVALDKETLSECL
HSLO_ENTS8      TLAVINGNNRQQMRG-VARVQGDVPADA----DLKTLVGNGYLVITITPEEGERYQGVVGLEGDTLAACL
HSLO_SHIBS      NLAVINGNNNQQMRG-VARVQGEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
HSLO_PSEPF      PLLMIECSSEREIRGLARYHAEQIPADAT----LGDLMPNGVLALTVDPIAGQRYQGIVDLDGETLSDCF
HSLO_PSEA7      PLLMVECSSDRQVRG-LARYSAEAIGAGAGMQEL---MPEGVLTLTVDPVKGQRYQGIVALEGVNLAECL
HSLO_PSEA6      NYAVINGTHDQQLRGVARESLAELPT------DFSQLFTKGILVITITPEDGERYQGMVALDKPTLAECI
HSLO_SHESH      SLAVINGNNLQQLRG-VARWDGEL----SDGATLQQLFGKGHMVITLTPAKGERYQGVVALDKDSLAACL
HSLO_NITOC      QTLVAQATHHRTLRG-LARWDGDVPHGS-----LSETYGSGRLALTIQTEGKNPYQGIVSLEGVNLAEAL
HSLO_VIBPA      SLAVINGDHNQQVRG-VARWEGDIADDAS----LHEMMGKGYLVITIEPKKGERYQGVVGLEGENLTEVL
HSLO_SODGM      RLAVINGDDRQNMRGLAC-------INGDIADDLAQMVGNGYLVITLTPAEGERYQGVVGLEGPRLADCL
HSLO_NEIG2      KMLVAEATSDRTVRATARWDETAEIADDESLGDLLGGNGVFVLTLQPKDG--EPWQGVVPLEGGSIAQML
HSLO_NEIG1      KMLVAEATSDRTVRATARWDETAEIADDESLGDLLGGNGVFVLTLQPKDG--EPWQGVVPLEGGSIAQML
HSLO_PROMH      RLVVINGNNEQQMRGVA-----RFSDDVKAGSSLKEMMGNGFM-VITITPKKGERYQGIVALDGETIEAI
HSLO_YERPS      TLAVINGNNRQEMRG-VARVKGEI----SDDSTLQEMVGNGYLVITITPAQGERYQGVVALEGETIAACL
HSLO_YERPP      TLAVINGNNRQEMRG-VARVKGEI----SDDSTLQEMVGNGYLVITITPAQGERYQGVVALEGETIAACL
HSLO_YERPN      TLAVINGNNRQEMRG-VARVKGEI----SDDSTLQEMVGNGYLVITITPAQGERYQGVVALEGETIAACL
HSLO_YERPG      TLAVINGNNRQEMRG-VARVKGEI----SDDSTLQEMVGNGYLVITITPAQGERYQGVVALEGETIAACL
HSLO_YERPE      TLAVINGNNRQEMRG-VARVKGEI----SDDSTLQEMVGNGYLVITITPAQGERYQGVVALEGETIAACL
HSLO_YERPB      TLAVINGNNRQEMRG-VARVKGEI----SDDSTLQEMVGNGYLVITITPAQGERYQGVVALEGETIAACL
HSLO_YERPA      TLAVINGNNRQEMRG-VARVKGEI----SDDSTLQEMVGNGYLVITITPAQGERYQGVVALEGETIAACL
HSLO_YERP3      TLAVINGNNRQEMRG-VARVKGEI----SDDSTLQEMVGNGYLVITITPAQGERYQGVVALEGETIAACL
HSLO_PSEHT      KYAVINGDDKQNMRG-IARLQSEVTGST-----VKELIGQGYMVITITPTKGERYQGIVPLEHETLSECI
HSLO_SHEFN      SLAVINGNNKQVLRGVARNGDIAADASLQQMFGK----GYMVITLTPDEGER--YQGIVSLDHVNLAACL
HSLO_PSEAB      PLLMVECSSDRQVRG-LARYSAESIGADAGMQEL---MPEGVLTLTVDPVKGQRYQGIVALEGVNLAECL
HSLO_VIBVY      SLAVINGDNEQKIRG-VARWEGHIA-DDATLHDM---MGKGYMVITIEPKKGERYQGIVGLEGDNLEQVL
HSLO_VIBVU      SLAVINGDNEQKIRG-VARWEGHIA-DDATLHDM---MGKGYMVITIEPKKGERYQGIVGLEGDNLEQVL
HSLO_PSEFS      PMLMIECSSEREIRGLARYEADQIAPDAT----LSDLMANGVLAITVDPTEGQRYQGIVDLDGETLSDCF
HSLO_PSEAE      PLLMVECSSDRQVRG-LARYSAESIGADAGMQEL---MPEGVLTLTVDPVKGQRYQGIVALEGVNLAECL
HSLO_PSEA8      PLLMVECSSDRQVRG-LARYSAESIGADAGMQEL---MPEGVLTLTVDPVKGQRYQGIVALEGVNLAECL
HSLO_PSEPW      PLLMVECSGERDIRGMARYEADQIAADAT----LAQLMPDGHLTLTIDPVKGQRYQGTVELDGKNLSECF
HSLO_YERPY      TLAVINGNNRQEMRG-VARVKGEI----SDDSTLQEMVGNGYLVITITPAQGERYQGVVALEGETIAACL
HSLO_VIBHB      SLAVINGDHDQKIRG-VARWEGDIA-DDASLHDM---MGKGYLVITIEPKKGERYQGVVGLEGETLADVI
HSLO_VIBCH      SLVVINGDNNQQVRG-VARWKGDIA-DDASLHDM---LGKGHLVITIEPKQGERYQGVVGLEGDTLAQVL
HSLO_PASMU      KLALVNGN-----HXXXXXXXXXXXXDVSDDMSLAQLVGKGVLVITIAPTEGERYQGVIALDKPTITACL
HSLO_COLP3      GYMSVSGNNKQQMRG------IAKMAEETSADTLQTLIGKGTMIITIRPNAGEAYQGVVALDEESLADCL
HSLO_METFK      KLLVVECTSDLGIR---ATAKWSGELDGMSFSDMVSNGHFVITLDPRDGG--QPYQGIVPVEGGSIAEIL
HSLO_AZOVD      PLLMVECSSEREVRG-IARYHAEQVEPGAGLREL---MPEGLLTLTIDPRRGQRYQGIVELRGESLADCL
HSLO_ERWT9      KMAVINGNNRQEMRG-VARMQGEIAEGSSLK----EMIGNGYLVITISPEVGERYQGVVGLEGDTLAACL
HSLO_PSE14      PLLMVECSSERELRG-IARYDETLITPDAGLQDL---MPDGSLALTVDPHKGKRYQGIVALDGVDLSESL
HSLO_PSEU2      PLLMVECSSERELRG-IARYDEALVTAGAGLQDL---MPDGSLALTIDPNKGKRYQGIVALDGVDLSESL
HSLO_PSESM      PLLMVECSSERELRG-IARYDEALITPGAGLQDL---MPDGSLALTVDPRQGKRYQGIVALDGVDLSESL
HSLO_MANSM      RLALVNGNHRQQIRA-LARIDGEI----RDDMSLHQLIGKGVLVITIAPQEGERYQGIIALDKPTVTECL
HSLO_PSEPG      PLLMVECSSDCEIRGMARYEAEQIPADAS----LSQLMPDGHLTLTIDPVKGQRYQGTVDLDGANLSECF
HSLO_PSEPK      PLLMVECSSEREIRGMARYEADQIPAGAT----LSQLMPDGHLTLTIDPVKGQRYQGTVDLDGANLSECF
HSLO_ALCBS      SLLLAECSHDGELRALARHSDGQ----DWSHGDIQTLIGEGVITITPDQGRQ--YQGIVPLSGDTLAQCL
HSLO_PSEP1      PLLMVECSSEREIRGMARYEADQISADAT----LSQLMPDGHLTLTIDPVKGQRYQGTVDLDGANLSECF
HSLO_NEIMB      KMLVAEAASDRTVRATARWDETAEIAXXXXXXXXXXXXXVFVLTLQPKDG--EPWQGVVPLEGGGIAQML
HSLO_PSEE4      PLLAIEYTSEHDIRG-LARFEAEQIKDDARLADLMPG-GHLVLTIIPVNGQR--YQGTVELDGQDLSECF
HSLO_NEIMA      KMLVAEATSDRTVRATARWDETAEIAXXXXXXXXXXXXXVFVLTLQPKDG--EPWQGVVPLEGDGIAQML
HSLO_EDWI9      KLAVINGNHRQEMRG-VARLQGDIADGSSLKH----MLGNGIMVITITPKEGERYQGVVALEGDTLSNCL
HSLO_HAHCH      RLLMAEATHRRTARGIA---RWEGAPDSTSLKQLLGNRAALAITIAPQNGQR--YQGIVPLSSDSLSACL
COPD_DICDI      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AYYFAVSEQIPSAFSIGVLVDSDGVKIAGGFAVQIIDRTLEQEKVEMIEKNIKNLPSISKLFQEAEPLDV
HSLO_THEMA      AYYFAVSEQIPSAFSIGVLVDSDGVKIAGGFAVQIIDRTLEQEKVEMIEKNIKNLPSISKLFQEAEPLDV
HSLO_THEP1      AYYFAVSEQIPSAFSIGVLVDSGGVKIAGGFAVQIIDRTLEQEKVELIERNIKNLPYITELFQKAEPLDV
HSLO_THESQ      AYYFAVSEQIPSAFSIGVLVDSGGVKIAGGFAVQIIDRTLEQEKVELIERNIKNLPYITELFQKAEPLDV
HSLO_THEM4      TYYFTISEQIPSAIALGVLVDKNGIKRAGGIIIQILDQSLPKKDITEIEKKFKEITPITNFLEKHTPIDA
HSLO_CLOCE      TYYFATSEQVPSTVALGVLIDATGVIGAGGFIVQMMPGA-EEETVATLEKRLIGFPSVSKLISETTPEQI
HSLO_BACA2      TYYLVSSEQVPSSVGVGVLVNPDNILAAGGFIIQLLPGT-DEETISTIEKQLSQIEPISKLIQKGTPEEI
HSLO_BACSU      TYYLVSSEQVPSSVGVGVLVNPDNILAAGGFIIQLMPGT-DDETITKIEQRLSQVEPISKLIQKGTPEEI
HSLO_GEOSW      TYYFASSEQVPSSVGVGVLVNPDNILAAGGFIIQLMPGT-EEKTIEQIEQRLQTIPPVSKMVESGTPEEI
HSLO_BACSK      TYYFANSEQTPSSVGVGVLVNPDSVLAAGGFVIQLLPGAKEATITE-IEKRIGETPPISKLVEQGKPEEI
HSLO_BACCN      TYYFAVSEQTPSSVGVGVLVNDDSILAAGGFILQIMPGA-QEETISFIEERLKKIPPVSTMIEKGSPEGI
HSLO_CLOB8      AYYFTASEQTPSAVSLGVLVDRDSIKAAGGFIVQMMPGA-DELLADVITYRLEEIPPITTLISEGKTIEI
HSLO_BACST      TYYFASSEQVPSSVGVGVLVNPDTILAAGGFILQLMPGT-EEKTIDQIERRLQTIPPVSRMVESGTPEEI
HSLO_BACLD      TYYLVSSEQVPSSVGVGVLVNPDNILAAGGFILQLLPGT-DDETITKLETNLSQVEPISKLIQKGTPEEV
HSLO_CLOPE      AYYFTASEQIPSAVALGVLVDRDSIKKAGGFIIQLLPGA-DELLGDLLTYRLDEIPSLTTMLSEGKTIEV
HSLO_CLOP1      AYYFTASEQIPSAVALGVLVDRDSIKKAGGFIIQLLPGA-DELLGDLLTYRLDEIPSLTTMLSEGKTIEV
HSLO_CLOBB      AYYFTVSEQTPSAVSLGVLVDKNSIKAAGGFIVQMMP-DADELLADLVTYRLEEIPPITTLISEGKSIEI
HSLO_SYNP2      THYLATSEQTPSALLVGVFVGAEGVTAAGGILLQILPKAARDESVAKLESRLGQLSGFTPLLQQGKSLDI
HSLO_CLOPS      AYYFTASEQIPSAVALGVLVDRDSIKKAGGFIIQLLPGA-DELLGDLLTYRLDEIPSLTTMLSEGKTIEV
HSLO_CLOBA      AYYFTVSEQTPSAVSLGVLVDKDSIKAAGGFIVQMMP-DADELLADLVTYRLEEIPPITTLISEGKTIEI
HSLO_STAHJ      TYYFATSEQTPSSVGLGVLVNPDSIKAAGGFIIQVMPGA-KDETVTKLENAINNMQPVSKLIEQGTPEGI
HSLO_AQUAE      AYYLYQSEQTPSAVAVGVKVNEDGVKHAGGYLVQTLGGTSEKVK-ELLEKRILSLPPVTEMMEKGRPEDI
HSLO_CLOBL      AYYYTVSEQTPSAVGLGVLVDKDSIKSAGGFIIQMMPGA-DEMLADLISYRLEEIPSITEMISKGMTIEI
HSLO_CLOBK      AYYYTVSEQTPSAVGLGVLVDKDSIKSAGGFIIQMMPGA-DEMLADLISYRLEEIPSITEMISKGMTIEI
HSLO_CLOBH      AYYYTVSEQTPSAVGLGVLVDKDSIKSAGGFIIQMMPGA-DEMLADLISYRLEEIPSITEMISKGMTIEI
HSLO_CLOB1      AYYYTVSEQTPSAVGLGVLVDKDSIKSAGGFIIQMMPGA-DEMLADLISYRLEEIPSITEMISKGMTIEI
HSLO_OCEIH      TYYYATSEQLPSAVGAGVLVNPDTILAAGGFIVQVMPGA-EEEVINELEDQIQAIPAISSLIREGKPEEI
HSLO_CLOTE      AYYFTVSEQTPSAVGLGVLVDKDSIKASGGFIIQMMPGA-DELLADFITYRLEEIPSITELISKGMSIEI
HSLO_CLOB6      AYYYTVSEQTPSAVGLGVLVDKDSIKSAGGFIIQMMPGA-DEMLADLISYRLEEIPSITEMISKGMTIEI
HSLO_THEPX      AYYFYTSEQVPSAVGVGVLVGKEGVLASGGFIIQLLP-NIXXXXXXXXXXXLKNISSVTELLRKGYPEDI
HSLO_THEP3      AYYFYTSEQVPSAVGVGVLVGKEGVLASGGFIIQLLP-NIXXXXXXXXXXXLKNISSVTELLRKGYPEDI
HSLO_LACAC      AYYLTKSEQIPSAVGLSVFVNNNSIGEAGGFMLQALPGA-SDALIDKTIKRINELPALSTSFLDGTPEDL
HSLO_LACBA      TYYLAKSEQIPSAVGVSVFVQNNTVKVAGGFLIQVMPGA-SDEAIARLEQRIKEMPMVSELLLAGQPEEI
HSLO_CLOBJ      AYYYTVSEQTPSAVGLGVLVDKDSIKSAGGFIIQMMPGA-DEMLADLISYRLEEIPSITEMISKGMTIEI
HSLO_LACF3      TYYLAQSEQIPSAVGLSVFVQSDDIEVAGGFLIQVLPGA-SDEAINHLETTLRELPLVSDLLREGKPEQI
HSLO_ACAM1      THYLVTSEQTPSALALGVFVGAQGVTASGGLLIQVLPKAAEDPAVELLESRLAHLQGFTPLLQAGKTLDI
HSLO_LACSS      TYYLAKSEQTPSAVGVSVFVNEDSIGVAGGFMIQILPGA-DDRLIDVLEARLQEMPLVSELLQQGTPEGI
HSLO_EUBR3      TYYFATSEQIPSAVGLGVLVDKDSVKQSGGFIIQLMPFTPE-DVVDRLEKKITEIDSVTQMLDRGTPEQI
HSLO_BACHK      TYYFAVSEQTPSSVGVGVLVNDDSILAAGGFILQIMPGA-QEETISFIEERLQKIPPVSTLIEQGSPEEL
HSLO_BACCZ      TYYFAVSEQTPSSVGVGVLVNDDSILAAGGFILQIMPGA-QEETISFIEERLQKIPPVSTLIEQGSPEEL
HSLO_BACCQ      TYYFAVSEQTPSSVGVGVLVNDDSILAAGGFILQIMPGA-QEETISFIEERLQKIPPVSTLIEQGSPEEL
HSLO_BACC7      TYYFAVSEQTPSSVGVGVLVNDDSILAAGGFILQIMPGA-QEETISFIEERLQKIPPVSTLIEQGSPEEL
HSLO_BACC3      TYYFAVSEQTPSSVGVGVLVNDDSILAAGGFILQIMPGA-QEETISFIEERLQKIPPVSTLIEQGSPEEL
HSLO_BACC1      TYYFAVSEQTPSSVGVGVLVNDDSILAAGGFILQIMPGA-QEETISFIEERLQKIPPVSTLIEQGSPEEL
HSLO_BACC0      TYYFAVSEQTPSSVGVGVLVNDDSILAAGGFILQIMPGA-QEETISFIEERLQKIPPVSTLIEQGSPEEL
HSLO_BACAN      TYYFAVSEQTPSSVGVGVLVNDDSILAAGGFILQIMPGA-QEETISFIEERLQKIPPVSTLIEQGSPEEL
HSLO_BACAH      TYYFAVSEQTPSSVGVGVLVNDDSILAAGGFILQIMPGA-QEETISFIEERLQKIPPVSTLIEQGSPEEL
HSLO_BACAC      TYYFAVSEQTPSSVGVGVLVNDDSILAAGGFILQIMPGA-QEETISFIEERLQKIPPVSTLIEQGSPEEL
HSLO_BACAA      TYYFAVSEQTPSSVGVGVLVNDDSILAAGGFILQIMPGA-QEETISFIEERLQKIPPVSTLIEQGSPEEL
HSLO_CLOBM      AYYYTVSEQTPSAVGLGVLVDKDSIKSAGGFIIQMMPGA-DEMLADLISYRLEEIPSITEMISKGMTIEI
HSLO_BACP2      TYYLVSSEQVPSSVGVGVLVNPDSILAAGGFIIQLLPGT-EDAVIERLEKRLSTIEPISKLIEKGTPEEI
HSLO_BACCR      TYYFAVSEQTPSSVGVGVLVNDDSILAAGGFILQIMPGA-QDETISFIEDRLQKIPPVSTLIEQGSPEEL
HSLO_BACC4      TYYFAVSEQTPSSVGVGVLVNDDSILAAGGFILQIMPGA-QDETISFIEDRLQKIPPVSTLIEQGSPEEL
HSLO_ENTFA      TYFMAVSEQVPSAIGLGVLVDTDSVKAAGGFMIQVMPGA-DESTIDFIEQRLAEVPPISQLLENGEPEQV
HSLO_BACC2      TYYFAVSEQTPSSVGVGVLVNDDSVLAAGGFILQIMPGA-QEETISFIEDRLQKIPPVSTLIERGSPEEL
HSLO_BACWK      TYYFAVSEQTPSSVGVGVLVNDDSVLAAGGFILQIMPGA-QEETISFIEERLQQIPPVSQLIEQGSPEEL
HSLO_LACH4      AYYLTKSEQIPSAVGLSVFVNNNSIGEAGGFMLQALPGASDALITETI-KRIKALPALSTEFLDGTPEDL
HSLO_CLOTH      TYYYAYSEQVPTATALGVLTNATEIVVAGGFILQLMPGA-DDDTISFIENKISSIPPVSTLLQNKSPEDI
HSLO_CLOAB      AYYYVNSEQTPSAVGLGVLVDKDSIKASGGFIIQMMPGA-DDLVADLITYRLQEIPSITDLIAKGMSVDI
HSLO_LACC3      TYYLAKSEQIPAAVGLSVFVNADNIQVAGGFMLQALPGANDAELSE-LEANVKTLPLVSELLKSGTPKQI
HSLO_TRIEI      THYLAKSEQTPSALVLGVFVDKEGVQTAGGILLQVMPKAIDEELVQVLESRIASLSGFTSLLHSGKTLEI
HSLO_STACT      TYYYATSEQVPSSVGLGVLVNPDSIKAAGGFIIQVMPNA-KEETIDKVEKAIGNMTPVSKLIQGLSPEEL
HSLO_LACCB      TYYLAKSEQIPAAVGLSVFVNADNIQVAGGFMLQALPGANDAELSE-LEANVKTLPLVSELLKSGTPEQI
HSLO_GEOKA      TYYFASSEQIPSSVGVGVLVNPDTIRAAGGFIIQLMP-GXXXXXXXXXXXXLKQIPPVSRMIERGSPXXX
HSLO_LISIN      TYYLATSEQINSSVGVGVLVNDDTIEAAGGFMLQLLPGATD-EIIDEIEKNLSTLPTVSRMIEAGEPETI
HSLO_LISMO      TYYLATSEQINSSVGVGVLVNDDTIEAAGGFMLQLLPGATD-EIIDEIEKNLMALPTVSRMIEAGEPESI
HSLO_LISMH      TYYLATSEQINSSVGVGVLVNDDTIEAAGGFMLQLLPGATD-EIIDEIEKNLTALPTVSRMIEAGEPESI
HSLO_LISMF      TYYLATSEQINSSVGVGVLVNDDTIEAAGGFMLQLLPGATD-EIIDEIEKNLTALPTVSRMIEAGEPESI
HSLO_LISMC      TYYLATSEQINSSVGVGVLVNDDTIEAAGGFMLQLLPGATD-EIIDEIEKNLTALPTVSRMIEAGEPESI
HSLO_DESPS      AYYLTTSEQVPSAVGLGIQLNPNGIDAAGGFLIQSLP-PADEELIASMEEVIANLPSISSMILDGQPRQM
HSLO_STAES      TYYYATSEQTPSSVGLGVLVNPDSIKAAGGFIIQVMPGATD-ETVTKLEEAISQMQPVSKLIEQGTPEGI
HSLO_STAEQ      TYYYATSEQTPSSVGLGVLVNPDSIKAAGGFIIQVMPGATD-ETVTKLEEAISQMQPVSKLIEQGTPEGI
HSLO_THETN      AYYFYTSEQIPSAVGLGVLVGKEGVLTAGGFILQLLP-DVKEEVILKLEKAIGQITSVTDLLRQGKPEDI
HSLO_ANASP      AHYLVTSEQTPSALMLGVFVGASGVTAAGGLLVQVLPKAARDEAVAKLESRVGALSGFTPLLQAGK---T
HSLO_THEYD      AYYLNVSEQIPSAVSLGVYVEPDSVKAAGGFMIQTMPET-RTEIVEFLERKLSETQSTSSILQGMDSLQI
HSLO_CYAP4      THYLVTSEQTPSALVLGVFVTEAGVTAAGGVLIQVLPKAAQDEAVEKLESRISALSGFTPLLQRGLSLEI
HSLO_CLOD6      TYYFAVSEQTPSVVALGVLTKEDEVEFAGGFIVQLMP-DAEEETIAKLEENVAKLPSITNMLKEGKPEDI
HSLO_STRSV      AFYLTESQQTPSAVGLNVLLDNDKVKVAGGFLVQVLPGAKEAE-IARFEKRIQEMPAISRLLESDDHIEL
HSLO_THEEB      TYYLATSEQTPSALMLGVFVEESGVTAAGGLMLQVLPKAANDEHIATLEQRVANLKGFTPLLQAGRTLDI
HSLO_STRGC      AFYLTESQQTPSAVGLNVLLDNDKVKVAGGFLVQVLPGAKEAE-IARFEKRIQEMPAISKLLESDDHIEL
HSLO_LACJO      TYYLAKSEQIPSAVGLSVFVENNEIGAAGGFILQALPGATDEQLAE-VEKRIKALPNLSTLFLDGTPENL
HSLO_DESRM      AHYLTTSEQTPSAVSLGVLVDTDSVVAAGGLILQLLPGAGE-EVLEILEQNLRQLPHLSSLIKNGEPEDI
HSLO_CLOPH      TYYFATSEQVPSSVALGVLMNRDNVRCAGGFIIQLLPFAXXXXXXXXXXXXXXXTSVTSMLDKGMTPEEI
HSLO_STRTD      AYYLTESEQTPSAVGLNVLLDEDKVKVAGGFMLQVLPGASEEE-IARYEKRIQEMPAISTLLESDDHIEL
HSLO_STAAW      TYYYATSEQTPSSVGLGVLVNPDNIKAAGGFIIQVMPGA-KDETISKLEKAISEMTPVSKLIEQGTPEGL
HSLO_STAAT      TYYYATSEQTPSSVGLGVLVNPDNIKAAGGFIIQVMPGA-KDETISKLEKAISEMTPVSKLIEQGTPEGL
HSLO_STAAS      TYYYATSEQTPSSVGLGVLVNPDNIKAAGGFIIQVMPGA-KDETISKLEKAISEMTPVSKLIEQGTPEGL
HSLO_STAAR      TYYYATSEQTPSSVGLGVLVNPDNIKAAGGFIIQVMPGA-KDETISKLEKAISEMTPVSKLIEQGTPEGL
HSLO_STAAE      TYYYATSEQTPSSVGLGVLVNPDNIKAAGGFIIQVMPGA-KDETISKLEKAISEMTPVSKLIEQGTPEGL
HSLO_STAAC      TYYYATSEQTPSSVGLGVLVNPDNIKAAGGFIIQVMPGA-KDETISKLEKAISEMTPVSKLIEQGTPEGL
HSLO_STAAB      TYYYATSEQTPSSVGLGVLVNPDNIKAAGGFIIQVMPGA-KDETISKLEKAISEMTPVSKLIEQGTPEGL
HSLO_STAA8      TYYYATSEQTPSSVGLGVLVNPDNIKAAGGFIIQVMPGA-KDETISKLEKAISEMTPVSKLIEQGTPEGL
HSLO_STAA3      TYYYATSEQTPSSVGLGVLVNPDNIKAAGGFIIQVMPGA-KDETISKLEKAISEMTPVSKLIEQGTPEGL
HSLO_LACPL      TYYLAQSEQIPSAVGLSVFVDDNSIGVAGGFLVQVLPNATD-EAISSLENKLKDMPLVSQLMRDGKPEDI
HSLO_STRT1      AYYLTESEQTPSAVGLNVLLDEDKVKVAGGFMLQVLPGASEEE-IARYEKRIQEMPAISTLLESDDHIEL
HSLO_STAAN      TYYYATSEQTPSSVGLGVLVNPDNIKAAGGFIIQVMPGA-KDETISKLEKAISEMTPVSKLIEQGTPEGL
HSLO_STAAM      TYYYATSEQTPSSVGLGVLVNPDNIKAAGGFIIQVMPGA-KDETISKLEKAISEMTPVSKLIEQGTPEGL
HSLO_STAA9      TYYYATSEQTPSSVGLGVLVNPDNIKAAGGFIIQVMPGA-KDETISKLEKAISEMTPVSKLIEQGTPEGL
HSLO_STAA2      TYYYATSEQTPSSVGLGVLVNPDNIKAAGGFIIQVMPGA-KDETISKLEKAISEMTPVSKLIEQGTPEGL
HSLO_STAA1      TYYYATSEQTPSSVGLGVLVNPDNIKAAGGFIIQVMPGA-KDETISKLEKAISEMTPVSKLIEQGTPEGL
HSLO_LACDA      TYYLAKSEQIPSAVGLSVFVNNDTIGAAGGFLLQALPGASE-ELLQETEDRIKALPQLSSAFLDGTPEDL
HSLO_CLONN      AYYFTVSEQTPTAVGLGVLVDKDSIRKAGGVIIQMMPGA-DEMLADLITYRLQDLGSITSFLDSGKTIXX
HSLO_STRT2      AYYLTESEQTPSAVGLNVLLDEDKVKVAGGFMLQVLPGASEEE-IARYEKRIQEMPAISTLLESDDHIEL
HSLO_LACDB      TYYLAKSEQIPSAVGLSVFVNNDTIGAAGGFLLQALPGASE-ELLQETEDRIKALPQLSSAFLDGTPEDL
HSLO_LACLA      AWYFLSSEQTPSSVGVNVLLDSDTVKIAGGFMLQALPDATDEEITE-IEHNIKSMPSIATMLTSEEPLTM
HSLO_SYNY3      THYLVTSEQTPSALLLGVFVGKDGVTAAGGLLLQVMPKAARDEAVAALESRLGHLTGFTPLLRSGKSLDI
HSLO_STAS1      TYYFAKSEQVPSSVGLGVLVNPDSIKASGGFLIQVMPGA-EDETINKLEDAINHMTPVSKLIQGLTPEEL
HSLO_BACHD      TYYFVSSEQTPSSVGVGVLVNPDSVLAAGGFVLQLMPGA-DDAIISEIEKRLQTIPPISKLVEAGPPEEI
HSLO_LACLM      AWYFLSSEQTPSSVGVNVLLDSDTVKIAGGFMLQALPDATDEEITE-IEHNIKSMPSIATMLTRDEPLTM
HSLO_GEOMG      AYYLTDSEQVPSAVGLGVFVEPDGVAAAGGFLIQSLP-PHNDEAVDRLMERIGAMPPVTELLRQGKPEGL
HSLO_LACLS      AWYFLSSEQTPSSVGVNVLLDSDTVKIAGGFMLQALPDATDEEITE-IEHNIKSMPSIATMLTSDEPLTM
HSLO_PROM2      ASYLYHSEQTPSAVFIGEKIENKGVICSGGLLAQVLKKDTDPLLVSLLEERCKEINSFSELFQSKDNLDI
HSLO_CYAP7      AHYLITSEQTPSALLVGVFVDVTGVIASGGILLQVMPKAADEELVSTLESRVGQLTGFTPLLRAGKTLEI
HSLO_ALKMQ      ATYFLNSEQQPSAVSLGVLIDIDRIKASGGFIIQVLP-NVQEAVLAKLESRIGQLESITVMMEQGNEVDI
HSLO_CYAP8      THYLATSEQTPSALLLGVFVGAQGVTAAGGLLLQVMPKAARDEAVATLESRVSQLSGFTPLLRSGKTLDM
HSLO_BREBN      TYYFVMSEQTPSAVGVGVLVNPESVLAAGGFILQLLPNTPE-EVVAAIEERLGQLPQVSRMIGEGTPEEI
HSLO_FINM2      SNYFYQSDQRPTVVALGVLVDTDSIKSAGGLFIQALP-GFDESLIDKLESDINKFPPISSLFTHDDPFDI
HSLO_LISW6      TYYLATSEQXXXXXXXXXXXPDDTIEAAGGFMLQLLPGATD-EIIDEIEKNLTALPTVSRMIEAGEPESI
HSLO_PROMS      ASYLYHSEQTPSAVFIGEKIQNKSVICSGGLLAQVLKKDTDPLLISLLEERCKEINSFSELFKSKHNLDI
HSLO_STRPS      AFYLTESQQTPSAVGLNVLLDEDKVKIAGGFLVQVLPGA-KKEEIARFEKRIQEMPAISTLLESDDHIEL
HSLO_STRZT      AFYLTESQQTPSAVGLNVLLDEDKVKVAGGFLVQVLPGA-KKEEIARFEKRIQEMPAISTLLESDDHIEL
HSLO_STRZP      AFYLTESQQTPSAVGLNVLLDEDKVKVAGGFLVQVLPGA-KKEEIARFEKRIQEMPAISTLLESDDHIEL
HSLO_STRZJ      AFYLTESQQTPSAVGLNVLLDEDKVKVAGGFLVQVLPGA-KKEEIARFEKRIQEMPAISTLLESDDHIEL
HSLO_STRR6      AFYLTESQQTPSAVGLNVLLDEDKVKVAGGFLVQVLPGA-KKEEIARFEKRIQEMPAISTLLESDDHIEL
HSLO_STRPN      AFYLTESQQTPSAVGLNVLLDEDKVKVAGGFLVQVLPGA-KKEEIARFEKRIQEMPAISTLLESDDHIEL
HSLO_STRPJ      AFYLTESQQTPSAVGLNVLLDEDKVKVAGGFLVQVLPGA-KKEEIARFEKRIQEMPAISTLLESDDHIEL
HSLO_STRPI      AFYLTESQQTPSAVGLNVLLDEDKVKVAGGFLVQVLPGA-KKEEIARFEKRIQEMPAISTLLESDDHIEL
HSLO_STRP7      AFYLTESQQTPSAVGLNVLLDEDKVKVAGGFLVQVLPGA-KKEEIARFEKRIQEMPAISTLLESDDHIEL
HSLO_STRP4      AFYLTESQQTPSAVGLNVLLDEDKVKVAGGFLVQVLPGA-KKEEIARFEKRIQEMPAISTLLESDDHIEL
HSLO_STRP2      AFYLTESQQTPSAVGLNVLLDEDKVKVAGGFLVQVLPGA-KKEEIARFEKRIQEMPAISTLLESDDHIEL
HSLO_GEOBB      ALYLVESEQIPSAVGIAEFIEQDGVAAAGGFLIQAVP-PVDPLVIEELMTRIEQLPPLSELLHKGNPEQI
HSLO_STRMU      AYYLTESEQTPSAVGLNVLLDKDKVKVAGGFMLQVLPEASEEE-ITRYEKRIQEMPAISTLLESEDHIEL
HSLO_STREM      AYYLTESEQTPSAVGLNVLLDEDKVKVAGGFMLQVLPEASDEE-ISRYEKRIQEMPAISSLLASENHIDA
HSLO_PROM0      ASYLYHSEQTPSAVFIGEKIQNQGIICSGGLLAQVLKKDTDPLLVSLLEERCKEVNSFSELFQSKDNLSL
HSLO_GEOSM      ALYLVESEQIPSAVGIAEFIEQDGVAAVGGFLIQAXXXXXXXXXXXXMTR-IEQLPPLSELLHEGNPEQI
HSLO_PROM9      ASYLYHSEQTPSAVFIGEKIQNKNVICSGGLLAQVLKKDTDPLLVSLLEERCKEINSFSELFHSQDNLDI
HSLO_STRE4      AYYLTESEQTPSAVGLNVLLDEDKVKVAGGFMLQVLPGA-SVEEISHYEKRIQEMPAISTLLASENHIDL
HSLO_STRP9      AYYLTESEQTPSAIGLNVLLDNDKVKVAGGFMVQVLPEASEEE-IARYEKRLQEMPAISHLLASKNHVDL
HSLO_PROM5      ASYLYHSEQTPSAVFIGEKIQNKNLICSGGLLAQVLKKETDPLLVSLLEDRCKEINSFSELFESKDDLSI
HSLO_SYNJA      SYYLSSSEQIPSAVLLGVNLDSQRVRAAGGVLMQLMPGAPASLIPEM-EARLAKVEEFSPMLAYGGGLEL
HSLO_PROMP      ASYLYHSEQTPSAVFIGEKIQNKNIISSGGLLAQVLKKETDPLLVSLLEERCKEINSFSELFKSKDNLDI
HSLO_STRS7      AYYLTESEQTPSAVGLNVLLDEDKVKVAGGFMLQVLPGASDEE-ISHYEKRIQEMPAISTLLASENHIDL
HSLO_STRPC      AYYLTESEQTPSAIGLNVLLDNDKVKVAGGFMVQVLPGASEEE-VARYEKRLQEMPAISHLLASKNHVDL
HSLO_STRPB      AYYLTESEQTPSAIGLNVLLDNDKVKVAGGFMVQVLPGASEEE-VARYEKRLQEMPAISHLLASKNHVDL
HSLO_STRA1      AYYLTESEQTPSAVGLNVLLDEDKVKVAGGFMLQVLPGASDEE-ISRYEKRIQEMPSISSLLESENHIEL
HSLO_SYNS9      ASYLLHSEQTPSGVFVGEKINRDGILCSGGLLVQILPKAAEEPAVELIEQRCREIEGFSERLAEDLLIDV
HSLO_STRPZ      AYYLTESEQTPSAIGLNVLLDNDKVKVAGGFMVQVLPEASEEE-IARYEKRLQEMPAISHLLASKNHVDL
HSLO_THET2      AHYLWQSEQIPSAXXXXXXXXXXXXXXXXXXXXXXXMPGAKEEVLGRLEANLKDLPGLTPXXXXXXXXXX
HSLO_STRPM      AYYLTESEQTPSAIGLNVLLDNDKVKVAGGFMVQVLPGASEEE-IARYEKRLQEMPAISHLLASKNHVDL
HSLO_STRPG      AYYLTESEQTPSAIGLNVLLDNDKVKVAGGFMVQVLPGASEEE-IARYEKRLQEMPAISHLLASKNHVDL
HSLO_STRPF      AYYLTESEQTPSAIGLNVLLDNDKVKVAGGFMVQVLPGASEEE-IARYEKRLQEMPAISHLLASKNHVDL
HSLO_STRP8      AYYLTESEQTPSAIGLNVLLDNDKVKVAGGFMVQVLPGASEEE-IARYEKRLQEMPAISHLLASKNHVDL
HSLO_STRP1      AYYLTESEQTPSAIGLNVLLDNDKVKVAGGFMVQVLPGASEEE-IARYEKRLQEMPAISHLLASKNHVDL
HSLO_CARHZ      AYYLYYSEQRPNVFNLGVLVNPDGVAQAGGCLIEILPGAPE-EIISTLEQNLGEQQSLTYQLQQGKHIEI
HSLO_STRPD      AYYLTESEQTPSAIGLNVLLDNDKVKVAGGFMVQVLPGASEEE-IARYEKRLQEMPAISYLLASKNHVDL
HSLO_STRU0      AYYLTESEQTPSAVGLNVLLDEDKVKVAGGFMVQALPGASEEE-IARYEKRLQEMPAISTLLAAEDPSDL
HSLO_GEOSL      AWYLTESEQIPSAVGLGVYVEQDGVAAAGGFLIQALPPG-DDQLIDRIMERIASMPPVTEMLRAATPEGL
HSLO_ACHLI      TYYYATSEQTPSAVGLGVLV-SRGKKVAGGFIIQVLPHASE-KTLNQLESIISKINSVTDLLKSNHTPED
HSLO_STRA5      AYYLTESEQTPSAVGLNVLLDEDKVKVAGGFMLQVLPGASDEE-ISRYEKRIQEMPSISSLLESENHIEL
HSLO_STRA3      AYYLTESEQTPSAVGLNVLLDEDKVKVAGGFMLQVLPGASDEE-ISRYEKRIQEMPSISSLLESENHIEL
HSLO_SYNP6      AYYLASSEQTPSAILLGVYLDRQGVEAAGGLLIQVLPQAADPELVSLLESRISHLKGFTQLLRSGKXXXX
HSLO_SYNE7      AYYLASSEQTPSAILLGVYLDRQGVEAAGGLLIQVLPQAADPELVSLLESRISHLKGFTQLLRSGKXXXX
HSLO_STRP3      AYYLTESEQTPSAIGLNVLLDNDKVKVAGGFMVQVLPGASEEE-IARYEKRLQEMPAISHLLASKNHVEL
HSLO_SYNSC      ASYLLHSEQTPSAVFVGEQVNSAGIHASGGLLVQILPKAAEEPAVELIEQRCREITGFSQRLAASXXXXX
HSLO_STRP6      AYYLTESEQTPSAIGLNVLLDNDKVKVAGGFMVQVLPGASEEE-IARYEKRLQEMPAISHLLASKNHVDL
HSLO_SYNJB      TYYLSSSEQIPSAVLLGVNLDSQRVRAAGGVLLQLMPASLIPEMEARLAKVEEFSPMLAXXXXXXXXXXX
HSLO_STRSY      AYFLTDSQQTPSAVGLNVLLDEDKVKVAGGFLLQVLPGATEVE-IARFEKRIQEMPAISSLLASENHIEL
HSLO_STRS2      AYFLTDSQQTPSAVGLNVLLDEDKVKVAGGFLLQVLPGATEVE-IARFEKRIQEMPAISSLLASENHIEL
HSLO_ALKOO      AAYFAFSEQQPSGIALGVLVDVDTIKAAGGYIIQVLPNIXXXXXXXXXXXXXXXXPITSIIDRIQDPEEI
HSLO_PELPD      AYYLADSEQTPSAVGLGAALDEDGISVCGGFLVQALPGVDEAER-DRVTDNIASLPPLSSLLREGGTQKL
HSLO_PELCD      AYYLTSSEQVPSTVALGVYLEKDGISAAGGLLVQXXXXXXXXXXXXXXXXXXXXPPITTLLRDGKGPRQI
HSLO_GEOLS      AYYLTDSEQIPSAMGLGVSLADDGIAVSGGFLIQSLPPS-DEAAVDQIMTTISKLPPLTTLLKDGQLLDI
HSLO_ANAVT      AHYLVTSEQTPSALMXXXXXXXXXXXXXXXXXXXXXPKAARDEAVAKLESRVGALSGFTPLLQAGK---T
HSLO_THET8      AHYLWQSEQIPSAXXXXXXXXXXXXXXXXXXXXXXXMPGAREEVLDRLEANLKDLPGLTPXXXXXXXXXX
HSLO_PROM1      ASYLLHSEQTPSAVFVGERINQDGIVCSGGLLAQILPKARDYSLIDLLEDRCKEINSFSELLNKKNLISL
HSLO_GLOVI      THYLVTSEQVASALMXXXXXXXXXXXXXXXXXXQVMPSADGQEDEELLERRLASVEGFTPLVRSGKRIQI
HSLO_PROMT      ASYLLHSEQTPSAVFVGEKINQDGIVCSGGLLAQILPKARDYSLIDLLEDRCKEINSFSELLNKKNLISL
HSLO_DEIRA      SRYLGASEQIPNAVLLGVYEEGGRVANAGGLLIQAMPGVTD-ETLAKLEANIAAMGMLTDQLRNXXXXXX
HSLO_SYNS3      ASYLLHSEQTPSAVFVGETISQEGLECSGGLLVQVLPKAAEPALVALLEERCREIHNFSKHLRDNQDEDL
HSLO_SYNPW      ASYLLHSEQTPSAVFVGETINSDGLQSSGGLLVQVXXREIQDFSDQLNRCGDHPEQLIQQVFPDLDPQPI
HSLO_SYMTH      AYYLTRSEQTPSAVGLXXXXXXXXXXXXXXYMVQLLPATPDADR-DRLEENLGRLGSVSLAVEQGTPEEI
HSLO_PROM4      ASYLLHSEQTPSAVFVGEKIKHKELVCSGGLIAQILPKASQDRSLELLEENCNTITSFSRLFEYKDNLDL
HSLO_SYNR3      ASYLLHSEQTPSAVFVGEHIDSSGIRCSGGVLVQVLPKAAEPALVALLEDRCREITGFSQRLEQGDLHSL
HSLO_NOSP7      AHYLVNSEQTPSXXXXXXXXXXXXXXXXXXXXIQVLPKAARDEAVETLESRVAGLAGFTPLLQAGKN---
HSLO_PROMA      ASYLLHSEQVQSAVFVGEIIEDQEFICSGALIAQILPSAVENKTINLLDEECKNLPSLSHLFPNLNP-KI
HSLO_SYNPX      ASYLLHSEQTPSAVFVGERIXXXXXXXXXXXXVQILPKAAEEPAVELLDQRCREIEDFSRLDRCGDQLEX
HSLO_MICAN      AYYLDQSEQIPSALQXXXXXXXXXXXXXXXILLQVLSKEASRDEVARLESRLRKLTGFTPLLRAGKG---
HSLO_TERTT      ALYFAQSEQLPT--KLWLFADQNGLMLQGLPAQQVTD--LDQRKEQQTAVQLANTVTPDELF-SLPANDL
HSLO_HAEDU      EDYFIRSEQLQTHLIIRV-GEYAGQAVAAGMLLQIMDGTGTPEDFEHLMTLAETVKDEELFGLTAEAL--
HSLO_CHRVO      ENYMLRSEQLDTA-----LVLASGDEAAAGMLLQRLPEGHGEDRVQMLGRTLKXXXXXXXXXX-----DI
HSLO_SHESW      EEYFNQSEQLPTA----LWLFANGQQAAGMFLQILPSQEDHHQDFEHLSQLTSTIKAEELFTLDAE--NV
HSLO_SHEPC      EEYFNQSEQLPTA----LWLFANGQQAAGMFLQILPSQEDHHQDFEHLSQLTSTIKAEELFTLDAE--NV
HSLO_PECCP      ESYFQQSEQLPTRLFIRT-GQHEGKQAAAGMLLQVLDRD-DFDHLAQLTTTVKG----EELF-SLPATEV
HSLO_HAES2      EDYFIRSEQLQTQLLIR-SGEYEGKPVAAGLLLQIMDGTGSQEDFEHLATLAATVKNEELFGLTAE--EL
HSLO_HAEIN      EDYFVRSEQLQTQLIIRT-GEYEGKPVAAGMLLQIMDGSGTPEDFEHLTTLAATVKDEELFGLPAEEL--
HSLO_HAEIG      EDYFVRSEQLQTQLIIRT-GEYEGKPVAAGMLLQIMDGSGTPEDFEHLTTLAATVKDEELFGLPAEEL--
HSLO_HAEI8      EDYFVRSEQLQTQLIIRT-GEYEGKPVAAGMLLQIMDGSGTPEDFEHLTTLAATVKDEELFGLPAEEL--
HSLO_ERWCT      ESYFQQSEQLPTRLFIRT-GQHEGNPVAAGMLLQVLPQDAERNDFDHLAQLTATVKAEELFTLPAN--EV
HSLO_HAES1      EDYFIRSEQLQTQLLIR-SGEYEGKPVAAGLLLQIMDGTGSQEDFEHLATLAATVKDEELFGLTAE--NL
HSLO_HAEIE      EDYFVRSEQLQTQLIIRT-GEYEGKPVAAGMLLQIMDGSGTPEDFEHLTTLAATVKDEELFGLPAEEL--
HSLO_ACTP7      EDYFIRSEQLQTHLVIRT-GEYEGKAVAGGLLLQIMDGTGMPEDFETLAETVKDXXXXXXXXXXXXXXXY
HSLO_SHELP      EQYFLQSEQLPTA----IRLFANG-KQAAGMLLQVLPGXXXXXXXXXXXXQLTSTIKAEELF-ELEATEV
HSLO_SALTI      EDYFLRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQAEDFDHLAMLTETIKSEELLTLPAN--DV
HSLO_SHESA      EDYFNQSEQLPTA----LWLFADGKQAAGMF-LQVLDHNADFEHLCQLTATIK----AEELFT-LDAQDI
HSLO_ACTPJ      EDYFIRSEQLQTHLVIRT-GEYEGKAVAGGLLLQIMDSTGTPEDFETLAETVKDXXXXXXXXXXXXXXXY
HSLO_SHEDO      EEYFNQSEQLPTQIHLFATNAQ-----AAGMLLQVLPSKQEQND------DFSHLSVLTQTIKPQELFDV
HSLO_SALPK      EDYFLRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQAEDFDHLAMLTETIKSEELLTLPAN--DV
HSLO_SALPA      EDYFLRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQAEDFDHLAMLTETIKSEELLTLPAN--DV
HSLO_PHOLL      DDYFRQSEQLPTRLFIRTGIQ-DGRVAAGGMLLQILP-TAEQGSAEAFDHLVQLTATIKELFS-LEVKEI
HSLO_ACTP2      EDYFIRSEQLQTHLVIRT-GEYEGKAVAGGLLLQIMDGTGTPEDFETLAETVKDXXXXXXXXXXXXXXXY
HSLO_SHEB9      EEYFNQSEQLPT----GIWLFADGKQAAGMF-LQILDHNPDFEHLSQLTSTIK----AEELFTDAE--SV
HSLO_SHEB8      EEYFNQSEQLPT----GIWLFADGKQAAGMF-LQILDHNPDFEHLSQLTSTIK----AEELFTDAE--SV
HSLO_SHEB5      EEYFNQSEQLPT----GIWLFADGKQAAGMF-LQILDHNPDFEHLSQLTSTIK----AEELFTDAE--SV
HSLO_SHEB2      EEYFNQSEQLPT----GIWLFADGKQAAGMF-LQILDHNPDFEHLSQLTSTIK----AEELFTDAE--SV
HSLO_SALTY      EDYFLRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQAEDFDHLAMLTETIKSEELLTLPAN--DV
HSLO_SALCH      EDYFLRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQAEDFDHLAMLTETIKSEELLTLPAN--DV
HSLO_ALISL      EGYFERSEQLKTRLWLR-LGEFEGKPHAAGMLLQVMDGTGSSDDFEHLEQLTDTVKNEELFSLEAE--DV
HSLO_SHESR      EDYFNQSEQLPTA----LWLFADGKQAAGMF-LQVLDHNADFEHLCQLTATIK----AEELFT-LEAQEV
HSLO_SHESM      EDYFNQSEQLPTA----LWLFADGKQAAGMF-LQVLDHNADFEHLCQLTATIK----AEELFT-LEAQEV
HSLO_ENT38      EDYFLRSEQLPTRLFIRT-GEVEGQLAAGGMLLQVLPAQNAQGN------DFEHLATLTETIKTEELFEV
HSLO_AERS4      EHYFAQSEQLATKLWIRTGYHQGEPRAAGALPAQSEDHSADFDHLTQLTATIKD----EELFGEAE--EI
HSLO_SHEON      EDYFNQSEQLPTA----LWLFADGKQAAGMF-LQILDHNADFEHLCQLTATIK----AEELFT-LEAQEV
HSLO_ESCF3      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQIMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_PHOPR      EGYFANSEQLKTRIILRT-GEFEGNAKAAGMLLQILPDGQGQEHLEQLTETVKD----EELFG-LDAQDV
HSLO_CHRSD      EDYFARSEQLATRLWLA----ADGDRAAGMLLQQLPDDASNRDP-DAWERTVHLATTLS----DAELLDL
HSLO_SERP5      EAYFRQSEQLPTRLFIRT-GESEGQPAAGGMLLQVLPAQDGNADDFDHLVQLTNTVKSEELFG-LPANEV
HSLO_SHISS      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_SHIFL      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNTQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_SHIF8      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNTQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_SHIDS      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_SHEWM      EEYFAQSEQLPTSITLFA-----NGKQAAGMLLQVLDHNAEFEHLEQLTATVKXXXXXXXXXXX-----V
HSLO_PSEF5      TNYFVMSQQTGTRFWLY----ADGRSARGLLLQQLADRLRDQEERDASWQHLTALAS-TLTADELLSLDV
HSLO_ECOSM      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_ECOLU      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_ECOLI      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_ECOL6      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_ECODH      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_ECOBW      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_ECO8A      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_ECO81      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_ECO57      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_ECO55      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_ECO45      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_ECO27      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_CAUCR      EQYFAQSEQTPTRVRLAVGQADTGQGAAGGILIQVIAGDQARGETQDAWTHVQALFETTGEDELIDPTTL
HSLO_CAUCN      EQYFAQSEQTPTRVRLAVGQADTGQGAAGGILIQVIAGDQARGETQDAWTHVQALFETTGEDELIDPTTL
HSLO_VIBFM      EGYFERSEQLKTRLWLR-LGEYEGKPHAAGMLLQVMDGTGSENDFEHLEQLTDTIKNEELFGLPAE--DV
HSLO_VIBF1      EGYFERSEQLKTRLWLR-LGEYEGKPHAAGMLLQVMDGTGSENDFEHLEQLTDTIKNEELFGLPAE--DV
HSLO_ECO7I      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_ACTSZ      EEYFERSEQLKTQLIIRT-GEFNGEPVAAGMLLQVMDGSGSPDDFEHLAALTATVKDDEIFGLTAE--EM
HSLO_SHEPW      EAYFEQSEQLPT--KIKLFADA---KQAAGMFLQVLNHNEEFEHLSVLTETVKQ----EELFTEAE--EV
HSLO_ENTS8      EDYFMRSEQLPTRLFIRT-GEAQGQPAAGGMLLQVLPAQDAQTD------DFNHLATLTETIKADELFDV
HSLO_SHIBS      EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMPQNAQQDDFDHXXXXXXXXXXXXXXXXPAN--EV
HSLO_PSEPF      TNYFVMSQQVGTRFKLC----ADGRRARGXXXXXXADRLKDEEERAASWQHITALGN-TLTADELLSLDV
HSLO_PSEA7      SNYFASSEQLPTRFWL----NADGRRARGXXXXXXADRLKDPEAREASWQHXXXXXXXXXXXXXXXXXXV
HSLO_PSEA6      ESYFQQSEQLATKVILRTQQTDSGAKACGMF-LQILPTS--SQATATTDTGFEHLAKLTETIKNEELFDI
HSLO_SHESH      EEYFTQSEQLPTKISLFA-----NGKQAAGMLLQVLDHNAEFEHLEQLTATVKXXXXXXXXXXX-----V
HSLO_NITOC      QTYFSRSEQLRTR----LWLVADEQQAVGLFLQELPSQQTDWERIALLASTVTTQEMLS-----LPSTEL
HSLO_VIBPA      EGYFANSEQLKTRLWIRT-GEFEGKPHAAGMLIQVIDGTGSPDDFEHLEQ-LTNTVKDEELFG-LEANDL
HSLO_SODGM      ENYFLQSEQLPTRLFIRT-GEYQGEVAAAGLLLQVLPHADDFDHLAQLTATVKG----DELF--ALPADV
HSLO_NEIG2      VNYMKRSEQLDTHIAL-----SASDEAAGGLLVQLPEEVLDEEAWEHVSTLARTL--TAEELAELDAQHV
HSLO_NEIG1      VNYMKRSEQLDTHIAL-----SASDEAAGGLLVQLPEEVLDEEAWEHVSTLARTL--TAEELAELDAQHV
HSLO_PROMH      DNYFNQSEQLPTRVFIRTGLQ-DGKAAGAGMLLQALPASAEHSADETAE-HFELLTQLTHTIQELFTLDI
HSLO_YERPS      ENYFMQSEQLPTRLFIGHVADK---AAAGGMLLQVLP---AQERNEDEFDHLAQLTATIK----AEELEV
HSLO_YERPP      ENYFMQSEQLPTRLFIGHVADK---AAAGGMLLQVLP---AQERNEDEFDHLAQLTATIK----AEELEV
HSLO_YERPN      ENYFMQSEQLPTRLFIGHVADK---AAAGGMLLQVLP---AQERNEDEFDHLAQLTATIK----AEELEV
HSLO_YERPG      ENYFMQSEQLPTRLFIGHVADK---AAAGGMLLQVLP---AQERNEDEFDHLAQLTATIK----AEELEV
HSLO_YERPE      ENYFMQSEQLPTRLFIGHVADK---AAAGGMLLQVLP---AQERNEDEFDHLAQLTATIK----AEELEV
HSLO_YERPB      ENYFMQSEQLPTRLFIGHVADK---AAAGGMLLQVLP---AQERNEDEFDHLAQLTATIK----AEELEV
HSLO_YERPA      ENYFMQSEQLPTRLFIGHVADK---AAAGGMLLQVLP---AQERNEDEFDHLAQLTATIK----AEELEV
HSLO_YERP3      ENYFMQSEQLPTRLFIGHVADK---AAAGGMLLQVLP---AQERNEDEFDHLAQLTATIK----AEELEV
HSLO_PSEHT      EAYFEQSEQLKTRLWFATDTTEGNAKACGLFL-----QVLPVDKQKSIE-DFAHLEALSHTIKDEELLEV
HSLO_SHEFN      EEYFNQSEQLPTQIQLFA-----NGKQAAGMLLQVLPKSGNNDDFEHLSALTSTIKAEELFTLDAE--QV
HSLO_PSEAB      SNYFASSEQLPTRFWXXXXXXXXXXXXXXXXPADRL-KDPEAREASWQHXXXXXXXXXXXXXXXXXXXXV
HSLO_VIBVY      EGYFERSEQLKTRIWIRT-GEHEGKAHAAGMLIQVMDGTGSENDFEHLEQ-LTNTVKNEELFT-LPANEL
HSLO_VIBVU      EGYFERSEQLKTRIWIRT-GEHEGKAHAAGMLIQVMDGTGSENDFEHLEQ-LTNTVKNEELFT-LPANEL
HSLO_PSEFS      TNYFVMSQQVGTKFWL----NADGKRARGLLLQQLADRIKDDERTDSWRKXXXXXXXXXXXXXXXXDNEI
HSLO_PSEAE      SNYFASSEQLPTRFWXXXXXXXXXXXXXXXXPADRL-KDPEAREASWQHXXXXXXXXXXXXXXXXXXXXV
HSLO_PSEA8      SNYFASSEQLPTRFWXXXXXXXXXXXXXXXXPADRL-KDPEAREASWQHXXXXXXXXXXXXXXXXXXXXV
HSLO_PSEPW      TNYFVQSQQLNTRFWL----NAEGGKARGLLLQQLVXXXXXXXXXXXSWQHVIALANTLKPQEWAEANEL
HSLO_YERPY      ENYFMQSEQLPTRLFIGHVADK---AAAGGMLLQVLP---AQERNEDEFDHLAQLTATIK----AEELEV
HSLO_VIBHB      EGYFANSEQLKTRLWIRT-GEHEGKAHAAGMMIQVIDGTGTPEDFEHLEQLTATVKNEELFTLPANEL--
HSLO_VIBCH      EGYFERSEQLKTRLWIRV-GKHDGKACAAGMLLQIVDGKGSAEDFEHLEQLTNTIKDXXXXXXXXXXXXY
HSLO_PASMU      EDYFVRSEQLQTQLIIRA-GEFEGQPVAAGMLLQIMDGSGSPEDFEHLATLAATVKE-EELFGLTAXXXX
HSLO_COLP3      AHYFDVSEQIPT--KIWLFCDTEXXXXXXXXXXXXPDGDGSTENKEQQQSDFEHLCQLTNTIKSEEVFSL
HSLO_METFK      QSYMQRSEQIDTRMWLAC----DG-KRAAGMLVQKMXXXXXXXXXXXWNRIIMLADTVDEELLDLSAVSL
HSLO_AZOVD      SGYFADSEQLPTRFWL----NADGRRARGXXXXXXADRLKDAEARTLNWEHXXXXXXXXXXXXXXXXXNL
HSLO_ERWT9      EDYFMRSEQLPTRLFIRSGEAEKGLG-AGGILLQVLPA--QDASLDDFNHXXXXXXXXXXXXXXXXPADV
HSLO_PSE14      SNYFVMSEQLGTRFWL----KADGHRARGLLLQQLAAQITDPEERDASWEHVITLAS-TLTAEEMLGLDI
HSLO_PSEU2      SNYFVMSEQLGTRFWL----KADGHRARGLLLQQLIAQITDPEERDASWEHVITLAN-TLTAEEMLGLDI
HSLO_PSESM      SNYFVMSEQLGTRFWL----KADGHRARGLLLQQLAAQITDPEERDASWEHVVTLAS-TLTAEEMLSLDV
HSLO_MANSM      EEYFQRSEQLQTQLLIRV-GEYEGKPVAAGMLLQIMDGSGSPDDFDHLATLTATVKDEEIFGLPAE--EL
HSLO_PSEPG      TNYFIQSQQLNTRFWL----NAEGGKARGXXXXXXXXXXXXXXXXXXXSQHVVALAKTLKPEEWAEGNEL
HSLO_PSEPK      TNYFVQSQQLNTRFWL----NAQGGKARGXXXXXXXXXXXXXXXXXXX--SWQHVVALAKTLKPEEWTEL
HSLO_ALCBS      QGYFQQSEQLPTRLWL-----ASGNNRAAGLLLQRLPNQLSTTNTQMWE----HLEALASTLQMEELLNI
HSLO_PSEP1      TNYFVQSQQLNTRFWLNA---------AGGKARGXXXXXXXXXXXXXXXXXXXSWQHVVALAKTLKPEEL
HSLO_NEIMB      VNYMKRSEQLDTHI---VLSASD--EAAGGLLVQLPEEVLDEEAWEHVSTLARTLTAEELAGLDAQ--HV
HSLO_PSEE4      TNYFVMSQQVHTSISL----TADGVR-ARGLLVQQLPAEIHKDIEEREESHVKALANTVKA-EELLGLDV
HSLO_NEIMA      VNYMKRSEQLDTHI---VLSASD--EAAGGLLVQLPEEVLDEEAWEHVSTLARTLTAEELAGLDAQ--HV
HSLO_EDWI9      EAYFMQSEQLPTRLFM-FTGEQDGQPAAAGMLLQILPTQPNNXXXXXXXXXXXXXXXPQELF-TLPANEV
HSLO_HAHCH      EEYFERSEQLATRI---WLYESNG--CWGGLLLQQLPAAYSAENWERIVALSATLTADELFSLPAE--EV
COPD_DICDI      -------------------VESDGIDIKGGLSVQINDQSLGKVKV-----NLKQ-GKLSKQFQFITHPNI


                         .         .         .         +         .         .         .:280
query           LERIFGEKVGFVETAEIKYKCDCNREKAKNALLVLDKKELEDMRKEGKGEVVCKWCNTRYVFSXXXXXXX
HSLO_THEMA      LERIFGEKVGFVETAEIKYKCDCNREKAKNALLVLDKKELEDMRKEGKGEVVCKWCNTRYVFSXXXXXXX
HSLO_THEP1      LERIFGEKVGFVETAEIRYKCDCNREKAKNALLVLDKKELEDMRKEGKGEVVCKWCNTKYVFSXXXXXXX
HSLO_THESQ      LERIFGEKVGFVETAEIRYKCDCNREKAKNALLVLDKKELEDMRKEGKGEVVCKWCNTKYVFSXXXXXXX
HSLO_THEM4      LKHIFGKKIEKTETHEINFRCSCSHQKALESLKLLKDXXXXXXXXXXXXXXSCKWCSTTY----------
HSLO_CLOCE      LNMLLGMEPKIVETVPCSFKCNCTRERMERNLISIGKKDLLEIFEDGKGELQCHFCNTKYNFS-------
HSLO_BACA2      LEEVLGQKPDVLETMPVKFHCSCSKDRFETAILGLGKKEIQDMEEDGKAEAVCHFCNEKYLFT-------
HSLO_BACSU      LEEVLGEKPEILETMPVRFHCPCSKERFETAILGLGKKEIQDMEEDGQAEAVCHFCNEKYLFT-------
HSLO_GEOSW      LEELLGKNVKVLETLPVSFVCRCSRERIADAIISLGPQEIQDMEKEGYAEASCHFCNETYHFT-------
HSLO_BACSK      INGLLGEEVKFLETKPVFFECSCSKERIGNAIISLGTKEIEAMTEDGGAETVCHFCNESYSFT-------
HSLO_BACCN      LNEILGEEVKVLETMDVQFNCTCSRERIESVLISLGKAELEQIREEEETEVHCHFCNERYKFS-------
HSLO_CLOB8      LEYIFGMDLKVLDSLTPEYKCDCSRERVEKALISIGKETLQEIYDDKKNEIVCNFCNTKYEFT-------
HSLO_BACST      LEELLGKNVKVLETLPVAFVCRCSRERIADALISLGAQEIQDIDKEGYAEASCHFCNETYHFT-------
HSLO_BACLD      LAAVLGEEPEVLETVPVRFTCNCSKERFARGIIGLGKDEIQQMDEDGQAEAQCHFCNETYLFT-------
HSLO_CLOPE      IEFIFGMDLKILEEETPKYKCDCSREKVERALLSIGYKDLKELYDEGKEELKCHFCNKAYKFT-------
HSLO_CLOP1      IEFIFGMDLKILEEETPKYKCDCSREKVERALLSIGYKDLKELYDEGKEELKCHFCNKAYKFT-------
HSLO_CLOBB      LEFIFGMDLNILDSIEPKYKCDCSREKVEKALASIGKNELQEIYDDGKNEIVCNFCNTKYTFT-------
HSLO_SYNP2      FQDLLGDENIFPETQMVRFDCGCTFERMMGALKMLGQDELLDMEKDGGAEATCNFCNEVY----------
HSLO_CLOPS      IEFIFGMDLKILEEETPKYKCDCSREKVERALLSIGYKDLKELYDEGKEELKCHFCNKAYKFT-------
HSLO_CLOBA      LEFIFGMDLNILDSIEPSYKCDCSREKVEKALASIGKKDLQEIYDDGKNEIVCNFCNTKYSFT-------
HSLO_STAHJ      LNEILGENVQILETMQAQFECNCSHEKFLNAIKGLGEAEIQDMIKEDHGEAICHFCGNKYNYS-------
HSLO_AQUAE      AVEILKDEPQLIGLKEVEYYCPCDEEVAKASLFLMSTQELEDLFNENEAEVSCNFCGRIYRF--------
HSLO_CLOBL      LEYIFEDDLKILESIAPEYRCDCSREKVERALASIGQKDLKEIYDEGKEELKCHFCNKAYVFS-------
HSLO_CLOBK      LEYIFEDDLKILESIAPEYRCDCSREKVERALASIGQKDLKEIYDEGKEELKCHFCNKAYVFS-------
HSLO_CLOBH      LEYIFEDDLKILESIVPEYRCDCSREKVERALASIGQKDLKEIYDEGKEELKCHFCNKAYVFS-------
HSLO_CLOB1      LEYIFEDDLKILESIVPEYRCDCSREKVERALASIGQKDLKEIYDEGKEELKCHFCNKAYVFS-------
HSLO_OCEIH      LTQLFGEELTIHEKMPIEFRCKCSKDRLAQAIIGLGNDEIQAMIEEDQGEATCHFCNEKYHFT-------
HSLO_CLOTE      LEFIFGMDLKILEGIVPEYTCDCSREKIDRALISIGYKDLKEIYDEGKEELVCQFCNEKYFY--------
HSLO_CLOB6      LEYIFEDDLNILESIVPEYRCDCSREKVERALASIGQKDLKEIYDEGKEELKCHFCNKAYTFS-------
HSLO_THEPX      LNHILGEMLNILERVDLKYECDCSQERFETAIIALGKEEIKKLIAEGQSEAVCHFCGKKYL---------
HSLO_THEP3      LNHILGEMLNILERVDLKYECDCSQERFETAIIALGKEEIKKLIAEGQSEAVCHFCGKKYL---------
HSLO_LACAC      ARKILGTDCKILEKDDVAFSCDCSKEKYAGILETLKSSQLKDMINEDHGELICNFCGNKYHYTEDELKEI
HSLO_LACBA      LALLFEEKIKIVQKMPVGFKCDCSKDRFAQSLASIQPAALQEMIDEDHGEAVCHFCGTKYQFS-------
HSLO_CLOBJ      LEYIFEDDLNILESIVPEYRCDCSREKVERALASIGQKDLKEIYDEVKEELKCHFCNKAYAFS-------
HSLO_LACF3      LETIFGRDLKILEKMPVEYKCDCSKDRFEKALASLSKDDLQEMIDNDHGEAVCRFCGHKYHFS-------
HSLO_ACAM1      FTDLLGDKI-FPQTQMVQFQCRCSTERVLGALKMLGQDELLDMEKDDGAEATCDFCGEVY----------
HSLO_LACSS      ITEIVGEPMKTLEELPVKYECDCSKERFAKALSSIAPQDLKQLIEEDHGEATCRFCGKQYQFS-------
HSLO_EUBR3      LEEILGDGLEITDTTETRFHCDCSKERVSRALSTLSKKDLDSIIADGESEVKCQFCNKAYEFT-------
HSLO_BACHK      LYAVLGEKVKVLETMDVQFNCTCSRERIESVLISLGKTXXXXXXXXXXXXXVCHFCNERYKFS-------
HSLO_BACCZ      LYAVLGEKVKVLETMDVQFNCTCSRERIESVLISLGKTXXXXXXXXXXXXXVCHFCNERYKFS-------
HSLO_BACCQ      LYAVLGEKVKVLETMDVQFNCTCSRERIESVLISLGKTXXXXXXXXXXXXXVCHFCNERYKFS-------
HSLO_BACC7      LYAVLGEKVKVLETMDVQFNCTCSRERIESVLISLGKTXXXXXXXXXXXXXVCHFCNERYKFS-------
HSLO_BACC3      LYAVLGEKVKVLETMDVQFNCTCSRERIESVLISLGKTXXXXXXXXXXXXXVCHFCNERYKFS-------
HSLO_BACC1      LYAVLGEKVKVLETMDVQFNCTCSRERIESVLISLGKTXXXXXXXXXXXXXVCHFCNERYKFS-------
HSLO_BACC0      LYAVLGEKVKVLETMDVQFNCTCSRERIESVLISLGKTXXXXXXXXXXXXXVCHFCNERYKFS-------
HSLO_BACAN      LYAVLGEKVKVLETMDVQFNCTCSRERIESVLISLGKTXXXXXXXXXXXXXVCHFCNERYKFS-------
HSLO_BACAH      LYAVLGEKVKVLETMDVQFNCTCSRERIESVLISLGKTXXXXXXXXXXXXXVCHFCNERYKFS-------
HSLO_BACAC      LYAVLGEKVKVLETMDVQFNCTCSRERIESVLISLGKTXXXXXXXXXXXXXVCHFCNERYKFS-------
HSLO_BACAA      LYAVLGEKVKVLETMDVQFNCTCSRERIESVLISLGKTXXXXXXXXXXXXXVCHFCNERYKFS-------
HSLO_CLOBM      LEYIFEDDLKILESIAPEYRCDCSREKVERAFASIGQKDLKEIYDEGKEELKCHFCNKAYAFS-------
HSLO_BACP2      LEEVLGEKPQILETVPVEFSCNCSKERFANGIISLGKAEIDDMEQDGQAEAQCHFCNETYVFT-------
HSLO_BACCR      LYAVLGEKVKVLETMDVQFNCTCSRERIESVLISLGKTXXXXXXXXXXXXXVCHFCNERYKFS-------
HSLO_BACC4      LYAVLGEKVKVLETMDVQFNCTCSRERIESVLISLGKTXXXXXXXXXXXXXVCHFCNERYKFS-------
HSLO_ENTFA      LYRLLGEEVEILEKMPVQFKCDCSKEKFATALIAVGIDELNAMIDEDHGEAVCQFCNNKYHYS-------
HSLO_BACC2      LYAVLGEKVKVLETMDVQFNCTCSRERIESVLISLGKTXXXXXXXXXXXXXVCHFCNERYKFS-------
HSLO_BACWK      LYEVLGEKVKVLETMDVQFNCTCSRERIESVLISLGKAXXXXXXXXXXXXXVCHFCNERHKFA-------
HSLO_LACH4      ARKILGTDCKILEKDDVAFSCDCSKEKYAGILETLKSSQLKAMINEDHGELTCNFCGNKYHYT-------
HSLO_CLOTH      LEMLLSEKMKIIGKSPCRYLCNCSRERMERNIMTLGKEEIMGMINENHGEAHCHFCNKKYWFS-------
HSLO_CLOAB      LEFIFEDKI-LDEGIVPEYRCDCSRDRVEKALISIGMKDLKEIYDDGKEEVVCNFCNKKYVFT-------
HSLO_LACC3      IQRIAGEPVQFLDAQPLKFACNCSKEHFGDIMATLPHAQLQEMDQDGGAETTCKFCGNQYHYT-------
HSLO_TRIEI      FQELLGDMLNILPEAQIRFKCDCSMEKVLRALRMFGVDELQNMIEEDKGEVTCEFCSQLY----------
HSLO_STACT      LTEILGENVKFLETVPVKFECNCSHEKFLNAIKGLGEAEIQAMIDEDHGEAECHFCRAKYQYS-------
HSLO_LACCB      IQRIAGEPVQFLDAQPLKFACNCSKEHFGDIMATLPHAQLQEMDQDGGAETTCKFCGNQYHYS-------
HSLO_GEOKA      XXXXXGDGVRVLETMPVSFVCRCSRERIADALISLGPEEIQDIDKEGQAEASCHFCNETYHF--------
HSLO_LISIN      LAKLAGDKLQILEKIPVAFECNCSKERFGSAIISLGKEEIRSMIEEDHGEAECHFCRNTYDFS-------
HSLO_LISMO      LAKLAGDKLQILEKIPVSFECNCSKERFGSAIISLGKEEIRSMIEEDHGEAECHFCRNTYDFS-------
HSLO_LISMH      LAKLAGDKLQILEKIPVSFECNCSKERFGSAIISLGKEEIRSMIEEDHGEAECHFCRNTYDFS-------
HSLO_LISMF      LAKLAGDKLQILEKIPVSFECNCSKERFGSAIISLGKEEIRSMIEEDHGEAECHFCRNTYDFS-------
HSLO_LISMC      LAKLAGDKLQILEKIPVSFECNCSKERFGSAIISLGKEEIRSMIEEDHGEAECHFCRNAYDFS-------
HSLO_DESPS      LDKLFG-AIPHKETSKLKYQCSCSREKMENALISLGAADLASLLTEGEAEVLCEFCRQNYHFA-------
HSLO_STAES      LNEILGENVQILNSTSAQFECNCSHEKFLNAIKGLGEAEIHSMIKEDHGEAVCHFCGNKYQYS-------
HSLO_STAEQ      LNEILGENVQILNSTSAQFECNCSHEKFLNAIKGLGEAEIHSMIKEDHGEAVCHFCGNKYQYS-------
HSLO_THETN      LTSIFEEEVKFLEKIPLKYECDCSQERFESAILAXXXXXXXXXXXXXXXXTVCHFCGKKY----------
HSLO_ANASP      LPEIFHDLLGFPESQILRFHCGCSFDRVLGALKMLGEAELQDMVKDDGAEATCDFCGRVY----------
HSLO_THEYD      LEEVVGLPIEVLHRGTVTYFCPCTKDRVINAIVTLGREEIQKMIEEGKTDVECYFCKKKY----------
HSLO_CYAP4      FEQLLGD-MGLTQRQLVRFHCRCSFDRMLGALKILGSDELQDMIDRDNGEATCHFCGEVY----------
HSLO_CLOD6      LNIVLGLEPKILDTCEVGFMCECSKERVKTALVAIGKKSLAQIIEEDKAEVGCQFCNKKYMYS-------
HSLO_STRSV      LAAIYGEPYKRLSEEEIRFQCDCNKERFMNALATLPKADLEEMRDQDQGEIVCQFCQTAYHF--------
HSLO_THEEB      FQELLGDMDLQIQRQMVRFHCGCSHERMXXXXXXXXXXXXRDLATEAKAEATCQFCNAVY----------
HSLO_STRGC      LAAIYGEPYKRLSEEEIRFQCDCSKERFMNALATLPKADLEEMRDQDQGEIICQFCQTAYHF--------
HSLO_LACJO      AERILGTDCKILAKEDVSFACDCSKEKYSQILATLKPAQLKEMEKDHGAELVCRFCKEKYHFT-------
HSLO_DESRM      IKRVTGIEMKFLESNPVGFSCQCSRERLENLLVGIGKDEVTSMQEQGAAEINCHFCAENYHF--------
HSLO_CLOPH      LQELLGEGLTILDKIPTKFTCNCTKERVEKAIVSIGKKDLQEMIDDEKPEVNCHFCNTNYEFS-------
HSLO_STRTD      LNAIYGEPFKRLSEEELSFECDCSRERFENALLTLGKDELQAMKDEDHGEIVCQFCQTKYEFS-------
HSLO_STAAW      LNEILGEHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGEAVCHFCGNKYKYT-------
HSLO_STAAT      LNEILGEHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGEAVCHFCGNKYKYT-------
HSLO_STAAS      LNEILGEHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGEAVCHFCGNKYKYT-------
HSLO_STAAR      LNEILGEHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGEAVCHFCGNKYKYT-------
HSLO_STAAE      LNEILGEHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGEAVCHFCGNKYKYT-------
HSLO_STAAC      LNEILGEHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGEAVCHFCGNKYKYT-------
HSLO_STAAB      LNEILGEHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGEAVCHFCGNKYKYT-------
HSLO_STAA8      LNEILGEHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGEAVCHFCGNKYKYT-------
HSLO_STAA3      LNEILGEHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGEAVCHFCGNKYKYT-------
HSLO_LACPL      LDLLFDGDVKVLDKMPVKFECDCSKERFAEALMALPKHEVQAMIDEDHGTAVCHFCGDQYQFS-------
HSLO_STRT1      LNAIYGEPFKRLSEEELSFECDCSRERFENALLTLGKDELQAIKDEDHGEIVCQFCQTKYEFS-------
HSLO_STAAN      LNEILGEHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGEAVCHFCGNKYKYT-------
HSLO_STAAM      LNEILGEHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGEAVCHFCGNKYKYT-------
HSLO_STAA9      LNEILGEHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGEAVCHFCGNKYKYT-------
HSLO_STAA2      LNEILGEHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGEAVCHFCGNKYKYT-------
HSLO_STAA1      LNEILGEHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGEAVCHFCGNKYKYT-------
HSLO_LACDA      AKKILGDDCKILEKDEVSYHCDCSKEKYAGMLETLKGSQLKEMIDEDHGELVCNFCGNKYNFT-------
HSLO_CLONN      XXXXXXXXXXILEEMTPEYSCDCSREKIERALISIGEKDLKEIYNDGKEEIVCQFCGEHYKFT-------
HSLO_STRT2      LNAIYGEPFKRLSEEELSFECDCSRERFENALLTLGKDELQAMKDEDHGEIVCQFCQTKYEFS-------
HSLO_LACDB      AKKILGDDSKILEKDEVSYHCDCSKEKYAGMLETLKGSQLKEMIDEDHGELVCNFCGNKYNFT-------
HSLO_LACLA      LDNIYGD-MEYKNLGELEFKCDCSKERFLEGIKSLGREPIEEMIAEDHGEIICQFCENKYEYS-------
HSLO_SYNY3      FQELLGDLAILPEVQLLRFDCRCSFPRVLGALKILGQDELEDMEKDNGAEATCDFCGEVY----------
HSLO_STAS1      LFEILGEEVQILENVPAHFECNCGHDKFLNAIKGLGEAEIQNMINEDHGEAECHFCRNKYQFS-------
HSLO_BACHD      LAALLGDNVKILEKMPIEFACQCSKERIARAIISLGKDEIRAMEEDGGAETTCHFCNEVYLFS-------
HSLO_LACLM      LDNIYGD-MEYKNLGELAFKCDCSKERFLEGIKSLGRQPIEEMIAEDHGEIICQFCENKYEYS-------
HSLO_GEOMG      LEYLFGIPYDTLEKRALAFVCSCSRERIERVLISLGRDDLASLAEQGETEVTCEFCREHYHF--------
HSLO_LACLS      LDNIYGD-MEYKNLGELAFKCDCSKERFLEGIKSLGREPIEEMIAEDHGEIICQFCENKYEYS-------
HSLO_PROM2      DDKSISEK---ARSQEVSFKCKCSKKRSLNAMKMLDKSELEDLKKDGEAELVCEFCKNKYLIN-------
HSLO_CYAP7      FEQLLGD-LGLVEIQMVRFDCHCSFERVLGALKMLGEAELQDMEKDDGAEATCQFCGEVY----------
HSLO_ALKMQ      LNHVLGMDPKIVETYEVDFECDCNVARFEKGLISIGRQEIREMIEEDENELVCHFCNKKYHFN-------
HSLO_CYAP8      FEQLLGD-LGLVILPEIRFDCRCSFTRVLGALKMLGEAELQDMEKDNGAEATCEFCSEVY----------
HSLO_BREBN      LDRVLDEP-KILSHTEIQFSCKCSADKVVQALISMXXXXXXXXXXXXXXXXVCHFCNERY----------
HSLO_FINM2      LNQYFSDDLKLLGQKEVQYLCDCNRDRVERSLISLGKETLTELEEDGKAELVCDFCNKKYNFS-------
HSLO_LISW6      LAKLAGDKLQILEKIPVSFECNCSKERFGSAIISLGKDEIRSMIEEDHGEAECHFCRNTYDFS-------
HSLO_PROMS      DDKSISEK---ARSQEVSFKCKCSKQRSLNAMKMLDKSELEDLKKDGKAELVCEFCKNKYLIN-------
HSLO_STRPS      LKAIYGEAYKRLSEEEIRFQCDCSHERFMNALASLPSSDLQEMKEEDHGEITCQFCQTTYNF--------
HSLO_STRZT      LKAIYGEAYKRLSEEEIRFQCDCSHERFMNALASLPSSDLQEMKEEDHGEITCQFCQTTYNF--------
HSLO_STRZP      LKAIYGEAYKRLSEEEIRFQCDCSHERFMNALASLPSSDLQEMKEEDHGEITCQFCQTTYNF--------
HSLO_STRZJ      LKAIYGEAYKRLSEEEIRFQCDCSHERFMNALASLPSSDLQEMKEEDHGEITCQFCQTTYNF--------
HSLO_STRR6      LKAIYGEAYKRLSEEEIRFQCDCSHERFMNALASLPSSDLQEMKEEDHGEITCQFCQTTYNF--------
HSLO_STRPN      LKAIYGEAYKRLSEEEIRFQCDCSHERFMNALASLPSSDLQEMKEEDHGEITCQFCQTTYNF--------
HSLO_STRPJ      LKAIYGEAYKRLSEEEIRFQCDCSHERFMNALASLPSSDLQEMKEEDHGEITCQFCQTTYNF--------
HSLO_STRPI      LKAIYGEAYKRLSEEEIRFQCDCSHERFMNALASLPSSDLQEMKEEDHGEITCQFCQTTYNF--------
HSLO_STRP7      LKAIYGEAYKRLSEEEIRFQCDCSHERFMNALASLPSSDLQEMKEEDHGEITCQFCQTTYNF--------
HSLO_STRP4      LKAIYGEAYKRLSEEEIRFQCDCSHERFMNALASLPSSDLQEMKEEDHGEITCQFCQTTYNF--------
HSLO_STRP2      LKAIYGEAYKRLSEEEIRFQCDCSHERFMNALASLPSSDLQEMKEEDHGEITCQFCQTTYNF--------
HSLO_GEOBB      LEQLLGIPYDILEKRNIAFACSCSRERIERVLLSMGKKELSSMKKDQHGEVTCEFCGEHYLF--------
HSLO_STRMU      LKAIYGEEDYKVLVEELQFTCDCSRQRFEAALMTLSKSDLKEMKEEDHGEIVCQFCGKKYQF--------
HSLO_STREM      LLAAIYGKEPYKRLAELSFQCDCSRERFASALMSLPKADLLTMLNEDKGEIVCQFCGTKYQF--------
HSLO_PROM0      IKKIFDESISKARSQEVSFKCKCSKQRSLNAMNMLDKSELEDLKKDGNAELVCEFCKNKYLIN-------
HSLO_GEOSM      LEQLLGIPYDILEKRNIAFACSCSRERIERVLLSMGKKELSSMKKDQHGEVTCEFCGERYLF--------
HSLO_PROM9      DDKSISEK---ARSQEVGFKCKCSKQRSLNAMKMLDKCELEDLKKDGRAELVCEFCKNKYLIN-------
HSLO_STRE4      LAAIYGEEYKRLAEEQLSFQCDCSRERFASALMSLPKADLLTMLNEDKGEIVCQFCGTKYQF--------
HSLO_STRP9      LEAIYGEPYKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGEIVCQFCGTKYQFN-------
HSLO_PROM5      IKNIFPDISENARTQEVRFECRCSKQRSLNAMKMLDKDELEDLKKEGKAELVCEFCKNKYLIN-------
HSLO_SYNJA      LQICLGDKIA-PEVRTIRFYCQCNSDRVKGALRMLGRDELIDMIRTDKGEAVCQFCNEVYRIS-------
HSLO_PROMP      DDKSISEK---ARTQEVRFECRCSRQRSLNAMKMLDKNELKDLIKEGKAELVCEFCKNKYLIN-------
HSLO_STRS7      LAAIYGEEYKRLAEEQLSFQCDCSKERFASALMNLPTADLQAMRDEDQGEIVCQFCGIKYQFT-------
HSLO_STRPC      LEAIYGEPYKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGEIVCQFCGTKYQFN-------
HSLO_STRPB      LEAIYGEPYKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGEIVCQFCGTKYQFN-------
HSLO_STRA1      LSAIYGEDYKRLSEDSLAFYCDCSKERFEAALLTLGTKELQAMKDEDKGEITCQFCNQTYYFT-------
HSLO_SYNS9      FPDLDPQPLTDTETQDVRFKCRCTRERSIGALLLLGRKELSEMEADGQAELTCHFCNNRYV---------
HSLO_STRPZ      LEAIYGEPYKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGEIVCQFCGTKYQFN-------
HSLO_THET2      XXXXXXXXXXFQNEIPARFRCRCNREKALEALVFFTPEEREEMVKEGGAEVVCHWCGEVYRFS-------
HSLO_STRPM      LEAIYGEPYKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGEIVCQFCGTKYQFN-------
HSLO_STRPG      LEAIYGEPYKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGEIVCQFCGTKYQFN-------
HSLO_STRPF      LEAIYGEPYKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGEIVCQFCGTKYQFN-------
HSLO_STRP8      LEAIYGEPYKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGEIVCQFCGTKYQFN-------
HSLO_STRP1      LEAIYGEPYKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGEIVCQFCGTKYQFN-------
HSLO_CARHZ      QEVVNPYKTEIYVKKPVGFLCSCSREKLLPHLIGL----YSEVKDEEIVEAVCHFCREKYTFS-------
HSLO_STRPD      LEAIYGEPYKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGEIVCQFCGTKYQFN-------
HSLO_STRU0      LSAIYGDE-GYKRLSELSFQCDCSKDRFESALMSLPNTDLQDMIDQDHGEIICQFCQTRYQFS-------
HSLO_GEOSL      LEYLFGIPFDILEKRATALVCSCSRERIERVXXXXXXXXXXXIHDQGEASVGCEFCGEHYNFT-------
HSLO_ACHLI      MINILSDNTGILEKHELKYHCGCSRKKYFDALSRLNKQALEDLHEDGQAEVVCQYCNKKYIYT-------
HSLO_STRA5      LSAIYGEDYKRLSEDSLAFYCDCSKERFEAALLTLGTKELQAMKDEDKGEITCQFCNQTYYFT-------
HSLO_STRA3      LSAIYGEDYKRLSEDSLAFYCDCSKERFEAALLTLGTKELQAMKDEDKGEITCQFCNQTYYFT-------
HSLO_SYNP6      XXXXXXXXXXXXXXAELRFFCPCTHQRMLGALKIFGAPELRDMIAKDQGEATCEFCSEVY----------
HSLO_SYNE7      XXXXXXXXXXXXXXAELRFFCPCTHQRMLGALKIFGAPELRDMIAKDQGEATCEFCSEVY----------
HSLO_STRP3      LEAIYGEPYKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGEIVCQFCGTKYQFN-------
HSLO_SYNSC      XXXXXXXXXXAEASQELRFFCPCSHERSKAALLLLGRDELTDMRKDGGAELTCHFCNNRY----------
HSLO_STRP6      LEAICGEPYKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGEIVCQFCGTKYQFN-------
HSLO_SYNJB      XXXXXXXKIA-PEMRTIRFYCKCNSDRVKGALRMLGRDELLDMIHTDKGEAVCQFCNEVYRIS-------
HSLO_STRSY      LSAIYGDDFKRLSEEEIGFVCDCSKDRFLDALASLPKADLQEMKEEDKGDITCQFCQTHYHF--------
HSLO_STRS2      LSAIYGDDFKRLSEEEIGFVCDCSKDRFLDALASLPKADLQEMKEEDKGDITCQFCQTHYHF--------
HSLO_ALKOO      LNHILGEEPVILETYDVDFVCDCSEERLEQVLISIGEKELTEIIEEDKAELVCHFCNKKYHF--------
HSLO_PELPD      LELLF-DSVAYLETRELFFRCGCGREKVERALLSLGGAELWDMTREGEARVTCEFCRQSYQF--------
HSLO_PELCD      IEELFGIPLGRNEETPLVFRCTCSRSQVLGMLKTLGEEELKDMAKDEQTSVVCEFCKERYSFS-------
HSLO_GEOLS      L--LEGVEHHPLESTNLFFRCGCSRDKVERALLSLGKAGLERMEEQGEAAVTCEFCKQQYRF--------
HSLO_ANAVT      LPEIFHDLLGFPESQILRFHCGCSFDRVLGALKMLGEAELQDMVKDDGAEATCDFCGRVY----------
HSLO_THET8      XXXXXXXXXXFQNEIPARFRCRCNREKALEALVFFTPEEREDMVKDGGAEVVCHWCGEVYRFS-------
HSLO_PROM1      IEEIFPDPSDIISTSEVRFKCRCSRERSLSALKILGKDELQKMIKEGKAELTCQFCKNVYL---------
HSLO_GLOVI      LEELLGD-MGFPEVQLVRFHCHCSPQRVLGALKMMGEAELLDMEKDGGAEATCHFCNQVY----------
HSLO_PROMT      IEEIFPDPSDIISTSEVHFKCRCSRERSLSALKILGKDELQKMIKEGKAELTCQFCKNVYL---------
HSLO_DEIRA      XXXXXXXXXXXXXXXPAHFSCRCSREKAIDSLKFFGAEERQEMIDEGGQEVLCHWCSEKY----------
HSLO_SYNS3      LKDVFPDPVG-EPLQPIQFSCPCSRERSINALRLFGKEELNKMLKEDKGELTCHFCSEVY----------
HSLO_SYNPW      PS---GEPMQPVE-----FHCPCSRERSLGALTLLGSEELNDMLENDRGELTCHFCSEVY----------
HSLO_SYMTH      LSVVLGIDYQILERRDLSFPCRCSRERALGAIALLDETELSGLVEEGRGELTCHFCNAVYRFS-------
HSLO_PROM4      FYNLNPEIVGPSARQEIKYRCKCSRDRSISALKLLGNSEIKSLNEDKKAEITCEFCKNVY----------
HSLO_SYNR3      LRDVFPDEVLADEQAEVEFFCPCTRERSRXXXXXXXXXXXXDMEKDNGAELTCHFCGEVYRFS-------
HSLO_NOSP7      LTEIFSDLLGFSERQMLRFHCGCSFDRVLGALKILGEAELQDMVKDNGAEATCDFCSNVY----------
HSLO_PROMA      IKTMDNNQ-------SISFKCRCSRDRSISAXXXXXXXXXXXMNEDKKSELTCNFCNEIY----------
HSLO_SYNPX      XXXXXXXXXXXXASQSVNFHCRCTRERSVAALLLMGRTELADMEKDGGAELNCHFCSNNYVVS-------
HSLO_MICAN      LEDIFQELLGFPAVQMLRFDCDCSFERALGALKFLGVDELKDIEKDKQAEAICEFCREVY----------
HSLO_TERTT      LYRLFNEGCRLFAAREFRFHCSCNRARGENAISSLGKEEAFALLAEQNGKIACHFCGQHYAF--------
HSLO_HAEDU      LYRLFHEQVEVYPAQTTAFKCGCSRERSGQAMLLLPMAEIEEMLAEKKGDMQCECCGTQYFF--------
HSLO_CHRVO      LHRLFHEEVRVFEQETVSFNCNCSRERVSNMLTMLGGQEVGDLLEQGSVEIVCDYCNQRYVF--------
HSLO_SHESW      LHRLYHEEVRLFDPIEVSFKCTCSRERSAAAIKTLEQAEVEALAEEGKIEMGCEYCNANYVF--------
HSLO_SHEPC      LHRLYHEEVRLFDPIEVSFKCTCSRERSAAAIKTLEQAEVEALAEEGKIEMGCEYCNANYVF--------
HSLO_PECCP      LYRLYQEEVTVYEPQDVEFRCHCSRDRCADALMTLSDQEVNEMEQDGEIDMHCDYCGTHYLFN-------
HSLO_HAES2      LYRLYHEEVEIYPPSAVEFHCGCSLERSGSALLLISDDEIENILTEGSIDMQCECCGTHYFF--------
HSLO_HAEIN      LYRLYHEEVNLYPAQDVQFFCGCSAERSSSALLLISDEEIDEILAEHKGDMQCECCGTHYFFN-------
HSLO_HAEIG      LYRLYHEEVNLYPAQDVQFFCGCSAERSSSALLLISDEEIDEILAEHKGDMQCECCGTHYFFN-------
HSLO_HAEI8      LYRLYHEEVNLYPAQDVQFFCGCSAERSSSALLLISDEEIDEILAEHKGDMQCECCGTHYFFN-------
HSLO_ERWCT      LYRLYHEEVTVYEPQDVEFQCHCSRDRCANALMTLSDQEINEMEQDGEIDMHCDYCGTHYLFN-------
HSLO_HAES1      LYRLYHEEVEIYPPSAVEFHCGCSLERSGSALLLISDDEIENILTEGSIDMQCECCGTHYFF--------
HSLO_HAEIE      LYRLYHEEVNLYPEQDVQFFCGCSAERSGSALLLISDEEIDEILAEHKGDMQCECCGTHYFFN-------
HSLO_ACTP7      HE----EQVEVYPPQETEFYCGCSRERSGNAILLLPMEEIDEMLAEKNGDMQCECCGTQYFF--------
HSLO_SHELP      LHRLYHEEVRLFDPIEVTFSCTCSRERSGQALKTVAKEELDALAEQGKIEMGCEYCNSSYSF--------
HSLO_SALTI      LWRLYHEEVTLYDPQEVEFKCTCSRERCAGALKTLPDEEVDSLAEEGEIDMHCDYCGNHYLFN-------
HSLO_SHESA      LHRLYHEEVRLFDPIEVSFKCTCSRERSAAAIKTIDQAEVEALAEDGKVEMGCEYCNAKYVF--------
HSLO_ACTPJ      HE----EQVEVYPPQETEFHCGCSRGRSGNAILLLPMEEIDEMLAEKNGDMQCECCGTQYFF--------
HSLO_SHEDO      LHRLYHEEVRLFEPMDVSFKCTCSRERSAGALKTLSLVELETLAEEGKIDMGCEYCTASYSF--------
HSLO_SALPK      LWRLYHEEVTLYDPQDVEFKCTCSRERCAGALKTLPDEEVDSLAEEGEIDMHCDYCGNHYLFN-------
HSLO_SALPA      LWRLYHEEVTLYDPQDVEFKCTCSRERCAGALKTLPDEEVDSLAEEGEIDMHCDYCGNHYLFN-------
HSLO_PHOLL      LHRLYHEEVILYEPQAVEFRCTCSRQRCADTLVTLSDEDVNHLQKDGNIDMACEYCGTHYIF--------
HSLO_ACTP2      HE----EQVEVYPPQETEFHCGCSRGRSGNAILLLPMEEIDEMLAEKNGDMQCECCGTQYFF--------
HSLO_SHEB9      LHRLYHEEVRLFDPIDVSFKCTCSHERSAGAIKTLDQAEIEALAEDGKIEMGCEYCHAKYIF--------
HSLO_SHEB8      LHRLYHEEVRLFDPIDVSFKCTCSHERSAGAIKTLDQAEIEALAEDGKIEMGCEYCHAKYIF--------
HSLO_SHEB5      LHRLYHEEVRLFDPIDVSFKCTCSHERSAGAIKTLDQAEIEALAEDGKIEMGCEYCHAKYIF--------
HSLO_SHEB2      LHRLYHEEVRLFDPIDVSFKCTCSHERSAGAIKTLDQAEIEALAEDGKIEMGCEYCHAKYIF--------
HSLO_SALTY      LWRLYHEEVTLYDPQNVEFKCTCSRERCAGALKTLPDEEVDSLAEEGEIDMHCDYCGNHYLFN-------
HSLO_SALCH      LWRLYHEEVTLYDPQNVEFKCTCSRERCAGALKTLPDEEVDSLAEEGEIDMHCDYCGNHYLFN-------
HSLO_ALISL      LYRLYNQKVQLFEPQNVEFFCGCSRERSGGAIITIERSEVDDIATEGKVSLHCDYCGTSYDF--------
HSLO_SHESR      LHRLYHEDVRLFDPIEVCFKCTCSRERSAAAIKTIDQAEVEALAEDGKVEMGCEYCNAKYVF--------
HSLO_SHESM      LHRLYHEDVRLFDPIEVCFKCTCSRERSAAAIKTIDQAEVEALAEDGKVEMGCEYCNAKYVF--------
HSLO_ENT38      LWRLYHEEVTLYDPQDVEFKCTCSRERCAGALRTLPDEEIDSMAEDGEIDMNCDYCGSHYVFN-------
HSLO_AERS4      LYRLYHQKVRVFDPQAVEFRCTCSRARCEGALLQIEKEEVLDMVQEGKIDMHCDYCGAQYQF--------
HSLO_SHEON      LHRLYHEEVRLFDPIEVSFKCTCSRERSAAAIKTIDQAEVEALAEDGNVEMGCEYCNAKYLF--------
HSLO_ESCF3      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLAEEGEIDMHCDYCGNHYLFN-------
HSLO_PHOPR      LYRLYHEEVKLFDPQSVEFHCGCSRERSASAICSIERIEVEKIADEGKVSLHCDYCGTSYDF--------
HSLO_CHRSD      LYRLFHEEQARVEPKALRFGCTCTRERIASALHGLGADELRHVREQGAVETQCHFCHSHYRFT-------
HSLO_SERP5      LYRLYHEEVTLYEPQDVVFRCTCSRQRCADALITLPAEEVAQMEQDGNIDMHCDYCGNHYVF--------
HSLO_SHISS      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------
HSLO_SHIFL      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------
HSLO_SHIF8      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------
HSLO_SHIDS      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------
HSLO_SHEWM      LHRLYHEEVRLFEPVAVTFSCTCSRERSASAIRTVSREEIESLAEQGKIEMGCEYCNTNYSF--------
HSLO_PSEF5      LHRLYHEEVRLFDVQPLRFRCSCSRERSGNALVSLGLEDAQQLVVEGSIEIDCQFCNERYLF--------
HSLO_ECOSM      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------
HSLO_ECOLU      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLTEDGEIDMHCDYCGNHYLFN-------
HSLO_ECOLI      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------
HSLO_ECOL6      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------
HSLO_ECODH      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------
HSLO_ECOBW      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------
HSLO_ECO8A      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------
HSLO_ECO81      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------
HSLO_ECO57      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------
HSLO_ECO55      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------
HSLO_ECO45      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------
HSLO_ECO27      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------
HSLO_CAUCR      LWRLFNEDVRLLDEKPLKAFCRCSEDRIGVVMDSFSAEEVAEMEPDGKIHVTCEYCSRIY----------
HSLO_CAUCN      LWRLFNEDVRLLDEKPLKAFCRCSEDRIGVVMDSFSAEEVAEMEPDGKIHVTCEYCSRIY----------
HSLO_VIBFM      LYRLYNQKVQLFEPQDVEFFCGCSRERSGGAIVTIDRAEVDDIIKEGKISLHCDYCGTSYDF--------
HSLO_VIBF1      LYRLYNQKVQLFEPQDVEFFCGCSRERSGGAIVTIDRAEVDDIIKEGKISLHCDYCGTSYDF--------
HSLO_ECO7I      LWRLYHEEVTVYDPQDVEFKCTCSRERCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------
HSLO_ACTSZ      LYRLYEEQVEIYAPQAVTFHCGCSAERSGAALLLISDAELDEILAEHNGDMQCECCGTHYFFN-------
HSLO_SHEPW      LHRLYHEEVRLFEPVAITFNCTCSKERSAQAIRTVAKEEIDSIAEQGKIEMGCEYCNSKYVF--------
HSLO_ENTS8      LWRLYHEEVTVYDPQAVEFKCTCSRERCADALRTLDEEVAQILEEDGEVDMHCDYCGTHYVF--------
HSLO_SHIBS      LWRLYHEEVTVYDPQDVEFKCTCSREHCADALKTLPDEEVDSLAEDGEIDMHCDYCGNHYLFN-------
HSLO_PSEPF      LHRLYHEEVRLFDVQKLRFHCSCSRERSGNALVSLGLEDAQALVAEGQVEIDCQFCNQRYLF--------
HSLO_PSEA7      LHRLYHEEVRLFEPQPLVFHCSCSRERSANALVSLGQADCERLLEEEEGAITCQFCNQRYLF--------
HSLO_PSEA6      LYRLYHEEIEVYPPADIIFKCSCSRERSANALAAVEKAELLDVATEGAIKMNCQYCHREYRF--------
HSLO_SHESH      LHRLYHEEVRLFDPIEVTFSCTCSRERSASAIRTVSKAEIDTIAEQGKIEMGCEYCNTTYDF--------
HSLO_NITOC      LYRLFNEEVRLFEPEPVSFRCGCSRGRIEQTLAALGREEMESILKEGIIEVDCEFCNRHYNF--------
HSLO_VIBPA      LYRLYNQKVRVYEPQPVAFHCGCSRERSGAAIITVEKAEIYDILAEGSVSLHCDYCGTTYTF--------
HSLO_SODGM      LYRLYHQDNVTVYPAQVQFLCTCSRQRCADALMTLGEQELHDMEQDGEVDMHCDFCGSHYRF--------
HSLO_NEIG2      LYRLFHETPPRVEPETFESSCTCSRGKVSDXXXXXXXXXXXXXXAEGSIEVDCDFCHSKYVF--------
HSLO_NEIG1      LYRLFHETPPRVEPETFESSCTCSRGKVSDXXXXXXXXXXXXXXAEGSIEVDCDFCHSKYVF--------
HSLO_PROMH      LHRLYHEEVTLYDPQPIAFHCTCSRKRCEDTLVTLSKEDVAHLQEQGKIDMECEYCGAHYIFT-------
HSLO_YERPS      LYRLYQEEVTLYEPQNVSFRCTCSRQRCXXXXXXXXXXXXXEMEQDGNIDMHCEYCGNHYLF--------
HSLO_YERPP      LYRLYQEEVTLYEPQNVSFRCTCSRQRCXXXXXXXXXXXXXEMEQDGNIDMHCEYCGNHYLF--------
HSLO_YERPN      LYRLYQEEVTLYEPQNVSFRCTCSRQRCXXXXXXXXXXXXXEMEQDGNIDMHCEYCGNHYLF--------
HSLO_YERPG      LYRLYQEEVTLYEPQNVSFRCTCSRQRCXXXXXXXXXXXXXEMEQDGNIDMHCEYCGNHYLF--------
HSLO_YERPE      LYRLYQEEVTLYEPQNVSFRCTCSRQRCXXXXXXXXXXXXXEMEQDGNIDMHCEYCGNHYLF--------
HSLO_YERPB      LYRLYQEEVTLYEPQNVSFRCTCSRQRCXXXXXXXXXXXXXEMEQDGNIDMHCEYCGNHYLF--------
HSLO_YERPA      LYRLYQEEVTLYEPQNVSFRCTCSRQRCXXXXXXXXXXXXXEMEQDGNIDMHCEYCGNHYLF--------
HSLO_YERP3      LYRLYQEEVTLYEPQNVSFRCTCSRQRCXXXXXXXXXXXXXEMEQDGNIDMHCEYCGNHYLF--------
HSLO_PSEHT      LTRLYHEDNPRVEPQSIQFKCGCTREKTMTALVNIGQQALDDVAEHGEIKISCHYCLKDYLF--------
HSLO_SHEFN      LHRLYHEEVRLFDPVDVTFKCSCSRDRSAAAIKTLPQTEVEELAEEGKIEMDCEYCTAKYSF--------
HSLO_PSEAB      LHRLYHEEVRLFEPQPLVFHCSCSRERSANALVSLGQADCERLLEEEEGSITCQFCNQRYLF--------
HSLO_VIBVY      LYRLYNEQVRLFEPQNVEFRCGCSRERSGAAIVTVDKNEIYDLASDGSVSLHCDYCGTTYSF--------
HSLO_VIBVU      LYRLYNEQVRLFEPQNVEFRCGCSRERSGAAIVTVDKNEIYDLASDGSVSLHCDYCGTTYSF--------
HSLO_PSEFS      LHRLYHEEVRLFEEQSLRFNCSCSRERSANALVSLGLEDAQNLVVEGNIEIDCQFCNERYLF--------
HSLO_PSEAE      LHRLYHEEVRLFEPQPLVFHCSCSRERSANALVSLGQADCERLLEEEEGSISCQFCNQRYLF--------
HSLO_PSEA8      LHRLYHEEVRLFEPQPLVFHCSCSRERSANALVSLGQADCERLLEEEEGSISCQFCNQRYLF--------
HSLO_PSEPW      LHRLYHEDVRLFDIQPLRFKCSCSRERSGNALVSLGEQDAKQLVEEGKVEIDCQFCNERYFF--------
HSLO_YERPY      LYRLYQEEVTLYEPQNVSFRCTCSRQRCXXXXXXXXXXXXXEMEQDGNIDMHCEYCGNHYLF--------
HSLO_VIBHB      LYRLYNQSVRLYEPQPVAFHCGCSRERSGAAIITVERAEINDLAEEGSVSLHCDYCGTSYSF--------
HSLO_VIBCH      --RLYNETVQLFTPQQISFRCGCSRERSAAAIVTVAREEINDLAQDGAVALHCDYCGTTYSF--------
HSLO_PASMU      XXXXXXXXXXIFPSQPISFFCGCSQERSGAALLLISDEELDEVLAEHNGDMQCECCGTHYFFN-------
HSLO_COLP3      LYRLYQEQVNIFEPQMVSYLCGCSADKCLSAISQIEPSEIKAILAEGKISMTCDYCITTYDF--------
HSLO_METFK      IKRLFNEEVRLFKEQPIKFHCGCSRESVGNMLRMLGEEEVADILAEQHTDINCDFCNAEYHF--------
HSLO_AZOVD      LRRLYHEAVRLFEPLPLRFRCSCSRERSANALSSLGQADAEQLLRERDGLVVCQFCNQRYEF--------
HSLO_ERWT9      LWRLYHEEVTLFDPQAVSFKCSCSRQRCGEVLRTLPPEEVDQMQEDGHIDMHCDYCGNNYVY--------
HSLO_PSE14      LHRLYHEDVRLFDAQPICFRCSCSRERSANALVSLGLEDAQQLVIEHNGEIDCQFCNERYLF--------
HSLO_PSEU2      LHRLYHEDVRLFDEQPICFRCSCSRERSANALASLGLEDAQQLVIEHNGEIDCQFCNQRYLF--------
HSLO_PSESM      LHRLYHEDVRLFDVQPICFRCSCSRERSANALASLGLEDAQQLVIEHNGEIDCQFCNERYLF--------
HSLO_MANSM      LYRLYHEEVELYEPQAIQFHCGCSQERSGSAXXXXXXXXXXXXXXXHNGDMQCECCGTHYFFN-------
HSLO_PSEPG      LHRLYHEDVRLFDIQPLRFNCSCSRERSGNALVSLGEHDAKALVEEGTVEIDCQFCNERYFF--------
HSLO_PSEPK      LHRLYHEDVRLFDIQPLRFNCSCSRERSGNALVSLGEHDAKALVDEGTVEIDCQFCNERYFF--------
HSLO_ALCBS      LRRLFHDTPPQLPDAQLRFGCTCSRERNRNALISLNXXXXXXXXXDGEVTLTCDFC--------------
HSLO_PSEP1      LHRLYHEDVRLFDIQPLRFNCSCSRERSGNALVSLGEHDAKALVDEGTVEIDCQFCNERYFF--------
HSLO_NEIMB      LYRLFHETPPRVEPETFEFSCTCSRGKVSDMLLMLXXXXXXXXXXXXXXXXXCDFCHSKYVF--------
HSLO_PSEE4      LHRLYHEDVRLFDIQPLXXXXXXXXXXXXNALVSLGEQDAKALVEEGTVEIDCQFCNERYLF--------
HSLO_NEIMA      LYRLFHETPPRVEPETFEFSCTCSRGKVSDMLLMLXXXXXXXXXXXXXXXXXCDFCHSKYVF--------
HSLO_EDWI9      LYRLYNEQVTLFEPQPIAFLCGCSRGRSASALMSXXXXXXXXXXAEGSIDIHCDYCGSHYLF--------
HSLO_HAHCH      LHRLFHEEVRVLQEEPASFWCSCSEERTLEVVKSLGREEAFSILDEGEIEMNCQFCLQRYSF--------
COPD_DICDI      DKALFGEQKGFPSGGILKWRCKTNQE--------------------------------------------


                         .         *         .         .         .         .         +:350
query           XKFKVDDSGS
HSLO_THEMA      XKFKVDDSGS
HSLO_THEP1      XKFKVDNSGS
HSLO_THESQ      XKFKVDNSGS
HSLO_THEM4      ----------
HSLO_CLOCE      ----------
HSLO_BACA2      ----------
HSLO_BACSU      ----------
HSLO_GEOSW      ----------
HSLO_BACSK      ----------
HSLO_BACCN      ----------
HSLO_CLOB8      ----------
HSLO_BACST      ----------
HSLO_BACLD      ----------
HSLO_CLOPE      ----------
HSLO_CLOP1      ----------
HSLO_CLOBB      ----------
HSLO_SYNP2      ----------
HSLO_CLOPS      ----------
HSLO_CLOBA      ----------
HSLO_STAHJ      ----------
HSLO_AQUAE      ----------
HSLO_CLOBL      ----------
HSLO_CLOBK      ----------
HSLO_CLOBH      ----------
HSLO_CLOB1      ----------
HSLO_OCEIH      ----------
HSLO_CLOTE      ----------
HSLO_CLOB6      ----------
HSLO_THEPX      ----------
HSLO_THEP3      ----------
HSLO_LACAC      LAKKKDD---
HSLO_LACBA      ----------
HSLO_CLOBJ      ----------
HSLO_LACF3      ----------
HSLO_ACAM1      ----------
HSLO_LACSS      ----------
HSLO_EUBR3      ----------
HSLO_BACHK      ----------
HSLO_BACCZ      ----------
HSLO_BACCQ      ----------
HSLO_BACC7      ----------
HSLO_BACC3      ----------
HSLO_BACC1      ----------
HSLO_BACC0      ----------
HSLO_BACAN      ----------
HSLO_BACAH      ----------
HSLO_BACAC      ----------
HSLO_BACAA      ----------
HSLO_CLOBM      ----------
HSLO_BACP2      ----------
HSLO_BACCR      ----------
HSLO_BACC4      ----------
HSLO_ENTFA      ----------
HSLO_BACC2      ----------
HSLO_BACWK      ----------
HSLO_LACH4      ----------
HSLO_CLOTH      ----------
HSLO_CLOAB      ----------
HSLO_LACC3      ----------
HSLO_TRIEI      ----------
HSLO_STACT      ----------
HSLO_LACCB      ----------
HSLO_GEOKA      ----------
HSLO_LISIN      ----------
HSLO_LISMO      ----------
HSLO_LISMH      ----------
HSLO_LISMF      ----------
HSLO_LISMC      ----------
HSLO_DESPS      ----------
HSLO_STAES      ----------
HSLO_STAEQ      ----------
HSLO_THETN      ----------
HSLO_ANASP      ----------
HSLO_THEYD      ----------
HSLO_CYAP4      ----------
HSLO_CLOD6      ----------
HSLO_STRSV      ----------
HSLO_THEEB      ----------
HSLO_STRGC      ----------
HSLO_LACJO      ----------
HSLO_DESRM      ----------
HSLO_CLOPH      ----------
HSLO_STRTD      ----------
HSLO_STAAW      ----------
HSLO_STAAT      ----------
HSLO_STAAS      ----------
HSLO_STAAR      ----------
HSLO_STAAE      ----------
HSLO_STAAC      ----------
HSLO_STAAB      ----------
HSLO_STAA8      ----------
HSLO_STAA3      ----------
HSLO_LACPL      ----------
HSLO_STRT1      ----------
HSLO_STAAN      ----------
HSLO_STAAM      ----------
HSLO_STAA9      ----------
HSLO_STAA2      ----------
HSLO_STAA1      ----------
HSLO_LACDA      ----------
HSLO_CLONN      ----------
HSLO_STRT2      ----------
HSLO_LACDB      ----------
HSLO_LACLA      ----------
HSLO_SYNY3      ----------
HSLO_STAS1      ----------
HSLO_BACHD      ----------
HSLO_LACLM      ----------
HSLO_GEOMG      ----------
HSLO_LACLS      ----------
HSLO_PROM2      ----------
HSLO_CYAP7      ----------
HSLO_ALKMQ      ----------
HSLO_CYAP8      ----------
HSLO_BREBN      ----------
HSLO_FINM2      ----------
HSLO_LISW6      ----------
HSLO_PROMS      ----------
HSLO_STRPS      ----------
HSLO_STRZT      ----------
HSLO_STRZP      ----------
HSLO_STRZJ      ----------
HSLO_STRR6      ----------
HSLO_STRPN      ----------
HSLO_STRPJ      ----------
HSLO_STRPI      ----------
HSLO_STRP7      ----------
HSLO_STRP4      ----------
HSLO_STRP2      ----------
HSLO_GEOBB      ----------
HSLO_STRMU      ----------
HSLO_STREM      ----------
HSLO_PROM0      ----------
HSLO_GEOSM      ----------
HSLO_PROM9      ----------
HSLO_STRE4      ----------
HSLO_STRP9      ----------
HSLO_PROM5      ----------
HSLO_SYNJA      ----------
HSLO_PROMP      ----------
HSLO_STRS7      ----------
HSLO_STRPC      ----------
HSLO_STRPB      ----------
HSLO_STRA1      ----------
HSLO_SYNS9      ----------
HSLO_STRPZ      ----------
HSLO_THET2      ----------
HSLO_STRPM      ----------
HSLO_STRPG      ----------
HSLO_STRPF      ----------
HSLO_STRP8      ----------
HSLO_STRP1      ----------
HSLO_CARHZ      ----------
HSLO_STRPD      ----------
HSLO_STRU0      ----------
HSLO_GEOSL      ----------
HSLO_ACHLI      ----------
HSLO_STRA5      ----------
HSLO_STRA3      ----------
HSLO_SYNP6      ----------
HSLO_SYNE7      ----------
HSLO_STRP3      ----------
HSLO_SYNSC      ----------
HSLO_STRP6      ----------
HSLO_SYNJB      ----------
HSLO_STRSY      ----------
HSLO_STRS2      ----------
HSLO_ALKOO      ----------
HSLO_PELPD      ----------
HSLO_PELCD      ----------
HSLO_GEOLS      ----------
HSLO_ANAVT      ----------
HSLO_THET8      ----------
HSLO_PROM1      ----------
HSLO_GLOVI      ----------
HSLO_PROMT      ----------
HSLO_DEIRA      ----------
HSLO_SYNS3      ----------
HSLO_SYNPW      ----------
HSLO_SYMTH      ----------
HSLO_PROM4      ----------
HSLO_SYNR3      ----------
HSLO_NOSP7      ----------
HSLO_PROMA      ----------
HSLO_SYNPX      ----------
HSLO_MICAN      ----------
HSLO_TERTT      ----------
HSLO_HAEDU      ----------
HSLO_CHRVO      ----------
HSLO_SHESW      ----------
HSLO_SHEPC      ----------
HSLO_PECCP      ----------
HSLO_HAES2      ----------
HSLO_HAEIN      ----------
HSLO_HAEIG      ----------
HSLO_HAEI8      ----------
HSLO_ERWCT      ----------
HSLO_HAES1      ----------
HSLO_HAEIE      ----------
HSLO_ACTP7      ----------
HSLO_SHELP      ----------
HSLO_SALTI      ----------
HSLO_SHESA      ----------
HSLO_ACTPJ      ----------
HSLO_SHEDO      ----------
HSLO_SALPK      ----------
HSLO_SALPA      ----------
HSLO_PHOLL      ----------
HSLO_ACTP2      ----------
HSLO_SHEB9      ----------
HSLO_SHEB8      ----------
HSLO_SHEB5      ----------
HSLO_SHEB2      ----------
HSLO_SALTY      ----------
HSLO_SALCH      ----------
HSLO_ALISL      ----------
HSLO_SHESR      ----------
HSLO_SHESM      ----------
HSLO_ENT38      ----------
HSLO_AERS4      ----------
HSLO_SHEON      ----------
HSLO_ESCF3      ----------
HSLO_PHOPR      ----------
HSLO_CHRSD      ----------
HSLO_SERP5      ----------
HSLO_SHISS      ----------
HSLO_SHIFL      ----------
HSLO_SHIF8      ----------
HSLO_SHIDS      ----------
HSLO_SHEWM      ----------
HSLO_PSEF5      ----------
HSLO_ECOSM      ----------
HSLO_ECOLU      ----------
HSLO_ECOLI      ----------
HSLO_ECOL6      ----------
HSLO_ECODH      ----------
HSLO_ECOBW      ----------
HSLO_ECO8A      ----------
HSLO_ECO81      ----------
HSLO_ECO57      ----------
HSLO_ECO55      ----------
HSLO_ECO45      ----------
HSLO_ECO27      ----------
HSLO_CAUCR      ----------
HSLO_CAUCN      ----------
HSLO_VIBFM      ----------
HSLO_VIBF1      ----------
HSLO_ECO7I      ----------
HSLO_ACTSZ      ----------
HSLO_SHEPW      ----------
HSLO_ENTS8      ----------
HSLO_SHIBS      ----------
HSLO_PSEPF      ----------
HSLO_PSEA7      ----------
HSLO_PSEA6      ----------
HSLO_SHESH      ----------
HSLO_NITOC      ----------
HSLO_VIBPA      ----------
HSLO_SODGM      ----------
HSLO_NEIG2      ----------
HSLO_NEIG1      ----------
HSLO_PROMH      ----------
HSLO_YERPS      ----------
HSLO_YERPP      ----------
HSLO_YERPN      ----------
HSLO_YERPG      ----------
HSLO_YERPE      ----------
HSLO_YERPB      ----------
HSLO_YERPA      ----------
HSLO_YERP3      ----------
HSLO_PSEHT      ----------
HSLO_SHEFN      ----------
HSLO_PSEAB      ----------
HSLO_VIBVY      ----------
HSLO_VIBVU      ----------
HSLO_PSEFS      ----------
HSLO_PSEAE      ----------
HSLO_PSEA8      ----------
HSLO_PSEPW      ----------
HSLO_YERPY      ----------
HSLO_VIBHB      ----------
HSLO_VIBCH      ----------
HSLO_PASMU      ----------
HSLO_COLP3      ----------
HSLO_METFK      ----------
HSLO_AZOVD      ----------
HSLO_ERWT9      ----------
HSLO_PSE14      ----------
HSLO_PSEU2      ----------
HSLO_PSESM      ----------
HSLO_MANSM      ----------
HSLO_PSEPG      ----------
HSLO_PSEPK      ----------
HSLO_ALCBS      ----------
HSLO_PSEP1      ----------
HSLO_NEIMB      ----------
HSLO_PSEE4      ----------
HSLO_NEIMA      ----------
HSLO_EDWI9      ----------
HSLO_HAHCH      ----------
COPD_DICDI      ----------