[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tmar0:AAD36720.1

[Show Plain Result]


## Summary of Sequence Search
    1::434
    1::432     e-116  51%  433 aa  PDP_BACST RecName: Full=Pyrimidine-nucleoside phosphorylase;       
    1::431     e-115  50%  433 aa  PDP_STAHJ RecName: Full=Pyrimidine-nucleoside phosphorylase;       
    1::424     e-113  50%  433 aa  PDP_STAAC RecName: Full=Pyrimidine-nucleoside phosphorylase;       
    1::424     e-113  50%  433 aa  PDP_STAA8 RecName: Full=Pyrimidine-nucleoside phosphorylase;       
    1::424     e-113  50%  433 aa  PDP_STAA3 RecName: Full=Pyrimidine-nucleoside phosphorylase;       
    1::431     e-113  49%  433 aa  PDP_STAEQ RecName: Full=Pyrimidine-nucleoside phosphorylase;       
    1::424     e-113  50%  433 aa  PDP_STAAB RecName: Full=Pyrimidine-nucleoside phosphorylase;       
    1::433     e-113  49%  433 aa  PDP_STAAW RecName: Full=Pyrimidine-nucleoside phosphorylase;       
    1::433     e-113  49%  433 aa  PDP_STAAS RecName: Full=Pyrimidine-nucleoside phosphorylase;       
    1::424     e-113  50%  433 aa  PDP_STAAN RecName: Full=Pyrimidine-nucleoside phosphorylase;       
    1::424     e-113  50%  433 aa  PDP_STAAM RecName: Full=Pyrimidine-nucleoside phosphorylase;       
    1::431     e-112  49%  433 aa  PDP_STAES RecName: Full=Pyrimidine-nucleoside phosphorylase;       
    1::433     e-112  49%  433 aa  PDP_STAAR RecName: Full=Pyrimidine-nucleoside phosphorylase;       
    1::431     e-112  50%  433 aa  PDP_BACSU RecName: Full=Pyrimidine-nucleoside phosphorylase;       
    4::434     2e-86  42%  443 aa  TYPH_SHEWM RecName: Full=Thymidine phosphorylase;       
   11::437     5e-85  40%  438 aa  TYPH_COLP3 RecName: Full=Thymidine phosphorylase;       
    7::437     3e-84  41%  438 aa  TYPH_RHISN RecName: Full=Thymidine phosphorylase;       
    4::400     3e-83  44%  443 aa  TYPH_SHEPW RecName: Full=Thymidine phosphorylase;       
    4::400     3e-83  43%  443 aa  TYPH_SHELP RecName: Full=Thymidine phosphorylase;       
    4::434     3e-83  41%  443 aa  TYPH_SHEDO RecName: Full=Thymidine phosphorylase;       
    7::424     3e-83  42%  446 aa  TYPH_PSYIN RecName: Full=Thymidine phosphorylase;       
    4::400     5e-83  44%  443 aa  TYPH_SHEHH RecName: Full=Thymidine phosphorylase;       
    4::400     1e-82  43%  443 aa  TYPH_SHESH RecName: Full=Thymidine phosphorylase;       
    4::434     2e-82  42%  443 aa  TYPH_SHEB5 RecName: Full=Thymidine phosphorylase;       
    4::400     2e-82  44%  443 aa  TYPH_SHEPA RecName: Full=Thymidine phosphorylase;       
    4::434     4e-82  42%  443 aa  TYPH_SHEB2 RecName: Full=Thymidine phosphorylase;       
    1::397     5e-82  42%  439 aa  TYPH_RHILO RecName: Full=Thymidine phosphorylase;       
    4::402     7e-82  45%  443 aa  TYPH_SHEFN RecName: Full=Thymidine phosphorylase;       
    4::434     9e-82  42%  443 aa  TYPH_SHESW RecName: Full=Thymidine phosphorylase;       
    4::434     9e-82  42%  443 aa  TYPH_SHEPC RecName: Full=Thymidine phosphorylase;       
    3::437     1e-81  39%  440 aa  TYPH_RHIME RecName: Full=Thymidine phosphorylase;       
    4::434     2e-81  41%  443 aa  TYPH_SHEB9 RecName: Full=Thymidine phosphorylase;       
    4::434     2e-81  41%  443 aa  TYPH_SHEB8 RecName: Full=Thymidine phosphorylase;       
    4::438     6e-81  41%  440 aa  TYPH_SALHS RecName: Full=Thymidine phosphorylase;       
    4::434     7e-81  41%  443 aa  TYPH_SHEON RecName: Full=Thymidine phosphorylase;       
    4::434     1e-80  41%  443 aa  TYPH_SHESR RecName: Full=Thymidine phosphorylase;       
    4::434     1e-80  41%  443 aa  TYPH_SHESM RecName: Full=Thymidine phosphorylase;       
    4::438     1e-80  41%  440 aa  TYPH_SALPK RecName: Full=Thymidine phosphorylase;       
    4::438     1e-80  41%  440 aa  TYPH_SALPA RecName: Full=Thymidine phosphorylase;       
    4::438     1e-80  41%  440 aa  TYPH_SALSV RecName: Full=Thymidine phosphorylase;       
    4::438     2e-80  41%  440 aa  TYPH_SALTY RecName: Full=Thymidine phosphorylase;       
    4::438     2e-80  41%  440 aa  TYPH_SALTI RecName: Full=Thymidine phosphorylase;       
    4::438     2e-80  41%  440 aa  TYPH_SALNS RecName: Full=Thymidine phosphorylase;       
    4::438     2e-80  41%  440 aa  TYPH_SALG2 RecName: Full=Thymidine phosphorylase;       
    4::438     2e-80  41%  440 aa  TYPH_SALEP RecName: Full=Thymidine phosphorylase;       
    4::438     2e-80  41%  440 aa  TYPH_SALDC RecName: Full=Thymidine phosphorylase;       
    4::438     2e-80  41%  440 aa  TYPH_SALA4 RecName: Full=Thymidine phosphorylase;       
    4::438     2e-80  41%  443 aa  TYPH_SHEAM RecName: Full=Thymidine phosphorylase;       
    4::438     2e-80  41%  440 aa  TYPH_ENT38 RecName: Full=Thymidine phosphorylase;       
    4::438     4e-80  41%  440 aa  TYPH_SALCH RecName: Full=Thymidine phosphorylase;       
    4::438     4e-80  41%  440 aa  TYPH_SALAR RecName: Full=Thymidine phosphorylase;       
    4::438     6e-80  41%  440 aa  TYPH_KLEP7 RecName: Full=Thymidine phosphorylase;       
    6::437     1e-79  40%  442 aa  TYPH_VIBPA RecName: Full=Thymidine phosphorylase;       
    4::434     2e-79  41%  443 aa  TYPH_SHESA RecName: Full=Thymidine phosphorylase;       
    4::438     7e-79  39%  440 aa  TYPH_PROMH RecName: Full=Thymidine phosphorylase;       
    4::438     9e-79  41%  440 aa  TYPH_KLEP3 RecName: Full=Thymidine phosphorylase;       
    6::438     9e-79  41%  443 aa  TYPH_AERHH RecName: Full=Thymidine phosphorylase;       
    4::400     1e-78  42%  443 aa  TYPH_SODGM RecName: Full=Thymidine phosphorylase;       
    6::438     2e-78  41%  443 aa  TYPH_VIBF1 RecName: Full=Thymidine phosphorylase;       
    6::438     2e-78  41%  443 aa  TYPH_ALISL RecName: Full=Thymidine phosphorylase;       
    6::438     2e-78  41%  443 aa  TYPH_VIBFM RecName: Full=Thymidine phosphorylase;       
    4::434     3e-78  40%  440 aa  TYPH_YERE8 RecName: Full=Thymidine phosphorylase;       
    6::438     8e-78  40%  443 aa  TYPH_AERS4 RecName: Full=Thymidine phosphorylase;       
    7::428     1e-77  39%  438 aa  TYPH_AGRT5 RecName: Full=Thymidine phosphorylase;       
    4::441     2e-77  38%  446 aa  TYPH_IDILO RecName: Full=Thymidine phosphorylase;       
    4::434     4e-77  40%  440 aa  TYPH_SERP5 RecName: Full=Thymidine phosphorylase;       
    4::438     5e-76  40%  440 aa  TYPH_SHIDS RecName: Full=Thymidine phosphorylase;       
    6::436     9e-76  39%  441 aa  TYPH_CHRVO RecName: Full=Thymidine phosphorylase;       
   11::427     2e-75  41%  427 aa  TYPH_MYCTU RecName: Full=Thymidine phosphorylase;       
    6::437     2e-75  37%  438 aa  TYPH_BURCJ RecName: Full=Thymidine phosphorylase;       
    6::437     6e-75  36%  438 aa  TYPH_BURCC RecName: Full=Thymidine phosphorylase;       
    3::438     8e-75  38%  438 aa  TYPH_SINMW RecName: Full=Thymidine phosphorylase;       
    6::437     2e-74  38%  442 aa  TYPH_VIBVY RecName: Full=Thymidine phosphorylase;       
    6::437     2e-74  38%  442 aa  TYPH_VIBVU RecName: Full=Thymidine phosphorylase;       
    6::438     5e-74  39%  442 aa  TYPH_ERWCT RecName: Full=Thymidine phosphorylase;       
    6::438     9e-74  39%  443 aa  TYPH_PHOPR RecName: Full=Thymidine phosphorylase;       
   12::443     3e-73  38%  448 aa  TYPH_VIBCH RecName: Full=Thymidine phosphorylase;       
    4::408     4e-73  41%  440 aa  TYPH_ESCF3 RecName: Full=Thymidine phosphorylase;       
    4::393     4e-73  42%  440 aa  TYPH_ENTS8 RecName: Full=Thymidine phosphorylase;       
    4::408     6e-73  41%  440 aa  TYPH_SHIFL RecName: Full=Thymidine phosphorylase;       
    4::408     6e-73  41%  440 aa  TYPH_SHIF8 RecName: Full=Thymidine phosphorylase;       
    4::409     6e-73  41%  440 aa  TYPH_ECOLI RecName: Full=Thymidine phosphorylase;       
    4::409     6e-73  41%  440 aa  TYPH_ECODH RecName: Full=Thymidine phosphorylase;       
    4::409     6e-73  41%  440 aa  TYPH_ECO45 RecName: Full=Thymidine phosphorylase;       
    4::408     6e-73  41%  440 aa  TYPH_ECO27 RecName: Full=Thymidine phosphorylase;       
    4::408     7e-73  41%  440 aa  TYPH_SHISS RecName: Full=Thymidine phosphorylase;       
    4::408     7e-73  41%  440 aa  TYPH_SHIB3 RecName: Full=Thymidine phosphorylase;       
    4::408     7e-73  41%  440 aa  TYPH_ECOSM RecName: Full=Thymidine phosphorylase;       
    4::408     7e-73  41%  440 aa  TYPH_ECOSE RecName: Full=Thymidine phosphorylase;       
    4::408     7e-73  41%  440 aa  TYPH_ECOLU RecName: Full=Thymidine phosphorylase;       
    4::408     7e-73  41%  440 aa  TYPH_ECOLC RecName: Full=Thymidine phosphorylase;       
    4::408     7e-73  41%  440 aa  TYPH_ECOL6 RecName: Full=Thymidine phosphorylase;       
    4::408     7e-73  41%  440 aa  TYPH_ECOHS RecName: Full=Thymidine phosphorylase;       
    4::408     7e-73  41%  440 aa  TYPH_ECO8A RecName: Full=Thymidine phosphorylase;       
    4::408     7e-73  41%  440 aa  TYPH_ECO7I RecName: Full=Thymidine phosphorylase;       
    4::408     7e-73  41%  440 aa  TYPH_ECO5E RecName: Full=Thymidine phosphorylase;       
    4::408     7e-73  41%  440 aa  TYPH_ECO57 RecName: Full=Thymidine phosphorylase;       
    4::408     7e-73  41%  440 aa  TYPH_ECO55 RecName: Full=Thymidine phosphorylase;       
    4::408     7e-73  41%  440 aa  TYPH_ECO24 RecName: Full=Thymidine phosphorylase;       
    6::437     2e-72  36%  438 aa  TYPH_BURS3 RecName: Full=Thymidine phosphorylase;       
    4::408     2e-72  41%  440 aa  TYPH_SHIBS RecName: Full=Thymidine phosphorylase;       
    4::438     5e-72  38%  440 aa  TYPH_YERPY RecName: Full=Thymidine phosphorylase;       
    4::438     5e-72  38%  440 aa  TYPH_YERPS RecName: Full=Thymidine phosphorylase;       
    4::438     5e-72  38%  440 aa  TYPH_YERP3 RecName: Full=Thymidine phosphorylase;       
    4::438     8e-72  38%  440 aa  TYPH_YERPE RecName: Full=Thymidine phosphorylase;       
    4::408     1e-71  40%  440 aa  TYPH_ECO81 RecName: Full=Thymidine phosphorylase;       
    7::440     3e-70  38%  440 aa  TYPH_BURP0 RecName: Full=Thymidine phosphorylase;       
   31::470     3e-70  38%  476 aa  TYPH_RAT RecName: Full=Thymidine phosphorylase;       
    7::440     3e-70  38%  440 aa  TYPH_BURPS RecName: Full=Thymidine phosphorylase;       
    7::440     3e-70  38%  440 aa  TYPH_BURMS RecName: Full=Thymidine phosphorylase;       
    7::440     3e-70  38%  440 aa  TYPH_BURMA RecName: Full=Thymidine phosphorylase;       
    7::440     3e-70  38%  440 aa  TYPH_BURM7 RecName: Full=Thymidine phosphorylase;       
   24::463     4e-69  38%  471 aa  TYPH_MOUSE RecName: Full=Thymidine phosphorylase;       
    1::402     8e-69  39%  421 aa  TYPH_MYCGE RecName: Full=Thymidine phosphorylase;       
    6::437     2e-68  35%  438 aa  TYPH_BURCH RecName: Full=Thymidine phosphorylase;       
    6::437     2e-68  35%  438 aa  TYPH_BURCA RecName: Full=Thymidine phosphorylase;       
    1::402     4e-66  38%  421 aa  TYPH_MYCPN RecName: Full=Thymidine phosphorylase;       
   38::477     5e-66  38%  482 aa  TYPH_HUMAN RecName: Full=Thymidine phosphorylase;       
    6::393     5e-66  41%  440 aa  TYPH_ERWT9 RecName: Full=Thymidine phosphorylase;       
   17::401     7e-66  39%  419 aa  TYPH_MYCPI RecName: Full=Thymidine phosphorylase;       
    7::440     8e-64  36%  440 aa  TYPH_BURP6 RecName: Full=Thymidine phosphorylase;       
   91::487     2e-53  33%  503 aa  TYPH_THEON RecName: Full=Putative thymidine phosphorylase;       
   90::493     4e-53  33%  506 aa  TYPH_METBU RecName: Full=Putative thymidine phosphorylase;       
   86::482     1e-52  32%  503 aa  TYPH_UNCMA RecName: Full=Putative thymidine phosphorylase;       
   91::485     2e-52  33%  503 aa  TYPH_PYRHO RecName: Full=Putative thymidine phosphorylase;       
    1::252     3e-51  44%  272 aa  TYPH_MYCHO RecName: Full=Thymidine phosphorylase;       
   91::485     4e-50  33%  503 aa  TYPH_PYRAB RecName: Full=Putative thymidine phosphorylase;       
   90::483     4e-50  33%  516 aa  TYPH_METHJ RecName: Full=Putative thymidine phosphorylase;       
   85::480     5e-50  31%  506 aa  TYPH_METBF RecName: Full=Putative thymidine phosphorylase;       
   91::481     9e-50  32%  503 aa  TYPH_THESM RecName: Full=Putative thymidine phosphorylase;       
   91::485     2e-49  33%  503 aa  TYPH_PYRKO RecName: Full=Putative thymidine phosphorylase;       
   90::481     3e-49  31%  507 aa  TYPH_METMA RecName: Full=Putative thymidine phosphorylase;       
   89::480     3e-49  31%  506 aa  TYPH_METAC RecName: Full=Putative thymidine phosphorylase;       
   91::481     2e-48  32%  503 aa  TYPH_THEGJ RecName: Full=Putative thymidine phosphorylase;       
   87::482     8e-48  31%  504 aa  TYPH1_ARCFU RecName: Full=Putative thymidine phosphorylase 1;      
   91::481     1e-47  33%  511 aa  TYPH_THEPD RecName: Full=Putative thymidine phosphorylase;       
   92::491     1e-47  31%  504 aa  TYPH_META3 RecName: Full=Putative thymidine phosphorylase;       
   91::505     4e-47  31%  508 aa  TYPH_METB6 RecName: Full=Putative thymidine phosphorylase;       
   92::490     3e-46  32%  503 aa  TYPH_METJA RecName: Full=Putative thymidine phosphorylase;       
   92::491     2e-44  30%  505 aa  TYPH_METLZ RecName: Full=Putative thymidine phosphorylase;       
   91::485     3e-42  31%  503 aa  TYPH_PYRFU RecName: Full=Putative thymidine phosphorylase;       
   93::493     7e-42  29%  505 aa  TYPH_METVS RecName: Full=Putative thymidine phosphorylase;       
  121::506     1e-41  32%  517 aa  TYPH_LEGPC RecName: Full=Putative thymidine phosphorylase;       
   87::491     2e-41  30%  505 aa  TYPH2_ARCFU RecName: Full=Putative thymidine phosphorylase 2;      
   92::504     3e-41  31%  507 aa  TYPH_METMJ RecName: Full=Putative thymidine phosphorylase;       
  121::506     6e-41  32%  517 aa  TYPH_LEGPN RecName: Full=Putative thymidine phosphorylase;       
  121::506     6e-41  32%  517 aa  TYPH_LEGPH RecName: Full=Putative thymidine phosphorylase;       
   93::492     8e-40  29%  505 aa  TYPH_METMP RecName: Full=Putative thymidine phosphorylase;       
  103::506     8e-40  31%  516 aa  TYPH_METCA RecName: Full=Putative thymidine phosphorylase;       
  114::525     1e-39  30%  526 aa  TYPH_PSEU5 RecName: Full=Putative thymidine phosphorylase;       
   93::492     2e-39  29%  505 aa  TYPH_METM5 RecName: Full=Putative thymidine phosphorylase;       
   96::499     2e-39  29%  512 aa  TYPH_METTP RecName: Full=Putative thymidine phosphorylase;       
  121::506     2e-39  32%  517 aa  TYPH_LEGPA RecName: Full=Putative thymidine phosphorylase;       
   88::487     9e-39  30%  502 aa  TYPH_HYPBU RecName: Full=Putative thymidine phosphorylase;       
  105::493     4e-38  31%  505 aa  TYPH_HAHCH RecName: Full=Putative thymidine phosphorylase;       
   93::492     1e-36  29%  505 aa  TYPH_METM6 RecName: Full=Putative thymidine phosphorylase;       
   99::491     3e-36  29%  505 aa  TYPH_PARL1 RecName: Full=Putative thymidine phosphorylase;       
  103::488     4e-36  32%  514 aa  TYPH_RHOPS RecName: Full=Putative thymidine phosphorylase;       
   93::492     7e-36  29%  505 aa  TYPH_METM7 RecName: Full=Putative thymidine phosphorylase;       
   99::491     9e-36  29%  505 aa  TYPH_TOLAT RecName: Full=Putative thymidine phosphorylase;       
  103::508     1e-35  33%  509 aa  TYPH_BRASO RecName: Full=Putative thymidine phosphorylase;       
  103::507     4e-35  32%  511 aa  TYPH_BRASB RecName: Full=Putative thymidine phosphorylase;       
  102::485     4e-35  30%  513 aa  TYPH_BRAJA RecName: Full=Putative thymidine phosphorylase;       
  110::497     5e-35  29%  522 aa  TYPH_RHOFD RecName: Full=Putative thymidine phosphorylase;       
  103::491     8e-35  31%  514 aa  TYPH_RHOPT RecName: Full=Putative thymidine phosphorylase;       
   89::477     8e-35  27%  500 aa  TYPH_NATPD RecName: Full=Putative thymidine phosphorylase;       
  103::505     1e-34  32%  513 aa  TYPH_RHOPB RecName: Full=Putative thymidine phosphorylase;       
  113::507     1e-34  29%  507 aa  TYPH_RALSO RecName: Full=Putative thymidine phosphorylase;       
  115::443     2e-34  32%  511 aa  TYPH1_ACISJ RecName: Full=Putative thymidine phosphorylase 1;      
  103::491     2e-34  31%  514 aa  TYPH_RHOPA RecName: Full=Putative thymidine phosphorylase;       
  103::485     4e-34  32%  510 aa  TYPH_NITHX RecName: Full=Putative thymidine phosphorylase;       
  274::665     1e-33  30%  677 aa  TYPH_ROSDO RecName: Full=Putative thymidine phosphorylase;       
  103::497     1e-33  31%  513 aa  TYPH_RHOP5 RecName: Full=Putative thymidine phosphorylase;       
  120::488     1e-31  29%  519 aa  TYPH_MARMM RecName: Full=Putative thymidine phosphorylase;       
  128::516     4e-31  29%  520 aa  TYPH1_RALEH RecName: Full=Putative thymidine phosphorylase 1;      
  115::495     1e-30  29%  509 aa  TYPH_MESSB RecName: Full=Putative thymidine phosphorylase;       
  120::447     2e-30  31%  514 aa  TYPH_SPHAL RecName: Full=Putative thymidine phosphorylase;       
  115::447     1e-28  30%  511 aa  TYPH_POLSJ RecName: Full=Putative thymidine phosphorylase;       
  118::483     1e-28  29%  512 aa  TYPH2_RALEJ RecName: Full=Putative thymidine phosphorylase 2;      
  284::653     5e-26  31%  693 aa  TYPH_AZOC5 RecName: Full=Putative thymidine phosphorylase;       
  117::501     6e-22  25%  513 aa  TYPH2_ACISJ RecName: Full=Putative thymidine phosphorylase 2;      
  200::505     1e-21  30%  602 aa  TYPH1_RALEJ RecName: Full=Putative thymidine phosphorylase 1;      
  265::491     1e-16  30%  601 aa  TYPH2_RALEH RecName: Full=Putative thymidine phosphorylase 2;      
   35::175     7e-10  36%  367 aa  TRPD_CORJK RecName: Full=Anthranilate phosphoribosyltransferase;   
    7::172     6e-09  33%  337 aa  TRPD_BRASB RecName: Full=Anthranilate phosphoribosyltransferase;   
    7::172     1e-08  34%  337 aa  TRPD_BRAJA RecName: Full=Anthranilate phosphoribosyltransferase;   
    8::151     1e-08  33%  338 aa  TRPD_AGRRK RecName: Full=Anthranilate phosphoribosyltransferase;   
    7::172     1e-08  32%  337 aa  TRPD_BRASO RecName: Full=Anthranilate phosphoribosyltransferase;   
    7::151     4e-08  31%  338 aa  TRPD_RHOPS RecName: Full=Anthranilate phosphoribosyltransferase;   
   17::130     4e-08  36%  363 aa  TRPD_GLUOX RecName: Full=Anthranilate phosphoribosyltransferase;   
   10::151     1e-07  32%  344 aa  TRPD_XANP2 RecName: Full=Anthranilate phosphoribosyltransferase;   
    8::151     2e-07  30%  338 aa  TRPD_RHIL3 RecName: Full=Anthranilate phosphoribosyltransferase;   
    2::149     2e-07  29%  339 aa  TRPD_LISMF RecName: Full=Anthranilate phosphoribosyltransferase;   
    2::149     2e-07  29%  339 aa  TRPD_LISMC RecName: Full=Anthranilate phosphoribosyltransferase;   
    5::150     2e-07  27%  351 aa  TRPD_CHLL2 RecName: Full=Anthranilate phosphoribosyltransferase;   
   11::148     2e-07  28%  343 aa  TRPD_CHLCV RecName: Full=Anthranilate phosphoribosyltransferase;   
    4::166     2e-07  28%  340 aa  TRPD_CARHZ RecName: Full=Anthranilate phosphoribosyltransferase;   
   15::151     3e-07  31%  337 aa  TRPD_RHISN RecName: Full=Anthranilate phosphoribosyltransferase;   
   10::334     3e-07  30%  342 aa  TRPD_MANSM RecName: Full=Anthranilate phosphoribosyltransferase;   
   12::150     4e-07  28%  344 aa  TRPD_PETMO RecName: Full=Anthranilate phosphoribosyltransferase;   
    3::333     5e-07  26%  334 aa  TRPD_STRZT RecName: Full=Anthranilate phosphoribosyltransferase;   
    3::333     5e-07  26%  334 aa  TRPD_STRPJ RecName: Full=Anthranilate phosphoribosyltransferase;   
    3::149     5e-07  31%  339 aa  TRPD_EXIS2 RecName: Full=Anthranilate phosphoribosyltransferase;   
    8::151     7e-07  30%  338 aa  TRPD_RHILW RecName: Full=Anthranilate phosphoribosyltransferase;   
   11::148     7e-07  27%  343 aa  TRPD_CHLFF RecName: Full=Anthranilate phosphoribosyltransferase;   
    8::128     9e-07  33%  338 aa  TRPD_RHIE6 RecName: Full=Anthranilate phosphoribosyltransferase;   
    8::151     9e-07  33%  338 aa  TRPD_MESSB RecName: Full=Anthranilate phosphoribosyltransferase;   
    1::336     9e-07  27%  339 aa  TRPD_IGNH4 RecName: Full=Anthranilate phosphoribosyltransferase;   
    1::337     9e-07  23%  351 aa  TRPD_CHLTE RecName: Full=Anthranilate phosphoribosyltransferase;   
    3::333     1e-06  27%  334 aa  TRPD_STRZP RecName: Full=Anthranilate phosphoribosyltransferase;   
    3::333     1e-06  27%  334 aa  TRPD_STRZJ RecName: Full=Anthranilate phosphoribosyltransferase;   
    3::333     1e-06  27%  334 aa  TRPD_STRR6 RecName: Full=Anthranilate phosphoribosyltransferase;   
    3::333     1e-06  27%  334 aa  TRPD_STRPS RecName: Full=Anthranilate phosphoribosyltransferase;   
    3::333     1e-06  27%  334 aa  TRPD_STRPN RecName: Full=Anthranilate phosphoribosyltransferase;   
    3::333     1e-06  27%  334 aa  TRPD_STRPI RecName: Full=Anthranilate phosphoribosyltransferase;   
    3::333     1e-06  27%  334 aa  TRPD_STRP7 RecName: Full=Anthranilate phosphoribosyltransferase;   
    3::333     1e-06  27%  334 aa  TRPD_STRP4 RecName: Full=Anthranilate phosphoribosyltransferase;   
    3::333     1e-06  27%  334 aa  TRPD_STRP2 RecName: Full=Anthranilate phosphoribosyltransferase;   
    3::333     1e-06  25%  335 aa  TRPD_STRMU RecName: Full=Anthranilate phosphoribosyltransferase;   
    8::128     1e-06  33%  338 aa  TRPD_RHIEC RecName: Full=Anthranilate phosphoribosyltransferase;   
    2::149     1e-06  28%  339 aa  TRPD_LISIN RecName: Full=Anthranilate phosphoribosyltransferase;   
   11::335     1e-06  24%  335 aa  TRPD_LACLS RecName: Full=Anthranilate phosphoribosyltransferase;   
   11::335     1e-06  24%  335 aa  TRPD_LACLM RecName: Full=Anthranilate phosphoribosyltransferase;   
   23::158     1e-06  29%  352 aa  TRPD_ARTS2 RecName: Full=Anthranilate phosphoribosyltransferase;   
  355::499     1e-06  31%  507 aa  ATPA_LEPIN RecName: Full=ATP synthase subunit alpha;       
  355::499     1e-06  31%  507 aa  ATPA_LEPIC RecName: Full=ATP synthase subunit alpha;       
    4::149     2e-06  27%  339 aa  TRPD_LISW6 RecName: Full=Anthranilate phosphoribosyltransferase;   
    2::149     2e-06  34%  339 aa  TRPD_LISMO RecName: Full=Anthranilate phosphoribosyltransferase;   
    6::328     2e-06  28%  340 aa  TRPD_AQUAE RecName: Full=Anthranilate phosphoribosyltransferase;   
   26::161     2e-06  28%  354 aa  TRPD1_STRCO RecName: Full=Anthranilate phosphoribosyltransferase 1;
   15::151     3e-06  31%  337 aa  TRPD_SINMW RecName: Full=Anthranilate phosphoribosyltransferase;   
   15::128     3e-06  36%  337 aa  TRPD_RHIME RecName: Full=Anthranilate phosphoribosyltransferase;   
    4::149     3e-06  26%  336 aa  TRPD_DICT6 RecName: Full=Anthranilate phosphoribosyltransferase;   
  351::495     3e-06  31%  503 aa  ATPA_LEPBL RecName: Full=ATP synthase subunit alpha;       
  351::495     3e-06  31%  503 aa  ATPA_LEPBJ RecName: Full=ATP synthase subunit alpha;       
   92::351     3e-06  29%  356 aa  TRPD_TRIEI RecName: Full=Anthranilate phosphoribosyltransferase;   
    1::150     5e-06  28%  345 aa  TRPD_CHLPB RecName: Full=Anthranilate phosphoribosyltransferase;   
   26::163     6e-06  28%  354 aa  TRPD_STRAW RecName: Full=Anthranilate phosphoribosyltransferase;   
   31::168     6e-06  27%  364 aa  TRPD_MYCGI RecName: Full=Anthranilate phosphoribosyltransferase;   
    5::152     6e-06  26%  339 aa  TRPD_CLOB8 RecName: Full=Anthranilate phosphoribosyltransferase;   
    7::151     8e-06  30%  338 aa  TRPD_RHOPA RecName: Full=Anthranilate phosphoribosyltransferase;   
    1::150     8e-06  25%  351 aa  TRPD_CHLCH RecName: Full=Anthranilate phosphoribosyltransferase;   
    7::151     1e-05  30%  338 aa  TRPD_RHOPT RecName: Full=Anthranilate phosphoribosyltransferase;   
    2::149     1e-05  32%  339 aa  TRPD_LISMH RecName: Full=Anthranilate phosphoribosyltransferase;   
   14::134     1e-05  30%  344 aa  TRPD_LEGPC RecName: Full=Anthranilate phosphoribosyltransferase;   
    7::335     1e-05  24%  335 aa  TRPD_LACLA RecName: Full=Anthranilate phosphoribosyltransferase;   
   15::145     1e-05  30%  346 aa  TRPD_GRABC RecName: Full=Anthranilate phosphoribosyltransferase;   
    4::151     2e-05  25%  339 aa  TRPD_PERMH RecName: Full=Anthranilate phosphoribosyltransferase;   
   14::134     2e-05  30%  344 aa  TRPD_LEGPL RecName: Full=Anthranilate phosphoribosyltransferase;   
   14::134     2e-05  30%  344 aa  TRPD_LEGPH RecName: Full=Anthranilate phosphoribosyltransferase;   
   14::134     2e-05  30%  344 aa  TRPD_LEGPA RecName: Full=Anthranilate phosphoribosyltransferase;   
    9::125     2e-05  36%  337 aa  TRPD_IDILO RecName: Full=Anthranilate phosphoribosyltransferase;   
    8::134     2e-05  33%  342 aa  TRPD_BEII9 RecName: Full=Anthranilate phosphoribosyltransferase;   
   27::161     2e-05  29%  354 aa  TRPD_STRGG RecName: Full=Anthranilate phosphoribosyltransferase;   
    7::142     2e-05  27%  345 aa  TRPD_NOCFA RecName: Full=Anthranilate phosphoribosyltransferase;   
    4::149     3e-05  27%  336 aa  TRPD_CLOPH RecName: Full=Anthranilate phosphoribosyltransferase;   
   73::149     3e-05  34%  341 aa  TRPD_CLOCE RecName: Full=Anthranilate phosphoribosyltransferase;   
   16::152     5e-05  23%  349 aa  TRPD_ACIBY RecName: Full=Anthranilate phosphoribosyltransferase;   
   16::152     5e-05  23%  349 aa  TRPD_ACIBT RecName: Full=Anthranilate phosphoribosyltransferase;   
   16::152     5e-05  23%  349 aa  TRPD_ACIBS RecName: Full=Anthranilate phosphoribosyltransferase;   
    4::150     7e-05  28%  337 aa  TRPD_SYNFM RecName: Full=Anthranilate phosphoribosyltransferase;   
   13::150     7e-05  27%  351 aa  TRPD_PELPB RecName: Full=Anthranilate phosphoribosyltransferase;   
    1::138     7e-05  24%  334 aa  TRPD_HAES2 RecName: Full=Anthranilate phosphoribosyltransferase;   
   16::152     7e-05  23%  349 aa  TRPD_ACIAD RecName: Full=Anthranilate phosphoribosyltransferase;   
   19::133     9e-05  26%  343 aa  TRPD_SYNJB RecName: Full=Anthranilate phosphoribosyltransferase;   
    7::151     9e-05  28%  339 aa  TRPD_RHOPB RecName: Full=Anthranilate phosphoribosyltransferase;   
    7::151     1e-04  26%  337 aa  TRPD_OLICO RecName: Full=Anthranilate phosphoribosyltransferase;   
  261::398     1e-04  25%  589 aa  TRPG_THEMA RecName: Full=Anthranilate synthase component II;       
   93::184     1e-04  34%  331 aa  TRPD_STAES RecName: Full=Anthranilate phosphoribosyltransferase;   
   93::184     1e-04  34%  331 aa  TRPD_STAEQ RecName: Full=Anthranilate phosphoribosyltransferase;   
   67::122     1e-04  43%  330 aa  TRPD_NOVAD RecName: Full=Anthranilate phosphoribosyltransferase;   
   15::138     1e-04  26%  341 aa  TRPD_LEUMM RecName: Full=Anthranilate phosphoribosyltransferase;   
   16::150     1e-04  29%  340 aa  TRPD_CHLAD RecName: Full=Anthranilate phosphoribosyltransferase;   
   14::151     1e-04  25%  344 aa  TRPD_AZOC5 RecName: Full=Anthranilate phosphoribosyltransferase;   
   16::151     2e-04  24%  333 aa  TRPD_PASMU RecName: Full=Anthranilate phosphoribosyltransferase;   
    7::172     2e-04  28%  337 aa  TRPD_NITHX RecName: Full=Anthranilate phosphoribosyltransferase;   
   13::151     2e-04  28%  337 aa  TRPD_METEP RecName: Full=Anthranilate phosphoribosyltransferase;   
   13::151     2e-04  28%  337 aa  TRPD_METC4 RecName: Full=Anthranilate phosphoribosyltransferase;   
    4::150     2e-04  28%  345 aa  TRPD_DESRM RecName: Full=Anthranilate phosphoribosyltransferase;   
  522::611     2e-04  36%  638 aa  DXS_MYCSS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  522::611     2e-04  36%  638 aa  DXS_MYCSK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  522::611     2e-04  36%  638 aa  DXS_MYCSJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   16::150     2e-04  28%  339 aa  TRPD_CHLSY RecName: Full=Anthranilate phosphoribosyltransferase;   
   16::150     2e-04  28%  339 aa  TRPD_CHLAA RecName: Full=Anthranilate phosphoribosyltransferase;   
   14::128     2e-04  32%  344 aa  TRPD2_RALSO RecName: Full=Anthranilate phosphoribosyltransferase 2;
   19::156     3e-04  24%  343 aa  TRPD_SYNJA RecName: Full=Anthranilate phosphoribosyltransferase;   
   75::151     3e-04  35%  349 aa  TRPD_METSB RecName: Full=Anthranilate phosphoribosyltransferase;   
   14::153     3e-04  25%  342 aa  TRPD_HALHL RecName: Full=Anthranilate phosphoribosyltransferase;   
    4::136     3e-04  26%  336 aa  TRPD_DICTD RecName: Full=Anthranilate phosphoribosyltransferase;   
   12::330     4e-04  22%  340 aa  TRPD_SYNWW RecName: Full=Anthranilate phosphoribosyltransferase;   
    6::115     6e-04  28%  330 aa  TRPD_THEVO RecName: Full=Anthranilate phosphoribosyltransferase;   
  122::171     6e-04  40%  367 aa  TRPD_MYCUA RecName: Full=Anthranilate phosphoribosyltransferase;   
    4::149     6e-04  28%  335 aa  TRPD_METS3 RecName: Full=Anthranilate phosphoribosyltransferase;   
   52::197     6e-04  32%  338 aa  B3GTB_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase
  368::453     7e-04  35%  501 aa  ATPA_CARHZ RecName: Full=ATP synthase subunit alpha;       
    1::125     0.001  25%  345 aa  TRPD_SULTO RecName: Full=Anthranilate phosphoribosyltransferase;   
    4::137     0.001  23%  342 aa  TRPD_SULAC RecName: Full=Anthranilate phosphoribosyltransferase;   
   12::127     0.001  27%  348 aa  TRPD_SORC5 RecName: Full=Anthranilate phosphoribosyltransferase;   
  122::171     0.001  38%  367 aa  TRPD_MYCMM RecName: Full=Anthranilate phosphoribosyltransferase;   
    8::128     0.001  29%  345 aa  TRPD_METRJ RecName: Full=Anthranilate phosphoribosyltransferase;   
    1::434

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRAYDVILKKRNGEKLSREEIEFMVGGYVKGEIPDYQMAAFLMAVYFRHLDXXXXXXXXXXMMRSGEVLD
PDP_BACST       MRMVDLIEKKRDGHALTKEEIQFIIEGYTKGDIPDYQMSALAMAIFFRGMNEEETAELTMAMVHSGDTID
PDP_STAHJ       MRMVDIIEKKRDGKSLSKEEIEFFIKGYTNGDIPDYQASSLAMAIFFQDMNDEERAALTMAMVNSGDVID
PDP_STAAC       MRMIDIIEKKRDGHTLTTEEINFFIGGYVKGDIPDYQASSLAMAIYFQDMNDDERAALTMAMVNSGDMID
PDP_STAA8       MRMIDIIEKKRDGHTLTTEEINFFIGGYVKGDIPDYQASSLAMAIYFQDMNDDERAALTMAMVNSGDMID
PDP_STAA3       MRMIDIIEKKRDGHTLTTEEINFFIGGYVKGDIPDYQASSLAMAIYFQDMNDDERAALTMAMVNSGDMID
PDP_STAEQ       MRMIDIIEKKRDGKSLTKEEIEFFVNGYTHGEVPDYQASSLAMAIFFQDMNDEERAALTMSMVNSGEKID
PDP_STAAB       MRMIDIIEKKRDGHTLTTEEINFFIDGYVKGDIPDYQASSLAMAIYFQDMNDDERAALTMAMVNSGDMID
PDP_STAAW       MRMIDIIEKKRDGHTLTTEEINFFIDGYVKGDIPDYQASSLAMAIYFQDMNDDERAALTMAMVNSGDMID
PDP_STAAS       MRMIDIIEKKRDGHTLTTEEINFFIDGYVKGDIPDYQASSLAMAIYFQDMNDDERAALTMAMVNSGDMID
PDP_STAAN       MRMIDIIEKKRDGHTLTTEEINFFIDGYVKGDIPDYQASSLAMAIYFQDMNDDERAALTMAMVNSGDMID
PDP_STAAM       MRMIDIIEKKRDGHTLTTEEINFFIDGYVKGDIPDYQASSLAMAIYFQDMNDDERAALTMAMVNSGDMID
PDP_STAES       MRMIDIIEKKRDGKSLTKEEIEFFVNGYTHEEVPDYQASSLAMAIFFQDMNDEERAALTMSMVNSGEKID
PDP_STAAR       MRMIDIIEKKRDGHTLTTEEINFFIDGYVKGDIPDYQASSLAMAIYFQDMNDDERAALTMAMVNSGDMID
PDP_BACSU       MRMVDIIIKKQNGKELTTEEIQFFVNGYTDGSIPDYQASALAMAIFFQDMSDRERADLTMAMVNSGETID
TYPH_SHEWM      --AQEIIRKKRNAEALSKEEIQFFVKGITDNTVSEGQIAALGMAVYFNDMNMDERIALTTSMRDSGTVLD
TYPH_COLP3      ----EIIRLKRDGKILDEQAINGFVSGLVDGNFSDSQVGAMAMAIFQQGMSIDERVNFTKAMMRSGEVLS
TYPH_RHISN      ----EVIRKKRDGGRLDRAEIADFVSGLADGSISEGQVAAFAMATWFSGMNRDECVALTLAMRDSGDILD
TYPH_SHEPW      --AQEIIRKKRNAEVLSTEEIQFFVNGITNNTVSEGQIAALGMAVYFNDMNMDERIALTTSMRDSGTVLD
TYPH_SHELP      --AQEIIRKKRNGEVLSTQEIQFFVQGITNNTVSEGQIAALGMAVYFKDMNMDERIALTTAMRDSGTVLN
TYPH_SHEDO      --AQEIIRKKRNGQALTAAEIQFFVNGITTNSVSEGQIAAFGMAVYFNDMNMDERIALTIGMRDSGTVLD
TYPH_PSYIN      ----EIIRNKRDGKTLSRQEIDFFIKGITDNSVTEGQIAAFAMAVYFQDMNMDERVLLVSAMRDSGQVIN
TYPH_SHEHH      --AQEIIRKKRNAEVLSTEEIQFFVNGITNNTVSEGQIAAFGMAVYFNDMNMDERIALTTAMRDSGTVLD
TYPH_SHESH      --AQEIIRKKRNAEALSKEEIQFFVKGITDNTVSEGQIAALGMAVYFNDMNMDERIALTTSMRDSGTVLN
TYPH_SHEB5      --AQEIIRKKRNGLALCSEEIQFFVQGITTNSVSEGQIAALGMAVYFNDMNMDERIALTTAMRDSGTVLN
TYPH_SHEPA      --AQEIIRKKRNAETLSTEEIQFFVKGITNNTVSEGQIAALGMAVYFNDMNMDERIALTTAMRDSGTVLN
TYPH_SHEB2      --AQEIIRKKRNGLALSSEEIQFFVQGITTNSVSEGQIAALGMAVYFNDMNMDERIALTTAMRDSGTVLN
TYPH_RHILO      MLPQEIIRHKRDGHRLSAGEIAAFIGGVTSGAVTDGQAAAFAMAVFFNGMNRDEAVALTLAMRDSGDVLD
TYPH_SHEFN      --AQEIIRKKRNGDVLSTAEIQFFVDGITHNTVSEGQIAAFGMAVYFKDMNMDERIALTIAMRDSGTVLD
TYPH_SHESW      --AQEIIRKKRNGLALSPAEIQFFVQGITTNAVSEGQIAAFGMAVYFNDMNMDERIALTTAMRDSGTVLN
TYPH_SHEPC      --AQEIIRKKRNGLALSPAEIQFFVQGITTNAVSEGQIAAFGMAVYFNDMNMDERIALTTAMRDSGTVLN
TYPH_RHIME      MLPQEIIRKKRDGDRLDPAEIAGFIAGVTDGSVSEGQAAAFAMAVWFSGMNRDECVALTLAMRDSGETLD
TYPH_SHEB9      --AQEIIRKKRNGLALSSEEIQFFVQGITTNSVSEGQIAALGMAVYFNDMNMDERIALTTAMRDSGTVLN
TYPH_SHEB8      --AQEIIRKKRNGLALSSEEIQFFVQGITTNSVSEGQIAALGMAVYFNDMNMDERIALTTAMRDSGTVLN
TYPH_SALHS      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_SHEON      --AQEIIRKKRNGLVLSAEEIQFFVKGITTNAVSEGQIAALGMAVYFNDMNMDERIALTTAMRDSGTVLN
TYPH_SHESR      --AQEIIRKKRNGLALSTEEIQFFVKGITTNAVSEGQIAALGMAVYFNDMNMDERIALTTAMRDSGTVLN
TYPH_SHESM      --AQEIIRKKRNGLALSAEEIQFFVKGITTNAVSEGQIAALGMAVYFNDMNMDERIALTTAMRDSGTVLN
TYPH_SALPK      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_SALPA      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_SALSV      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGSVLD
TYPH_SALTY      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_SALTI      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_SALNS      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_SALG2      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_SALEP      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_SALDC      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_SALA4      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_SHEAM      --AQEIIRKKRNAEALSKEEIQFFVKGITDNSVSEGQIAALGMAVYFNDMTMDERIALTTAMRDSGTVLD
TYPH_ENT38      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSIPERVSLTMAMRDSGSVLD
TYPH_SALCH      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_SALAR      --AQEIIRKKRDGHTLSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_KLEP7      --AQEIIRKKRDGQALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPERVSLTMAMRDSGTVLD
TYPH_VIBPA      ----EIIRKKRDGEVLTADEINFFIQGVANNTVSEGQIAAFAMTIFFNEMTMDERIALTCAMRDSGMVID
TYPH_SHESA      --AQEIIRKKRNGLALSTEEIQFFVKGITTNAVSEGQIAALGMAVYFNDMNMDERIALTTAMRDSGTVLN
TYPH_PROMH      --AQEIIRKKRDGHPLTEEEIRFFINGVRDNTVSEGQIAALAMTIYFHDMTMPERVALTLAMRDSGTVLN
TYPH_KLEP3      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPERVSLTMAMRDSGTVLN
TYPH_AERHH      ----EIIRKKRNGEALSTQEIQFFVQGITNNTIGEGQIAALAMAVYFKDMTMDERVALTCAMRDSGMVLD
TYPH_SODGM      --AQEIIRKKRDGEPLSDEEIRFFINGVYDNTVSEGQIAALAMTIFFHDMDLQERVALTLAMRDSGHTLD
TYPH_VIBF1      ----EIIRKKRDNKELTAEEINFFIQGVAKETVSEGQIAAFAMAVYFNEMTMPERIALTCAMRDSGMVID
TYPH_ALISL      ----EIIRRKRDNKVLTTEEINFFIQGVAKNTVSEGQIAAFAMAVYFNEMTMPERIALTCAMRDSGMVID
TYPH_VIBFM      ----EIIRKKRDNKELTTEEINFFIQGVAKETVSEGQIAAFAMAVYFNEMTMPERIALTCAMRDSGMVID
TYPH_YERE8      --AQEIIRKKRDGQALSEEEIRFFINGIRDNVVSEGQIAALAMTIYFHDMSMPERVALTMAMRDSGTVLN
TYPH_AERS4      ----EIIRKKRNGEALSTQEIQFFVQGITNNTIGEGQIAALAMAVYFKDMTMDERVALTCAMRDSGMVLN
TYPH_AGRT5      ----EIIRRKRDGLSLAPQEIAAFIEALSKDGISEGQAAAFAMAVFFRGMNRDEMVALTLAMRDSGDVLS
TYPH_IDILO      --AQEVIRKKRDAVSLSDTDIQQFVNGICDDSVSEGQIAALAMAIYFRGMSAQEKTALTVAMRDSGDVLD
TYPH_SERP5      --AQEIIRKKRDGQPLSEAEIRFFINGIRDNVVSEGQIAALAMTIYFHDMTMPERVALTMAMRDSGTVLD
TYPH_SHIDS      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_CHRVO      ----EIIRKKRDNLTLSQQEIQQFVAGITDNSVADSQIAALAMAIYFNGMELEENVHLALAMRDSGRRMH
TYPH_MYCTU      -----VIRTKRDGGRLSDAAIDWVVKAYTDGRVADEQMSALLMAIVWRGMDRGEIARWTAAMLASGARLD
TYPH_BURCJ      ----EFIRRKRDGQPLDRDGMAAFVRGVTDGSVTEGQVAAFAMAVYFNDLSTDERVALTLAQRDSGDVLD
TYPH_BURCC      ----EFIRRKRDGQPLDRDGMAAFVRGVTDGSVTEGQVAAFAMAVYFNDLSTDERVALTLAQRDSGDVLD
TYPH_SINMW      MLPQEVIRKKRDGGRLVPAEIAGFIEGLADGSISEGQAAAFAMAVWFSGMSRDECVALTLAMRDSGETLD
TYPH_VIBVY      ----EIIRKKRDGEALTADEINFFIQGVANNTVSEGQIAAFAMTIFFNEMTMPERIALTCAMRDSGMVID
TYPH_VIBVU      ----EIIRKKRDGEALTADEINFFIQGVANNTVSEGQIAAFAMTIFFNEMTMPERIALTCAMRDSGMVID
TYPH_ERWCT      ----EIIRKKRDGKTLSEEEIRFFINGIRDNTVSEGQIAALAMTIYFHDMSMDERVALTLAMRDSGTVLN
TYPH_PHOPR      ----EIIRKKRDNVELTADEINFFIQGIAKETMSEGQIAAFAMAIYFNDMTMDERVALTCAMRDSGMVID
TYPH_VIBCH      ----EIIRRKRDGEVLTNDEINFFIQGVANNTVSEGQIAAFAMAIFFREMTMPERIALTCAMRDSGMVID
TYPH_ESCF3      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_ENTS8      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTVSEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_SHIFL      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_SHIF8      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_ECOLI      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_ECODH      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_ECO45      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_ECO27      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_SHISS      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_SHIB3      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_ECOSM      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_ECOSE      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_ECOLU      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_ECOLC      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_ECOL6      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_ECOHS      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_ECO8A      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_ECO7I      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_ECO5E      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_ECO57      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_ECO55      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_ECO24      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_BURS3      ----EFIRQKRNRQALDRDGIAAFVRGVTDGSVTEGQVAAFAMAVYFNDLSTDERVALTLAQRDSGDVLD
TYPH_SHIBS      --AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_YERPY      --AQEIIRKKRDGQPLSEEEIRFFINGIRDNVVSEGQIAALAMTIYFHDMSMPERVALTMAMRDSGTVLN
TYPH_YERPS      --AQEIIRKKRDGQPLSEEEIRFFINGIRDNVVSEGQIAALAMTIYFHDMSMPERVALTMAMRDSGTVLN
TYPH_YERP3      --AQEIIRKKRDGQPLSEEEIRFFINGIRDNVVSEGQIAALAMTIYFHDMSMPERVALTMAMRDSGTVLN
TYPH_YERPE      --AQEIIRKKRDGQPLSEEEIRFFINGIRDNVVSEGQIAALAMTIYFHDMSMPERVALTMAMRDSGTVLN
TYPH_ECO81      --AQEIIRKKRDGHALSDDEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLD
TYPH_BURP0      ----EFIRKVRDRAPLDTADVARFVQGVTAGDVTEGQIAAFAMAVYFNELPLSARIALTLAQRDSGDVLD
TYPH_RAT        ----ELIRLKRNGGHLSEADIRNFVHALMDGRAQDTQIGAMLMAIRLQGMDLEETSVLTQALAESGQQLE
TYPH_BURPS      ----EFIRKVRDRAPLDTADVARFVQGVTAGDVTEGQIAAFAMAVYFNELPLSARIALTLAQRDSGDVLD
TYPH_BURMS      ----EFIRKVRDRAPLDTADVARFVQGVTAGDVTEGQIAAFAMAVYFNELPLSARIALTLAQRDSGDVLD
TYPH_BURMA      ----EFIRKVRDRAPLDTADVARFVQGVTAGDVTEGQIAAFAMAVYFNELPLSARIALTLAQRDSGDVLD
TYPH_BURM7      ----EFIRKVRDRAPLDTADVARFVQGVTAGDVTEGQIAAFAMAVYFNELPLSARIALTLAQRDSGDVLD
TYPH_MOUSE      ----ELIRLKRDGGHLREADIRNFVHAVIDGRAQDTQIGAMLMAIRLQGMNLEETSVLTRALAESGQQLE
TYPH_MYCGE      MNIINLINKKQRGKALNLAEINWFVNAVLNKTIADYQITAFLMAIWFKGMNPNELFLLTKAMVDTGEIIK
TYPH_BURCH      ----EFIRRKRDGQPLDRDDMAAFVRGVTDGSVTEGQVAAFAMAVYFNDLSTDERVALTLAQRDSGDVLD
TYPH_BURCA      ----EFIRRKRDGQPLDRDDMAAFVRGVTDGSVTEGQVAAFAMAVYFNDLSTDERVALTLAQRDSGDVLD
TYPH_MYCPN      MNIVNLISKKQRGKALTETEINWFVHSVNNKSLADYQVSAFLMAVWFQGMNSKELFCLTKAMVKSGESLH
TYPH_HUMAN      ----ELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLE
TYPH_ERWT9      ----EIIRKKRDGHALSDEEIRSFINGVRDNSVSEGQIAALAMAIWFRDITLPERVALTMAMRDSGSVLC
TYPH_MYCPI      ----------------SQDQINFCISGLVNKSIPDYQISALLMAIWFNGLDDNELYFLTKAMIDSGKIYK
TYPH_BURP6      ----EFIRKVRDRAPLDTADVARFVQGVTAGDVTEGQIAAFAMAVYFNELPLSARIALTLAQRDSGDVLD
TYPH_THEON      ------IKKKMNGEKLRKVEIETIVKDIVDRKLRDIEISSFVTALEINGLDMDEIAALTIAMAETGDMLD
TYPH_METBU      -----IIRKTMDGQKLTKEEIDILVKDIVEENLAEIEIAAFLTATYINDMTDDETEWLTRAMIDSGDKLE
TYPH_UNCMA      -KSVSFIRKKMDKQKLTSEEMHAIIEDIVDGNLTEVELTAFVTASYIYTMDSDEIEWMTRAMVKTGDQIS
TYPH_PYRHO      ------IKKKMKGEKLRKVEIETIIRDIVDRKLRNTEISAFITAIEINGLSMDEIAALTIAMAETGDMLD
TYPH_MYCHO      ----------------------------------------------------------------------
TYPH_PYRAB      ------IKKKMRGEKLRKVEIETIVRDIVDRKLRNTEISALVTAIEVNGLDMDEIAALTIAMAETGDMLD
TYPH_METHJ      ----DYIKKKMEGEKLTREDIRAIVADIVQDTLSPSEITAFVVSSYINQLDMDEIESLTRAMVETGD--Q
TYPH_METBF      -KSASVIKKMMDKKPVVQEEIKTLVNDIVEENLSEIELSAFITSSYIHGMTDDEVEWLTRAMIESGDTIE
TYPH_THESM      ------IRRKMNGQKLKKVEIEAIVKDIVNRKLRDIEISSFVTSLEINGLDMDEIAWLTTAMAETGDMLD
TYPH_PYRKO      ------IKKKMHGEKLRKVEIEAIVRDIVDRKLRDIEISSFVTALEINGLDMDEIAALTIAMAETGDMLD
TYPH_METMA      -----VIKKMLDKKPVVQDEIKMLVSDIVDENLSDVELSAFITASYIHGMTDDEVEWLTRAMIDTGDTIE
TYPH_METAC      -----VIKKMLDKKSVLQDEIKLLVNDIVEENLSDVELSAFITASYIHGMTDDEVEWLTRAMIDTGDTIE
TYPH_THEGJ      ------IKKKMHGEKLRKVEIEAIVRDIVDRKLRDIEISSFVTALEINGLDMDEIAALTIAMAETGDMLD
TYPH1_ARCFU     -KSVELIKKKTRGEKLSQDEIRRIVEDITNNALSEVELTAFVISSMLRGMDFDEIEWLTRSMIETGERIE
TYPH_THEPD      ------IRKKLQGLSLESDEIYQVVKDIVDGKLSELELAAFVTAVHFQGMTPSEIYSFTLSMVETGQRLR
TYPH_META3      ------IRKKMNGQTLTADEIHTIIDEIVSKKLTNVELSAFLVSTYIRGMNTEEIVAMTKRMAETGDTIQ
TYPH_METB6      ----DFIKKKMDGGRLTKEETLTIIKDVVNDEISAAELTAFITASYINPLDMEEVEHLTRAMVETGERIK
TYPH_METJA      ------IRKKMDGNKLKKEEIFEIIDEMVDGKLTNIEISAFVTSLYINGMDMDEIEAMTIRMAETGEMVN
TYPH_METLZ      ------IRKKMDGGKFTREETATIISDMSSNVLSPSEITAYITAAYINGLDMDEVEFLTREMVASGEQIT
TYPH_PYRFU      ------IKKKMRGEKLKKVEIETIVRDIVDRKLRNTEISAFVSAIEINGLDMEEIAALTIAMAETGDMLD
TYPH_METVS      ------IKKKMDGQVLSPNEIRTIIDEIVSKKLSNIELAAFVTSTYVNGMNMEEIVEMTKRMAETGDMIS
TYPH_LEGPC      ------------GNELSYEQMKVIIDDVLSGRLSDVQISAFLAASSAGRLTRTEIMKLTKAMIDSGDRLS
TYPH2_ARCFU     -KSVEYIRKKLNGAKYEREEIKDIIGSISSDVLSDIEISAFILANEIVGMQNDEIQWMIEAMXXXXXXXX
TYPH_METMJ      ------IKKKMDGGRFTKXXXXXXXXXXXXXXLSPGEITAYVTASYINGLDMDEVEYLTRATVETGERLH
TYPH_LEGPN      ------------GNELSFEQMKVIIDDVLSGRLSDVQISAFLAASGAGRLTRTEVMKLTKAMIDSGD--R
TYPH_LEGPH      ------------GNELSFEQMKVIIDDVLSGRLSDVQISAFLAASGAGRLTRTEVMKLTKAMIDSGD--R
TYPH_METMP      ------IKKKMDGQVLNPHEIRTIIDEIVSKKLSNIELSAFVSSTYINGMNMDEIGEMTKRIAETGDMIS
TYPH_METCA      ----DGVRRKIGGERLDYGDYQAITSDIAKGRYSKMEMAAFLVATGQNGLDRDEVLSLTRAMLETGVRLS
TYPH_PSEU5      --------RKIAGERLNRDDFLAIMRDIAEHRYSKIELTAFVVACNQGELDREEVFFLTDAMIRVGRRLD
TYPH_METM5      ------IKKKMDGQVLNPHEIRTIIDEIVSKKLSNIELSAFVSSTYINGMNMDEISEMTKRIAETGDMIA
TYPH_METTP      -------------QKLSEDQIRSIVRDIVYNNLSEIELSAYITASYIHNLDPQETEWLTRAMIETGERIY
TYPH_LEGPA      ------------GKELSYEQMKVIIDDVLSGRLSDVQISAFLAASSAGRLTRTEIMKLTKAMIDSGDRLS
TYPH_HYPBU      --SFDAFKKRLSGARLSAAEYKMLIADIVAGYYDDAQIASFLVSQLYSKLADEELEHLIRAMVETGEVVK
TYPH_HAHCH      ---------KLYGASLTQESADEVVKDVAGGLYSDVQLAAFVTACAGSRLNQDEVAALTSAMVKVGQRID
TYPH_METM6      ------IKKKMDGQVLNPHEIRTIIDEIVSKKLSNIELSAFVSSTYINGMNMDEISEMTKRIAETGDMIS
TYPH_PARL1      LESLSAVRARIHGHRLQTTELQAIVRDVVDGRYTDVALSAFLTATAVLPLDMQETIHLTRAMVDVGDHLQ
TYPH_RHOPS      ----DAVRAKIQGHTLTPAEITAVIDDVAHFRYSDMEIAAFLIAARFTSTDELLA------------LVD
TYPH_METM7      ------IKKKMDGQVLNPHEIRTIIDEIVSKKLSNIELSAFVSSTYINGMNMDEISEMTKRIAETGDMIS
TYPH_TOLAT      LESLSAVRARIHGHRLQTTELQAIVRDVVDGRYTDVALSAFLTATAVLPLDMQETIHLTRAMVDVGDHLQ
TYPH_BRASO      ----EAVRAKIRGETLSDEAIAAVIEDLAHYRYSDMEIAAFLIG--------------SASFMTSGELLA
TYPH_BRASB      ----EAVRAKIRGETLSDQAISAVIDDLAHYRYSDMEIAAFLIG--------------SASFMTSGELLA
TYPH_BRAJA      ----EAVRAKIRGRTLSQAEIGAIINDLAHYRYSDMEIAAFLIGSA-SFITSDELLALTGAMAQAGTQLV
TYPH_RHOFD      --------RKLAGERLGREDFLGIVRDIAELHYSKIELSAFVVATNRDELDREEVYFLTEAMVASGRTLN
TYPH_RHOPT      ----DAVRAKIQGHTLSAAEITAIVDDLAHFRYSDMEIAAFLIAARFTTTDELLALVGAMASVGTKLTWD
TYPH_NATPD      ------IRRKLDGRELDSDELGAIVADIEADRLSDLELSAYVCASHANGLSLEETKQLTERMAEVGKQLS
TYPH_RHOPB      ----DAVRGKIQGRTLSAAEITAIVNDLTRYRYSDMEIAAFLIGAA-RFMTSDELLALVSAMASVGTQLR
TYPH_RALSO      ------------GAHLDTHQLASVVGDIAKERYADVHIAAFLSACAGGRMSVKETIDLTQAMVDSGECLE
TYPH1_ACISJ     ------------GHRLDAGAFNAVIGDVAAGRYSDLYLAAFVTACAGDRLDLSETVALTRAMVAVGHRLD
TYPH_RHOPA      ----DAVRAKIQGHTLSAAEITAIVDDLAHFRYSDMEIAAFLIAARFTTTDELLALVGAMASVGTKLTWD
TYPH_NITHX      ----DAVRAKIMGQTFSAVDISAIIDDLTHYRYSDMEIAAFLIS--------------SASFMTNGELIA
TYPH_ROSDO      -KSRSILQKKVRGGELSHAEMEAFIHDLVNGRFSTSEIAGFLVAA--------------SNNLTMDEVIS
TYPH_RHOP5      ----DAVRGKIQGRTLTAPEIEAIVNDLARYRYSDMEIAAFLIGAA-RFMTSDELLALVSAMASVGTQLR
TYPH_MARMM      ------------GEPLDQNNLDAIVGDIAAGRFSDIHLSAFLTASAAHEQSFEEIRDLTLSMVNVGQRLD
TYPH1_RALEH     ------------GCHLDSVQLDGIIGDISAGRYADVHIAAFLTACADGRMSLRETVDLTRAMVRSGQRLN
TYPH_MESSB      ------------GHRLDAQALSEIVRDVAAGRYTDVHLAAFLTASAALPLDENETADLTGAMIAVGDRME
TYPH_SPHAL      ------------GNRLDGAAFRSIVDDIVAGRYSDVHLSAFVTACSAFPLDHAETVALTGAMVASGERLA
TYPH_POLSJ      ------------GRHLTQAAITAVIEDVTAGRYSDLQLAAFVTACAGDRLDQEETVSLTRAMVAAGERID
TYPH2_RALEJ     ------------GRRLDGAQXXXXXXXXXAGRYPDVYISAFLAACADGRMNRRETVDLTRAMVHSGERLS
TYPH_AZOC5      --------RKIQGATLDEGAYAQVVGDIVEGRYPDSEVAGFLVAA--------------DRSLSDDEVLA
TYPH2_ACISJ     ------------GNSLGDAQFGAIISDVAAGRYSDLHLATFITACAGDRLDLAETLSLTKAMIAVGDRID
TYPH1_RALEJ     ---------KLDGQPLDEGAYEAILRDAIAGRYTAQELTAFLTAAT-RSLDDREVVXXXXXXXXXXXXIE
TYPH2_RALEH     ----------------------------------------------------------------------
TRPD_CORJK      -----------NGQELSEAQVRWAMNEIMEGNATDAQIAAFAFGIRVRGITXXXXXXXXXTMTSFATPVD
TRPD_BRASB      -----IIGKVATGAPLSREEAASAFDSMMSGEATPSQMGALLMALRVRG-ETVEEITGAVSVMRA-KMLR
TRPD_BRAJA      -----IIGKVATGASLSRDEAASAFDAMMSGEATPSQMGGLLMALRVRG-ETVDEITGAVAAMRS-KMLT
TRPD_AGRRK      ------LAKVANREVLTRDEARQAFDILMSGEATPSQIGAFLMALRVRG-ETVDEIVGAVTAMRA-KMLP
TRPD_BRASO      -----IIGKVATGAPLSREQAASAFDSMMSGEATPSQMGALLMALRVRG-ETVEEITGAVSVMRA-KMLR
TRPD_RHOPS      -----IIAKVATGATLTRDEAASAFDGMMSGDATPSQMGALLMGLRVRGETVDEITGAVSTMRAKMLTVD
TRPD_GLUOX      ------------GRPLDSHEAETAFHAIMAGEVDPVQLAAFLTALKLRGETFAELTGAVQAVRHHMTVLP
TRPD_XANP2      --------KVATGASLTRDEAAYVFDKMMSGEATPSQMGALLMGLRVRG-ETVEEIAGAVSVMRS-KMLS
TRPD_RHIL3      ------LAKAASREPLTREEARSAFDILMSGQATPSQIGGFLMALRVRG-ETVDEIVGAVASMRS-KMLT
TRPD_LISMF      ----EILLQKYDQENLSKEEMTMIATEIFEGRLSKTKIAAFLMALKVKGETAEEMAGIAQAMQRVA--IQ
TRPD_LISMC      ----EILLQKYDQENLSKEEMTMIATEIFEGRLSKTKIAAFLMALKVKGETAEEMAGIAQAMQRVA--IQ
TRPD_CHLL2      ----DFLHKLLSGDHFSQEEMTQCMNAIMNGVFPDTVIAALLALLEHKGVTSTEVAGAYYSLIAKANTID
TRPD_CHLCV      -----------NQSHLTYDEVESVTNLMLNGADP-HQIAAFLAVLKYRGETPTEVAGMISALQKQATPVN
TRPD_CARHZ      ----EVLERLMRGENLNFSEALATMNELMEGKYTEAQVAAFLVALKMKG-ETEEEISAFALALREKARRV
TRPD_RHISN      -------------EALSREDARAAFEIIMSGAATPSQIGGFLMALRVRG-ETVDEIVGAVGAMRA-RMLP
TRPD_MANSM      MQTQQILTQLFDNQPLSQEQAAFIFGNIVKGELSNEQLAGALIALKIREITGAVTXXXXXXXXXXXXDYP
TRPD_PETMO      ------------GENLSLDEMEQAMEMIMEGKVTHSQLSGFLVALHMKGETVEEITASAKVMKEKATPIS
TRPD_STRZT      ----EIIEKLAKFENLSGVEMTDVIERIVTGRVTEAQIASLLLALKMKG-ETPEERTAIAQVMRGHEIHD
TRPD_STRPJ      ----EIIEKLAKFENLSGVEMTDVIERIVTGRVTEAQIASLLLALKMKG-ETPEERTAIAQVMRGHEIHD
TRPD_EXIS2      ----DVLTKLANANHLRFEEMQQAARELFAEDVTDSEIAAFLIALKAKG-ETAEELAGLASIMR--EVAV
TRPD_RHILW      ------LAKAASREPLTRDEARAAFDILMSGQATPSQIGGFLMALRVRG-ETVDEIVGAVTAMRS-KMLT
TRPD_CHLFF      -----------NQSHLTYDEAESVTNLMLNGSDP-HQIAAFLAVLKYRGETPTEIAGMVSALQKQATSVD
TRPD_RHIE6      ------LAKAASREPLTRDEARAAFDILMSGQATPSQIGGFLMALRVRG-ESVDEIVGAVTTMRS-KMLT
TRPD_MESSB      ------IAKVASGAALSFAEAREAFGIIMSGEATPSQIGGFLMALRVRG-ETVDEISGAVDTMRS-KMLP
TRPD_IGNH4      MNAPHLLEKILRGERLSSEEAYALAMSIAKNEIDDVQKAGFLVALRC----GRERPEELEGFVRA--LLD
TRPD_CHLTE      MRQQEILQKLLEGHDLSRQEMETCMNSIMENRFTDAGTGAILALLQKKGATPAEVIGACASIVSKSTPVT
TRPD_STRZP      ----EIIEKLAKFENLSGVEMTDVIERIVTGRVTEAQIASLLLALKMKG-ETPEERTAIARVMRGHEIHD
TRPD_STRZJ      ----EIIEKLAKFENLSGVEMTDVIERIVTGRVTEAQIASLLLALKMKG-ETPEERTAIAQVMRGHEIHD
TRPD_STRR6      ----EIIEKLAKFENLSGVEMTDVIERIVTGRVTEAQIASLLLALKMKG-ETPEERTAIAQVMRGHEIHD
TRPD_STRPS      ----EIIEKLAKFENLSGVEMTDVIERIVTGRVTEAQIASLLLALKMKG-ETPEERTAIAQVMRGHEIHD
TRPD_STRPN      ----EIIEKLAKFENLSGVEMTDVIERIVTGRVTEAQIASLLLALKMKG-ETPEERTAIAQVMRGHEIHD
TRPD_STRPI      ----EIIEKLAKFENLSGVEMTDVIERIVTGRVTEAQIASLLLALKMKG-ETPEERTAIAQVMRGHEIHD
TRPD_STRP7      ----EIIEKLAKFENLSGVEMTDVIERIVTGRVTEAQIASLLLALKMKG-ETPEERTAIAQVMRGHEIHD
TRPD_STRP4      ----EIIEKLAKFENLSGVEMTDVIERIVTGRVTEAQIASLLLALKMKG-ETPEERTAIARVMRGHEIHD
TRPD_STRP2      ----EIIEKLAKFENLSGVEMTDVIERIVTGRVTEAQIASLLLALKMKG-ETPEERTAIAQVMRGHEIHD
TRPD_STRMU      ----DIFEKLAAQENLTEAEITAVAEKIFKGELSEAQIAAFLMALKIKGETPEEILGLVKTIKKNAAVID
TRPD_RHIEC      ------LAKVASREPLTRDEARAAFDILMSGQATPSQIGGFLMALRVRG-ESVDEIVGAVTTMRS-KMLT
TRPD_LISIN      ----EILLQKVYDQKLSKAEMNIVATEIFEGRLSKTKIAAFLMALKVKGETAEEMAGIAEAMQQVAIQVD
TRPD_LACLS      ------------GRDMTENEMNMLANSIIQGELSDVQIASFLVALKMKGESASELTGLARALQKA--AIS
TRPD_LACLM      ------------GRDMTENEMNMLANSIIQGELSDVQIASFLVALKMKGESASELTGLARALQKA--AIS
TRPD_ARTS2      -----------NGADLTADNTEWAMDTIMSGEATPSQIAGFLVALRSKGETVDEIAGLVEAMLAHANPVD
ATPA_LEPIN      ----------------------------------------------------------------------
ATPA_LEPIC      ----------------------------------------------------------------------
TRPD_LISW6      -----LLQKVYDQENLTKAEMNILATEIFEGRLSKTKMAAFLMALKVKGETAEEMAGIAEAMQEVA--IQ
TRPD_LISMO      ----EILLQKYDQENLSKEEMNIIATEIFEGRLSKTKMAAFLMALKVKGETAEEXXXXXXXXXXXXXXXX
TRPD_AQUAE      ----ELLRKIAEFENLTAEEMYNLMKEVAEGRATDAQIGALVMGTKMKG-ETPEEIEGAVKLFREKVVRE
TRPD1_STRCO     -----------DGRDLSADDTAWALDVIMRGEATDVQIAGFAVGLRFKGETVEEISGLVRTMYEHANVI-
TRPD_SINMW      -------------EALSRDDARAAFEIIMSGAATPSQIGGFLMALRVRG-ETVDEIVGAVGAMRA-RMLH
TRPD_RHIME      -------------EALSREDARAAFEIIMSGAATPSQIGGFLMALRVRG-ETVDEIVGAVGAMRA-RMLP
TRPD_DICT6      ----EYLKKISEGKHLTFDEAKEIVLSIDREEITEAQLGAVLLGLRLKGENPEEIAGFVDVLHEKAKKIP
ATPA_LEPBL      ----------------------------------------------------------------------
ATPA_LEPBJ      ----------------------------------------------------------------------
TRPD_TRIEI      ----------------------------------------------------------------------
TRPD_CHLPB      MQYKELLHKLLTGTDLSGKEMEECFSGIMLGEYPDSVIAAILALLQKKGVTPEEVAGAYFAIISKALPVQ
TRPD_STRAW      -----------DGRDQSADDTAWAMDRIMRGEATDAQIAGFLVALRAKGETVEEISGLVRAMY---EHAN
TRPD_MYCGI      ------------GQSLLPGQTAWAMDQIMTGVATPAQIAAFAVSMKMKRPTSAEVTELAEIMLKHALPVP
TRPD_CLOB8      ----DAIKKLALREELTEDEVRGVINQIMKGEATSSQIGGFLVGLRVNGETPRQILGAVKAIRDNGVKVE
TRPD_RHOPA      -----IIAKVATGATLTRDEATDAFDAMMSGDATPSQMGALLMGLRVRG-ETVDEITGAVTTMRA-KMLP
TRPD_CHLCH      MESKQLLQKLLAGEHCSKEEMQDCMNSIMDGEFSDSVIAALLALLQKKGVVANELAGAHASLMAHATTVA
TRPD_RHOPT      -----IIAKVATGATLTRDEATDAFDAMMSGDATPSQMGALLMGLRVRG-ETVDEITGAVTTMRA-KMLP
TRPD_LISMH      ----EILLQKYDQENLSKEEMTMIATEIFEGRLSKTKIAAFLMALKVKGETAEEXXXXXXXXXXXXXXXX
TRPD_LEGPC      -------------QDLSSDQMQEVIHACMTGEFSDVQIATFLALMRMKSETVNELTAAAKVMRQLAHKID
TRPD_LACLA      --------KVMSGRDMTENEMNMLANSIIQGELSEVQIASFLVALKMKGEAASELTGLARALQKA--AIP
TRPD_GRABC      -----VLSRLAKGEHLNEEEAFAAFDLIMRGQATSSQIAALVMALRLRG-ETEAEMGGAVRALRSHMIP-
TRPD_PERMH      ----EYIRKITEGKDLSADEMKDLFNILMEGQATDAQIGAVLIGLKMKG-ESVEEISSAAQIMREKAVKV
TRPD_LEGPL      -------------QDLSSDQMQEVIHACMTGEFSDVQIATFLALMRMKGETVNELTAAAKVMRQLAHKID
TRPD_LEGPH      -------------QDLSSDQMQEVIHACMTGEFSDVQIATFLALMRMKGETVNELTAAAQVMRQLAHKID
TRPD_LEGPA      -------------QDLSSDQMQEVIHACMTGEFSDVQIATFLALMRMKGETVNELTAAAQVMRQLAHKID
TRPD_IDILO      -----------SGESLTQDQTREFFQRLIKGELNDIQVSAALIAMKMRGETPXXXXXXXXXXXXXXKPFL
TRPD_BEII9      ------IAKLATGSSLTRAEAEAAFDQIFAGEVTPAQLGGFLMAMRVRGETIGAVTAMRARMVRVDAPTD
TRPD_STRGG      ------------GEDLSAEETAWAMDRIMSGEATDAQIAGFAVALRAKGETVDEVTGLVRAMYAHANTI-
TRPD_NOCFA      -----------DGRDLSAADTAWAMNEIMSDNATSAQIAAFGVAIKIKGPTPEELGGLATGMFEHARLVD
TRPD_CLOPH      ----EAIYQLVNKEDLSYEVAEQVMDEIMSGEASNVLIGSYLTALRMKGETIDEITASAAGMVRLLHNMD
TRPD_CLOCE      ---------------------------------------------------------------------D
TRPD_ACIBY      ---------------LTQPQMEEIMRSIMQGEATEAQIGALMMGLRMKGESIDEMTAAARVMREFAIKID
TRPD_ACIBT      ---------------LTQPQMEEIMRSIMQGEATEAQIGALMMGLRMKGESIDEMTAAARVMREFAIKID
TRPD_ACIBS      ---------------LTQPQMEEIMRSIMQGEATEAQIGALMMGLRMKGESIDEMTAAARVMREFAIKID
TRPD_SYNFM      ----DGIKKIIQREDLSETEMSAVMSEIMSGEATDAQIGAFMGALATKGETFEELAGAARTMRRKAARIQ
TRPD_PELPB      ------------GEDFSQEEMILCMNNIMDGLFSEMVIAALLALLQKKGVTPTETAGAYYSLMEKAVTIE
TRPD_HAES2      MQTEQLISQLFDGQHLNQEQIQQLFHYIIQGQLSNEQLAGVLIALKFRGEQTDEISGAVKAIIANAKPFP
TRPD_ACIAD      ---------------LTQAQMEDVMRSIMQGEATEAQIGALMMGLRMKGESIDEITAAARVMRELAIKID
TRPD_SYNJB      -------------QSLSEAQAEQLMNGWLQNQVPDVVSGAILAALQAKGVSAGELAGMARVLQRAGSPLD
TRPD_RHOPB      -----IIGKLATGVTLSREESAGAFDAMMSGEATPSQMGALLMALRVRG-ETVEEITGAVAAMRSKMLRX
TRPD_OLICO      -----ILAKLADGKSLSRDEAVAAFDHLMSGEATPSQIGGALMAMRVRGETVDEITGAVSTMRAKMLRXX
TRPG_THEMA      -------------EDLTFEESRQVMNFIMSGNATDAQIAGFLVALRMKE-ETGDELGGMASVMREKSIHI
TRPD_STAES      ----------------------------------------------------------------------
TRPD_STAEQ      ----------------------------------------------------------------------
TRPD_NOVAD      ----------------------------------------------------------------------
TRPD_LEUMM      -------------KNLTDDMAQKVMNDIMDGKVSDPEIAAYLMGLAAKKEAVSEIVGSARAMIDHAKTIE
TRPD_CHLAD      ---------------LTQAEAASVMEEIMNGTATPAQIAAFLTALHIKG-ETDAEIAGMAAVMR--EKAT
TRPD_AZOC5      ------------GTALNRDEAAYAFDKMMSGETTPSQMGALLMGLRVRGETVDEIVGAVSVMRAKMLTVD
TRPD_PASMU      ---------------LNQQQTEFLFTAIVRGQLDNSQLSAALIALKLRGETPEEISGAVTALQADAESFP
TRPD_NITHX      -----LIGKVATGATLTREEASCAFDSMMSGEATPSQMGGLLMALRVRG-ETVDEITGAVAAMRSKMLRX
TRPD_METEP      -----------SGAPLSREQARAAFDDLLSGEVTPIQAGAFLTALSVRGESEDEIVGAVSAMR--ARMLP
TRPD_METC4      -----------SGAPLSREQARAAFDDLLSGEVTPIQAGAFLTALSVRGESEDEIVGAVSAMR--ARMLP
TRPD_DESRM      ----EAIQKVVAGINLSEAEAMETMQEVMEGKATQAQIASLLTALHLKG-ETVPEITGFARTMRT-KVIR
DXS_MYCSS       ----------------------------------------------------------------------
DXS_MYCSK       ----------------------------------------------------------------------
DXS_MYCSJ       ----------------------------------------------------------------------
TRPD_CHLSY      ---------------LTQAEAASVMEEIMSGTATPAQIGAFLTALHMKG-ETDAEIAGMAAVMR--EKAT
TRPD_CHLAA      ---------------LTQAEAASVMEEIMSGTATPAQIGAFLTALHMKG-ETDAEIAGMAAVMR--EKAT
TRPD2_RALSO     ------------GQTLGRQDAWMLFEQMAFGHASHAQLGALLMALRVRG-ETVEEIVGAALAMRARMVP-
TRPD_SYNJA      -------------QSLSEAQAEQLMNGWLHNQVPDVVSGAILAALQAKGVSASELAGMARVLQRAGSPLD
TRPD_METSB      ---------------------------------------------------------------------D
TRPD_HALHL      -------------QDLSPDEMTAVFRTIMTGGATPAQIGGFLIGMRLKGETVQEMAAAASVMRELAERVD
TRPD_DICTD      ----EFLKKISEGKHLNFEEAREIVLSIDREEITEAQLGAILLGLRLKGENPEEIAGFVDVLHEKAKKVP
TRPD_SYNWW      ------------GDYLNSEEAYLTARMLLHEDIPEIKAAAFLSALRTRKESQEELTGFVQALYEEAKMVD
TRPD_THEVO      ----DIVL----GLNVDRESAKRLYEIISKEDCSDVCRAAVLTAFHFKGVTREEFMGFLDAIYKPTVSVD
TRPD_MYCUA      ----------------------------------------------------------------------
TRPD_METS3      ----EAILKVVNGNDLNAKEAYGAMDEIMSGESSEVQMSAYLTALSMKTASTKAMRAHCVKLLNDEEVL-
B3GTB_ARATH     ----------------------------------------------------------------------
ATPA_CARHZ      ----------------------------------------------------------------------
TRPD_SULTO      MNTAELLRKIIRRENLTEDEARSIANSVMKAEVPEIVTAGFLVGLATKGESVEEITGFAKAMRDNALHIN
TRPD_SULAC      -----IVFEKRD---LSTEDSEAIANALMKGEIPEIQVSALLTSLAMKGESFEEIVGFARAMRNNAIKIS
TRPD_SORC5      ------------GVDLSAEQTEALFRDLIAGALTEIELSALFVALKAKGETPAEIAGAARALR--GTSVP
TRPD_MYCMM      ----------------------------------------------------------------------
TRPD_METRJ      ------LAKVAGGLALDRAEARAAFDDLLSGEVTPVQAGAFLTALKVRGESVEEIVGAAEAMRAR---MT


                         .         .         *         .         .         .         .:140
query           LSEIPGTKVDKHSTGGVGDKTTLVVAPLVASAGVPVAKMSGRALGHTGGTIDKLESIPGFRTELSLEEFI
PDP_BACST       LSRIEGIKVDKHSXXXXXXXXXXXXXXXXASVGVPVAKMSGRGLGHTGGTIDKLESVPGFHVEITNDEFI
PDP_STAHJ       LSKINGIKVDKHSXXXXXXXXXXXXXXXXXXXXXXXXKMSGRGLGHTGGTIDKLESIKGFHVEISEEDFI
PDP_STAAC       LSDIKGVKVDKHSXXXXXXXXXXXXXXXXXXXXXXXXKMSGRGLGHTGGTIDKLEAIDGFHVEIDEATFV
PDP_STAA8       LSDIKGVKVDKHSXXXXXXXXXXXXXXXXXXXXXXXXKMSGRGLGHTGGTIDKLEAIDGFHVEIDEATFV
PDP_STAA3       LSDIKGVKVDKHSXXXXXXXXXXXXXXXXXXXXXXXXKMSGRGLGHTGGTIDKLEAIDGFHVEIDEATFV
PDP_STAEQ       LSDINGIKVDKHSXXXXXXXXXXXXXXXXXXXXXXXXKMSGRGLGHTGGTIDKLESVKGFNVEISEKDFI
PDP_STAAB       LSDIKGVKVDKHSXXXXXXXXXXXXXXXXXXXXXXXXKMSGRGLGHTGGTIDKLEAIDGFHVEIDEATFV
PDP_STAAW       LSDIKGVKVDKHSXXXXXXXXXXXXXXXXXXXXXXXXKMSGRGLGHTGGTIDKLEAIDGFHVEIDEATFV
PDP_STAAS       LSDIKGVKVDKHSXXXXXXXXXXXXXXXXXXXXXXXXKMSGRGLGHTGGTIDKLEAIDGFHVEIDEATFV
PDP_STAAN       LSDIKGVKVDKHSXXXXXXXXXXXXXXXXXXXXXXXXKMSGRGLGHTGGTIDKLEAIDGFHVEIDEATFV
PDP_STAAM       LSDIKGVKVDKHSXXXXXXXXXXXXXXXXXXXXXXXXKMSGRGLGHTGGTIDKLEAIDGFHVEIDEATFV
PDP_STAES       LSDINGIKVDKHSXXXXXXXXXXXXXXXXXXXXXXXXKMSGRGLGHTGGTIDKLESVKGFNVEISEKDFI
PDP_STAAR       LSDIKGVKVDKHSXXXXXXXXXXXXXXXXXXXXXXXXKMSGRGLGHTGGTIDKLEAIDGFHVEIDEATFV
PDP_BACSU       LSAIEGIKVDKHSXXXXXXXXXXXXXXXXXXXXXXXXKMSGRGLGHTGGTIDKLEAIMGFHVELTKDEFI
TYPH_SHEWM      WQDLNGPIIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTEPDSALFR
TYPH_COLP3      WEGFDGPIVDKHSTGGVGDKVSFMLAAIVAACGGYVPMISGRGLGHTGGTADKLESIAGFNVQPSISEFK
TYPH_RHISN      WSEFGRPIVDKHSTGGVGDNVSLMLAPIVAACGPNVPMISGRGLGHTGGTLDKLESIPGYNIQPSPELFR
TYPH_SHEPW      WKDLNGPIIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYNTEPDSALFR
TYPH_SHELP      WKNLDGPIIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTEPDSDLFR
TYPH_SHEDO      SLGLNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAILGYQTEPSSELFR
TYPH_PSYIN      WQSLNGPVVDKHSTGGVGDVTSLILGPMVAACGGYVPMISGRGLGHTGGTLDKLDAISGYKTTPSLDHFR
TYPH_SHEHH      WKDLNGPIIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYNTEPDSALFR
TYPH_SHESH      WKDLDGPIIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTEPDSALFR
TYPH_SHEB5      WQELNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTEPSSELFR
TYPH_SHEPA      WQDLNGPIIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYNTEPDSALFR
TYPH_SHEB2      WQSLGGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTEPSSELFR
TYPH_RHILO      WSDLPGPVTDKHSTGGVGDNVSLMLAPIVAACGAYVPMISGRGLGHTGGTLDKMDAIPGYISQPDIALFR
TYPH_SHEFN      SLGLNGPIIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTEPSSELFR
TYPH_SHESW      WQSLGGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTEPSSELFR
TYPH_SHEPC      WQSLGGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTEPSSELFR
TYPH_RHIME      WSDLARPIVDKHSTGGVGDNVSLMLAPIVAACGAAVPMISGRGLGHTGGTLDKLESIPGYDIQPSPELFR
TYPH_SHEB9      WQSLGGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIQGYQTEPSSELFR
TYPH_SHEB8      WQSLGGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIQGYQTEPSSELFR
TYPH_SALHS      WKSLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFR
TYPH_SHEON      WQSLNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTEPSSELFR
TYPH_SHESR      WQSLGGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTEPSSELFR
TYPH_SHESM      WQSLGGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTEPSSELFR
TYPH_SALPK      WKSLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFR
TYPH_SALPA      WKSLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFR
TYPH_SALSV      WKSLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFR
TYPH_SALTY      WKSLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFR
TYPH_SALTI      WKSLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFR
TYPH_SALNS      WKSLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFR
TYPH_SALG2      WKSLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFR
TYPH_SALEP      WKSLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFR
TYPH_SALDC      WKSLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFR
TYPH_SALA4      WKSLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFR
TYPH_SHEAM      SLGLNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTEPSSELFR
TYPH_ENT38      WKSLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLEAIPGFDIFPNDTRFR
TYPH_SALCH      WKSLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFR
TYPH_SALAR      WKNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFR
TYPH_KLEP7      WKSLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFR
TYPH_VIBPA      WSHMNGPIVDKHSTGGVGDVTSLMLGPMVAACGGFVPMISGRGLGHTGGTLDKLEAIPGYNITPTNEVFG
TYPH_SHESA      WQSLGGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTEPSSELFR
TYPH_PROMH      WKSLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDEKFR
TYPH_KLEP3      WKSLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFR
TYPH_AERHH      HLNLGGPIVDKHSTGGVGDVVSLMLGPMVAACGGFVPMISGRGLGHTGGTLDKLDAIPGYQTSVDNDRFL
TYPH_SODGM      WRRLGGPVVDKHSTGGVGDVTSLMLGPMIAACGGFVPMVSGRGLGHTGGTLDKLEAIPGLAIFLDDDAFR
TYPH_VIBF1      WSHMDGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLESIAGYNITPSNDVFG
TYPH_ALISL      WSHMDGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLESIAGYNIMPNNDLFG
TYPH_VIBFM      WSHMDGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLESIAGYNITPSNDVFG
TYPH_YERE8      WKSLNGPMVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDSAFR
TYPH_AERS4      WEHLNGPIVDKHSTGGVGDVVSLMLGPMVAACGGFVPMISGRGLGHTGGTLDKLDAIPGYQTSVDNDRFL
TYPH_AGRT5      WRDIGRPVADKHSTGGVGDNVSLMLAPIVAACGLAVPMISGRGLGHTGGTLDKLEAIPGYDVMPDEALFR
TYPH_IDILO      WRQLNGPVLDKHSTGGVGDVVSLMLGPIVAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTAPDNRRFR
TYPH_SERP5      WKSLSGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFNIFPDDNAFR
TYPH_SHIDS      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_CHRVO      WKDLPGPIVDKHSTGGVGDVVSLMLGPMVAACGGFVPMISGRGLGHTGGTLDKLSAVPGYNPFPEPELFR
TYPH_MYCTU      FTDLPLATVDKHSTGGVGDKITLPLXXXXXXXXXXXXXXSGRGLGHTGGTLDKLESITGFTANLSNQRVR
TYPH_BURCJ      WRDLDGPVIDKHSTGGVGDVVSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLSAIPGYDVMPATDAFR
TYPH_BURCC      WRALGGPVIDKHSTGGVGDVVSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLSAIPGYDVMPDTDAFR
TYPH_SINMW      WGEFGRPVVDKHSTGGVGDNVSLMLAPIVAACGPVVPMISGRGLGHTGGTLDKLESIPGYNIQPSPELFR
TYPH_VIBVY      WSHMNGPIVDKHSTGGVGDVTSLMLGPMVAACGGFVPMISGRGLGHTGGTLDKLEAIPGYNITPSNDVFG
TYPH_VIBVU      WSHMNGPIVDKHSTGGVGDVTSLMLGPMVAACGGFVPMISGRGLGHTGGTLDKLEAIPGYNITPSNDVFG
TYPH_ERWCT      WKSLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGLDIFPNDDHFR
TYPH_PHOPR      WSHMDGPIVDKHSTGGVGDVTSLMLGPMVAACGGFVPMISGRGLGHTGGTLDKLESIPGYNITPTNDVFG
TYPH_VIBCH      WSHMDGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGYNITPTNDVFG
TYPH_ESCF3      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_ENTS8      WKSLNGPVVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFR
TYPH_SHIFL      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_SHIF8      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_ECOLI      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_ECODH      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_ECO45      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_ECO27      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_SHISS      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_SHIB3      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_ECOSM      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_ECOSE      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_ECOLU      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_ECOLC      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_ECOL6      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_ECOHS      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_ECO8A      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_ECO7I      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_ECO5E      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_ECO57      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_ECO55      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_ECO24      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_BURS3      WHELDGPVIDKHSTGGVGDVVSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLSAIPGYNVTPDTDAFR
TYPH_SHIBS      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_YERPY      WKSLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNAFR
TYPH_YERPS      WKSLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNAFR
TYPH_YERP3      WKSLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNAFR
TYPH_YERPE      WKSLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNAFR
TYPH_ECO81      WKSLHGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
TYPH_BURP0      WARLNGPVVDKHSTGGVGDLTSLVIGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGYDVAPSVDMLR
TYPH_RAT        WPKAWHQQVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRSLGHTGGTLDKLESIPGFSVTQSPEQML
TYPH_BURPS      WARLNGPVVDKHSTGGVGDLTSLVIGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGYDVAPSVDMLR
TYPH_BURMS      WARLNGPVVDKHSTGGVGDLTSLVIGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGYDVAPSVDMLR
TYPH_BURMA      WARLNGPVVDKHSTGGVGDLTSLVIGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGYDVAPSVDMLR
TYPH_BURM7      WARLNGPVVDKHSTGGVGDLTSLVIGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGYDVAPSVDMLR
TYPH_MOUSE      WPKAWHQQVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRSLGHTGGTLDKLESIPGFGVTQSPEQML
TYPH_MYCGE      FNHHGKISVDKHSTGGIGDKVSLALVPILTSLGFSVAKLSGRGLGYTGGTIDKLEAV-GVKTELTDQQAQ
TYPH_BURCH      WRDLGGPVIDKHSTGGVGDVVSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLSAIPGYDVMPDTDAFR
TYPH_BURCA      WRDLGGPVIDKHSTGGVGDVVSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLSAIPGYDVMPDTDAFR
TYPH_MYCPN      FNHHSKLSVDKHSTGGIGDKVSIALIPILTALDYSVAKLSGRGLGYTGGTIDKLEAV-GVKTDFTPTEAQ
TYPH_HUMAN      WPEAWRQQVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQ
TYPH_ERWT9      WKDLNGPVVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPSDDRFR
TYPH_MYCPI      FHEYKKILIDKHSTGGIGDKVSIALRPILVSFDLGVAKLSGRGLGFTGGTIDKLESI-NVNTDIDLKNSK
TYPH_BURP6      WARLNGPVVDKHSTGGVGDLTSLVIGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGYDVAPSVDMLR
TYPH_THEON      IDRKP--IMDVHSIGGVGNKTNILVVPIVAAAGLTIPKTSSRAITSAAGTADVVEVFA--EVSFSLDEIK
TYPH_METBU      FDTHP--IMDKHSIGGVGNKISLLIVPIVAANGLLIPKTSSRAITGAGGTADLMEILAP--VEFDAAEIK
TYPH_UNCMA      FDVHP--VMDHHSIGGVGNKISLCIVPIIAAAGLLIPKTSSRAITGAGGSADLMEIL--CPVSFRADEIK
TYPH_PYRHO      IDRKP--IMDVHSIGGVGNKTNILVVPIVAAAGLTIPKTSSRAITSAAGTADVVEVLTNVK--LSLDEIK
TYPH_MYCHO      ----------------------------------------------------------------------
TYPH_PYRAB      IDRKP--IMDVHSIGGVGNKTNIIVVPIVAAAGLTIPKTSSRAITSAAGTADVVEVFTN--VTLSLDEIK
TYPH_METHJ      LSFHAGPIVDKHSIGGVGNKISLIVVPIIAASGLLIPKTSSRAITGAGGTADLMEVLAP--VEFSASEVQ
TYPH_METBF      FDTHP--IMDKHSIGGVGNKISLLVVPIIAANGLLIPKTSSRAITGAGGTADLMEVL--CPVEFSSQEVK
TYPH_THESM      IDRKP--IMDVHSIGGVGNKTNILVVPIVAAAGLTIPKTSSRAITSAAGTADVVEVLAPVTH--SLDEIK
TYPH_PYRKO      IDRKP--IMDVHSIGGVGNKTNILVVPIVAAAGLTIPKTSSRAITSAAGTADVVEVFAD--VSFSLDEIK
TYPH_METMA      FDTHP--IMDKHSIGGVGNKISLLIVPIVAANGLLIPKTSSRAITGAGGTADLMEVLSP--VEFSSQEVK
TYPH_METAC      FDTHP--VMDKHSIGGVGNKISLLVVPIVAANGLLIPKTSSRAITGAGGTADLMEVLSP--VEFSSEEVK
TYPH_THEGJ      IDRKP--IMDVHSIGGVGNKTNILVVPIVAAAGLTIPKTSSRAITSAAGTADVVEVFTN--VSFSLDEIK
TYPH1_ARCFU     FDR--GTVVDKHSIGGVGNKISLLIVPTVAAAGLLIPKTASRAITSASGTADTMEVLAN--VNLSVDEIK
TYPH_THEPD      LKRKP--ILDKHSLGGVGDKTSLLVVPIIASLGFTIPKTSSRAITSAAGTADRMEVLAP--VNLSIDEIE
TYPH_META3      WEKRP--VVDVHSIGGVGNKYALLTIPIVAAAGMTIPKTSSRAITSAAGTADVLEVITN--VNLSCEEIQ
TYPH_METB6      FASRP--IVDKHSIGGVGNKISLLVVPIIAASGLKIPKTSSRAITGAGGTADLMEVLAN--VEFSAREVQ
TYPH_METJA      WE---GHIFDVHSIGGVGNKYALLVVPIVASAGLKIPKTSSRAITSAAGTADVVEVLT--RVDLTIEEIK
TYPH_METLZ      FSKKP--VVDKHSIGGVGNKITLLVVPVIAASGLLIPKTSSRAITGAGGTADLMEALAP--VAFSAAEIK
TYPH_PYRFU      IERKP--IMDIHSIGGVGNKTNVIVVPIVAAAGLTIPKTSSRAITSAAGTADXXXXXXXXXXXXXXIKRI
TYPH_METVS      WEK--SLVVDIHSIGGVGNKYALLSIPILAAAGITIPKTSSRAITSPAGTADVMEVLTN--VELDEEELK
TYPH_LEGPC      WSS--PLVVDKHCVGGLGNRTTLIVVPIVAAFGLMIPKTSSRAITSPAGTADTMETLPVHLSPQKMRQVV
TYPH2_ARCFU     XXXXXXX--DMHSIGGLGNRFSLIAVPTVAAAGLLIPKTASRAITTASGTADTMEVLAN--VNLSVDEIK
TYPH_METMJ      FTRHP--IVDKHSIGGVGNKITLLIAPIIAASGLLIPKTSSRAITGAGGTADLMEVLPVSFPALEVQQMT
TYPH_LEGPN      LSWPSPLVVDKHCVGGLGNRTTLIVVPIVASFGLMIPKTSSRAITSPAGTADTMETLPVHLSPQKMRQVV
TYPH_LEGPH      LSWPSPLVVDKHCVGGLGNRTTLIVVPIVASFGLMIPKTSSRAITSPAGTADTMETLPVHLSPQKMRQVV
TYPH_METMP      WEK--NLVVDIHSIGGVGNKYALLSIPILAAAGITIPKTSSRAITSPAGTADVMEVLTN--VELKEDEIK
TYPH_METCA      WNE--PLVADKHCIGGIGNRTSLLIVPIVAAHGMLIPKTSSRAITSPAGTADTMEVLA--RTDLAPESLD
TYPH_PSEU5      WREHP--VVDKHCIGGIGNRTSMLVVPIVAAHGMLCPKTSSRAITSPAGTADTMEVLAN--VELPFERLC
TYPH_METM5      WEK--SLVVDIHSIGGVGNKYALLSIPILAAAGITVPKTSSRAITSPAGTADVMEVLTN--VELKEEEIK
TYPH_METTP      FDKHP--VVDKHSIGGVGNKVSMLVVPIVAASGLLIPKTSSRAITGAGGTADLMEVLPVEFTADEIKEIT
TYPH_LEGPA      WSS--PLVVDKHCVGGLGNRTTLIVVPIVAAFGLMIPKTSSRAITSPAGTADTMETLPVHLSPQKMRQVV
TYPH_HYPBU      FGE---PVYDVHSIGGVNSKVALLVVPIVASRGLLIPKTSSRAITSPAGTADTMEVLAAFKPQ---ELHD
TYPH_HAHCH      WGTSP--IMDKHCVGGLGNRTTPIVVAIVTACGLRMPKTSSRAITSPAGTADTMETMAP--VNLTLAQMK
TYPH_METM6      WEK--SLVVDIHSIGGVGNKYALLSIPILAAAGITIPKTSSRAITSPAGTADVMEVLTN--VELKEEEIK
TYPH_PARL1      WQA--PIVVDKHCVGGLGNRTTPLVVAIAAANGLVMPKTSSRAITSPAGTADTMETLAP--VDLDLDTLR
TYPH_RHOPS      AMASVGTRVDKHCIGGIGNRTTMIVVPIVAAQGLMIPKTSSRAITSPAGTADTMEVLA--RVDLDVEQMK
TYPH_METM7      WEK--SLVVDIHSIGGVGNKYALLSIPILAAAGITVPKTSSRAITSPAGTADVMEVLTN--VELKEEEIK
TYPH_TOLAT      WQA--PIVVDKHCVGGLGNRTTPLVVAIAAANGLVMPKTSSRAITSPAGTADTMETLAP--VDLDLDTLR
TYPH_BRASO      LTHAAGTQVDKHCIGGIGNRTSMVVVPIVAAHGLTIPKTSSRAITSPAGTADTMEVLA--RVNVGAEEMK
TYPH_BRASB      LTRAAGTQVDKHCIGGIGNRTSMVVVPIVAAHGLTIPKTSSRAITSPAGTADTMEVLA--RVNVGAEEMK
TYPH_BRAJA      WPD--PVVVDKHCIGGIGNRTSMVVVPIVAAHGLPIPKTSSRAITSPAGTADTMEVLA--RVNVGVEEMK
TYPH_RHOFD      WHE--PLVVDKHCIGGIGNRSSMLVVPIVAAHGLLCPKTSSRAITSPAGTADTMEVLA--KVELPVDQLA
TYPH_RHOPT      TPIV----VDKHCIGGIGNRTTMIVVPIVAAHGLMIPKTSSRAITSPAGTADTMELLA--RVDLDVEQMK
TYPH_NATPD      WEQ--PVVADKHSIGGVGNRVTPXXXXXXXXXGLTIPKTSSRAVTSPAGTADTMEVF--CPVEFSREEIR
TYPH_RHOPB      WDR--PIVVDKHCIGGIGNRTSMILVPIVAAHGLTIPKTSSRAITSPAGTADTMEVLA--RVDVSVAEMK
TYPH_RALSO      WDR--EIVADKHCVGGLGNRTSPXXXXXXXXXGLLLPKTSSRAITSPAGTADTMETLT--RVALSATELR
TYPH1_ACISJ     WGR--ETVVDKHCVGGLGNRTTLLVVPIVAACGLTMPKTSSRAITSPAGTADTMEVLAP--VNLDIAAMR
TYPH_RHOPA      TPIV----VDKHCIGGIGNRTTMIVVPIVAAHGLMIPKTSSRAITSPAGTADTMELLA--RVDLDVEQMK
TYPH_NITHX      LVDSAGTQVDKHCIGGIGNRTSMIVVPIVAAHGLTIPKTSSRAITSPAGTADTMEMLA--RVDVGVEEMK
TYPH_ROSDO      LTQVRAAVVDKHSMGGVGNRITPIIIPILAAFGLTVPKTSSRAITSAAGTADMMEVLS--RVDLSPDE-M
TYPH_RHOP5      WDR--PVVVDKHCIGGIGNRTSMVLVPIVAAHGLTIPKTSSRAITSPAGTADTMEVLA--RVDVGVPEMK
TYPH_MARMM      WGRAP--IVDKHCVGGLGNRTTPIVVAICVAAGLTMPKTSSRAITSPAGTADTMETLAP--VELDVSAMR
TYPH1_RALEH     WDR--EVVADKHCVGGLGNRTTPXXXXXXXXXGLLLPKTSSRAITSPAGTADTMEALT--RVTLDSTELR
TYPH_MESSB      WDA--PTVVDKHCVGGLGNRTTPIVVAIVAANGLVMPKTSSRAITSPAGTADTMETLAP--VDLDLATLR
TYPH_SPHAL      WGS--DVVVDKHSVGGLGNRTTPIVVAIVAALGLIMPKTSSRAITSPAGTADTMETLAPVNLDVGA---I
TYPH_POLSJ      WGE--GLVMDKHCVGGLGNRTTMVIVPIVAACGLRMPKTSSRAITSPAGTADTMETLA--PVDLDVAQIR
TYPH2_RALEJ     WSH--AVVADKHCVGGLGNRXXXXXXXXXXXXXXXXXKTSSRAITSPAGTADTMETLT--RVALSAAELR
TYPH_AZOC5      LAKVRAKVVDKHSMGGIGSRITMIVVPIVAAHGLAIPKTSSRAITSAAGTADAMETLA--RVDLDSAEVR
TYPH2_ACISJ     WGR--PLVVDKHCVGGLGNRTTLLVVPIVTACGLMMPKTSSRAITSPAGTADTMEVLAP--VNLDVPSMR
TYPH1_RALEJ     WDE--PIVVDKHSMGGIGSRITLIVVPIVAAYGLAMPKTSSRAITSAAGTADAMETVA--RVDLTHDDVR
TYPH2_RALEH     --------VDKHSMGGVGSRITLIVVPIVAAYGLAMPKTSSRAITSAAGTADAMETIA--RVDLAHEDVR
TRPD_CORJK      FSDVPNC-VDIVGTGGDGHHTSTMASFVVSAAGVPVVKHGNRAASSKCGGADMLEAL-GLDIERSPEDIR
TRPD_BRASB      V-DAPAGAVDIVGTGGDGSGSVNVAAFIVAGAGIPVAKHGNRALSSRSGAADVLAAL-GVKIDLKPDQVG
TRPD_BRAJA      VTAPPDA-VDIVGTGGDGSGSVNVASFIVSGAGVPVAKHGNRALSSRSGAADVLASL-GVRIDLRPEQVG
TRPD_AGRRK      V-EAPADAIDIVGTGGDGFGTSTLAAFIVAGAGVPVAKHGNRAQSSKAGTAD-TQSVLGIKLDIGPEVIA
TRPD_BRASO      V-DAPANAVDIVGTGGDGSGSVNVASFIVAGAGVPVAKHGNRALSSRSGAADVLAAL-GVKIDLKPDQVG
TRPD_RHOPS      A---PADAVDIVGTGGDGSGSVNVASFIVAGCGVPVAKHGNRALSSKSGAADVLNAL-GVRIDITPEHVG
TRPD_GLUOX      --DVPAGAIDVCGTGGDGLKTLNVVAFVLAGLGVPVAKHGNRALSSASGATDVLE---------------
TRPD_XANP2      V-EAPSEAVDVVGTGGDASGSSTCASFIVAGAGVPVAKHGNRALSSKSGAADVLAAL-GVRIDLDPAGIS
TRPD_RHIL3      V-EAPADAIDIVGTGGDASGTSTLAALIVAGAGVPVAKHGNRALSSKSGAADNLAAL-GVKLDVGPEIIS
TRPD_LISMF      VAFPAGTAMDNCGTGG--DKSSTTSAFVLAAAGIPVAKHGNRSISSRSGSADVCQEL-GIDINMRPEDMT
TRPD_LISMC      VAFPAGTAMDNCGTGG--DKSSTTSAFVLAAAGIPVAKHGNRSISSRSGSADVCQEL-GIDINMRPEDMT
TRPD_CHLL2      LSP---DAVDTCGTGGAGTYNISTIGSIIASTGVSIAKHGNRSVTSSCGSADVLEEL-GFRIDLPVEATV
TRPD_CHLCV      LPDIVGTGGDLANTVNISTGSAI----LAAACGIPIAKHGNRSVSSQSGSADVLEAL-GIEIEMSPEELL
TRPD_CARHZ      ITQTEGL-VDTCGTGGDGRQTSTAAAFVVAGAGIPVAKHGNRSVSSRSGSADVLEAL-GVNIDLDAKGTA
TRPD_RHISN      V-EAPEDAIDIVGTGGDGAGTSTLASLIVAGAGVPVAKHGNRALSSKSGTADALSCL-GVKLDIGPEAIA
TRPD_MANSM      FADIVGTGGDNADTINISTASAIV----AASMGLKIAKHGNRSVSSKTGASDVLTAL-GVNIRMSTEQAR
TRPD_PETMO      IES--GELMDTCGTGGDAKGTSTAVAFILAAAGVVVAKHGNRSVSSKSGSADVLESL-GINISLPPSSVE
TRPD_STRZT      AMDNCGTGGDKSFSFNISTTAAFVLA----GGGIHMAKHGNRSISSKSGSADVLEAL-GINLDLKPAELG
TRPD_STRPJ      AMDNCGTGGDKSFSFNISTTAAFVLA----GGGIHMAKHGNRSISSKSGSADVLEAL-GINLDLKPAELG
TRPD_EXIS2      DIPVSGTDIDNCGTGGDGSQSSTTAAFVLAGAGAKVAKHGNRSVSSKTGSADVLESL-GVPLDVSTEEIA
TRPD_RHILW      V-EAPEDAIDIVGTGGDASGTSTLAALIVAGAGVPVAKHGNRALSSKSGAADNLAAL-GVKLDVGPEIIS
TRPD_CHLFF      LPDIVGTGGDLANTVNISTGSAI----LSAACGIPIAKHGNRSVSSQSGSADVLEAL-GIEIEMTPEELL
TRPD_RHIE6      V-EAPADAIDIVGTGGDASGTSTLAALIVAGAGVPVAKHGNRALSSKSGAADNLSAL-------------
TRPD_MESSB      VTA-PAEAVDIVGTGGDASGTYNVAAFIVAGCGVPVAKHGNRALSSKSGAADSLVAL-GVNIELGPDQIA
TRPD_IGNH4      LAVKVGPFREAIDTAGTGDRANLAAAVTLAAMGYKVVKHGNRSVTSAAGSADVMEAL-GYNLNLPPEKAT
TRPD_CHLTE      LDQQAVXXXXXXXXXXXXFNISTAAAFIACGAGIPIAKHGNRSITSKCGSADVLEAL-GYQVDLPPCATE
TRPD_STRZP      AMDNCGTGGDKSFSFNISTTAAFVLA----GGGIHMAKHGNRSISSKSGSADVLEAL-GINLDLKPAELG
TRPD_STRZJ      AMDNCGTGGDKSFSFNISTTAAFVLA----GGGIHMAKHGNRSISSKSGSADVLEAL-GINLDLKPAELG
TRPD_STRR6      AMDNCGTGGDKSFSFNISTTAAFVLA----GGGIHMAKHGNRSISSKSGSADVLEAL-GINLDLKPAELG
TRPD_STRPS      AMDNCGTGGDKSFSFNISTTAAFVLA----GGGIHMAKHGNRSISSKSGSADVLEAL-GINLDLKPAELG
TRPD_STRPN      AMDNCGTGGDKSFSFNISTTAAFVLA----GGGIHMAKHGNRSISSKSGSADVLEAL-GINLDLKPAELG
TRPD_STRPI      AMDNCGTGGDKSFSFNISTTAAFVLA----GGGIHMAKHGNRSISSKSGSADVLEAL-GINLDLKPAELG
TRPD_STRP7      AMDNCGTGGDKSFSFNISTTAAFVLA----GGGIHMAKHGNRSISSKSGSADVLEAL-GINLDLKPAELG
TRPD_STRP4      AMDNCGTGGDKSFSFNISTTAAFVLA----GGGIHMAKHGNRSISSKSGSADVLEAL-GINLDLKPAELG
TRPD_STRP2      AMDNCGTGGDKSFSFNISTTAAFVLA----GGGIHMAKHGNRSISSKSGSADVLEAL-GINLDLKPAELG
TRPD_STRMU      AMDNCGTGGDKSFSFNISTTCSFV----LAAGGIHIAKHGNRSISSKSGSADVLEEL-GINVVLAPEKLA
TRPD_RHIEC      V-EAPADAIDIVGTGGDASGTSTLAALIVAGAGVPVAKHGNRALSSKSGAADNLSAL-------------
TRPD_LISIN      FPA--GTAMDNCGTGG--DKSSTTSAFVLAAAGIPVAKHGNRSISSRSGSADVCQEL-GIDINMRPEDMT
TRPD_LACLS      IPTNLTNAMDNCGTGGFSFNISTTAAFVLAAGGVNMAKHGNRSITSKSGSADVLEAL-GINLYLPAEKLA
TRPD_LACLM      IPTNLTNAMDNCGTGGFSFNISTTAAFVLAAGGVNMAKHGNRSITSKSGSADVLEAL-GINLYLPAEKLA
TRPD_ARTS2      ---IAGEKLDIVGTGGDQLNTSTMAALVCAGAGAKVVKHGNRAXXXXXXXADVLEAL-GVRLDLPIERVA
ATPA_LEPIN      ----------------------------------------------------------------------
ATPA_LEPIC      ----------------------------------------------------------------------
TRPD_LISW6      VAFPAGTAMDNCGTGG--DKSSTTSAFVLAAAGIPVAKHGNRSISSRSGSADVCQEL-GIDINMRPEDMT
TRPD_LISMO      FPA--GTAMDNCGTGG--DKSSTTSAFVLAAAGIPVAKHGNRSISSRSGSADVCQEL-GIDINLRPEDMT
TRPD_AQUAE      LVDVVGTGGDKSSTFNVSTVTGFVLA----GAGVKVAKHGNRSVSSKSGSADFLEAL-GAKVELLPEKVA
TRPD1_STRCO     --EVPGKTVDIVGTGGDGAKTSTMSAIVLAGTGAKVVKHGNRXXXXXXXXXDVLEKL-GVNLELTPQRVA
TRPD_SINMW      V-KAPDGSIDIVGTGGDGAGTSTLAALIVAGAGVPVAKHGNRALSSKSGTADALSCL-GVNLEIGPEAIS
TRPD_RHIME      V-EAPDGAIDIVGTGGDGAGTSTLAALIVAGAGVPVAKHGNRALSSKSGTADALSCL-------------
TRPD_DICT6      AVDVCGTGGDKSNTFNI----STAVAFTLASLGVRVAKHGNRAMSSKAGSIDVIEAL-GFKCSDNPEEIA
ATPA_LEPBL      ----------------------------------------------------------------------
ATPA_LEPBJ      ----------------------------------------------------------------------
TRPD_TRIEI      --------IDTCGTGGDGASTSTAVAFVLAAAGVPVAKHGNRSASGKVGSADVLEAL-GIRLNAPTEKVI
TRPD_CHLPB      LGD---NAVDTCGTGGAGTFNISTVAAIIANAGVPIAKHGNRSVTSRCGSADVLEQL-GYRILLPPDKTE
TRPD_STRAW      LIEVPGATVDIVGTGGDGAKTSTMSSIVVAGTGAKVVKHGNRXXXXXXXXXDVLEKL-GINLQLTPKRVA
TRPD_MYCGI      TDTIGTHTVDIVGTGGDGANTSTMASIVVAAAGVPVVKHGNRAASSLSGGADTLEAL-GLRIDLGPDDVA
TRPD_CLOB8      I-ENTEHLIDTCGTGGDGSKTSTAVAIVAASGGAKVAKHGNRAVSSKSGCADVLVEL-GINIDFDEIQSK
TRPD_RHOPA      VTA-PADAVDIVGTGGDGSGSVNVASFVVAGCGVTVAKHGNRALSSKSGAADVLAAL-GVKIDITPEQVG
TRPD_CHLCH      LSTHAVXXXXXXXXXXXXYNISTTASLIACSAGVRVAKHGNRSVTSSCGSADVLEAL-GFTLELPPEATI
TRPD_RHOPT      VTAPPDA-VDIVGTGGDGSGSVNVASFVVAGCGVTVAKHGNRALSSKSGAADVLAAL-GVKIDITPEQVG
TRPD_LISMH      FPA--GTAMDNCGTGG--DKSSTTSAFVLAAAGIPVAKHGNRSISSRSGSADVCQEL-GIDINMRPEDMT
TRPD_LEGPC      LGDIVGTGGDGRNTFNVSTACSFVVA----AAGIKVAKHGNRSVSSRSGSADLLEQ-AGFILNLS-----
TRPD_LACLA      IPTNLTNAMDNCGTGGFSFNISTTAAFVLAAGGVNMAKHGNRSITSKSGSADVLEAL-GINLYLPAEKLA
TRPD_GRABC      -IKAPDGAIDVCGTGGDGAGTSTAVTFVVAGCGIPIAKHGNRALSSRSGAADVLTAL-GVQIDLGTE---
TRPD_PERMH      PVKDRSRLIDTCGTGGDKVDTSTITAFVIAGAGVKVAKHGNRSVSSKCGSADIMEAL-GVKIDLSPEQAA
TRPD_LEGPL      LGDIVGTGGDGRNTFNVSTACSFVVA----AAGIKVAKHGNRSVSSRSGSADLLEQ-AGFILNLS-----
TRPD_LEGPH      LGDIVGTGGDGRNTFNVSTACSFVVA----AAGIKVAKHGNRSVSSRSGSADLLEQ-AGFILNLS-----
TRPD_LEGPA      LGDIVGTGGDGRNTFNVSTACSFVVA----AAGIKVAKHGNRSVSSRSGSADLLEQ-AGFILNLS-----
TRPD_IDILO      RSDT--TVIDSCGTGGDGSNTSTTAALVAASMGLAVAKHGNRSVSSRSGSADVLEAL-------------
TRPD_BEII9      AIDIVGTGGDGHGTFNVSTLASLI----VAACGVPVAKHGNXXXXXXXXXXDVLSAL-GVRTGL------
TRPD_STRGG      --EVPGRTVDIVGTGGDLAKTSTMSAIVIAGTGAKVVKHGNRXXXXXXXXXDVLEKL-GVNLELTPRRVV
TRPD_NOCFA      AVDIVGTGGDRSGSVNISTMSSIVVA----AAGVPVVKHGNRAASSKSGGADVLEAL-GVRLNLGPEAVA
TRPD_CLOPH      VLEIVGTGGDEANTFNISTTTGFVVS----AAGIPVAKHGNRCVSSKCGAADVLEAL-GVNIMLAPLESA
TRPD_CLOCE      VLDIVGTGGDEANTFNISTVSSFVVS----AGGVPVAKHGGRSVSSKCGSADLLEAL-GINIALSAEQSA
TRPD_ACIBY      VSDIKHL-VDIVGTGGDGQNLFNVSTAVIAAAGATIAKHGNRGVSSKSGSSDLLEQ-AGIHLDLDMQQTE
TRPD_ACIBT      VSDIKHL-VDIVGTGGDGQNLFNVSTAVIAAAGATIAKHGNRGVSSKSGSSDLLEQ-AGIHLDLDMQQTE
TRPD_ACIBS      VSDIKHL-VDIVGTGGDGQNLFNVSTAVIAAAGATIAKHGNRGVSSKSGSSDLLEQ-AGIHLDLDMQQTE
TRPD_SYNFM      VTS--PVIVDTCGTGGDRKGTSTTAAFVVAGCGVTVAKHGNRSVSSQCGSADLLEAL-GMRLDAPAEVVE
TRPD_PELPB      LDE---NAVDTCGTGGAGTFNISTTASIIASAGVRIAKHGNRSVTSSCGSADVLEAL-GFTIDLPPEATK
TRPD_HAES2      FIDYPGTGGDNANTINISTTAAIVAATL----GYKVVKHGNRSVSSKSGASDVLNAL-GIKIDLSAEK--
TRPD_ACIAD      VSDIQYL-VDIVGTGGDGQNLFNVSTAVIAAAGATIAKHGNRGVSSKSGSSDLLEQ-AGINLDLDMQQTE
TRPD_SYNJB      LSLLVXXXXXXXXXXXXFNIST-AVAFVVSAAGIPVVKHGNRSASGKVGSADVLEAL-------------
TRPD_RHOPB      XXXXXXXXXXXXXXXXXXXXXXXXCASIVAGAGVPVAKHGNRALSSKSGAADVLAAL-GVKIDITPAEVG
TRPD_OLICO      XXXXXXXXXXXXXXXXXXXNVSTCAAFIVAGAGVPVAKHGNRAMSSKSGAADVLASL-GVNIELTPEQVG
TRPG_THEMA      KAPSPRXXXXXXXXXXXXXXXNITTAFVVAAAGIPVAKHGNRSVSSKVGSADVLEA-GGYKLEKTPEEME
TRPD_STAES      ------------------------VAFVVASAGVPVIKHGNKSITSHSGSTDVLHEMNIKTNKMNEVEQQ
TRPD_STAEQ      ------------------------VAFVVASAGVPVIKHGNKSITSHSGSTDVLHEMNIKTNKMNEVEQQ
TRPD_NOVAD      ----PANAIDVCGTGGDGHHTLNVVSLVVAACGVPVAKHGNRAASSKAGAADTLEAL-------------
TRPD_LEUMM      AMDIVGTGGDLSGTFNISTTASFIVA----GAGVPVVKHGNRAASSKSGTADALEAL-GVTIDLTPEQ--
TRPD_CHLAD      HVYFDGPVIDTCGTGGDGAHTSTTAAFVAAGAGLTVAKHGNRAMSSVCGSADVLEGL-GVQIELDAEGVA
TRPD_AZOC5      APXXXXXXXXXXXXXXXXYNISTCASFIVAGAGVPVAKHGNRALSSKSGAADVLAAL-GVRIDLAPAAIS
TRPD_PASMU      IPDYP--FADIVGTGGDGANTSTASAIVAASYGLKVAKHGNRSVSSQTGASDLLTAL-GVNVHISAHKAR
TRPD_NITHX      XXXXXXXXXXXXXXXXXXXXXXXXCASIVAGAGVPVAKHGNRALSSKSGAADCLAAL-GIKIDLTPEQVG
TRPD_METEP      VAAPEGA-IDIVGTGGDHSNVSTLAAILTAACGVPVAKHGNRAATSRSGAADVLAAL-GVKIGLPPEALA
TRPD_METC4      VAAPEGA-IDIVGTGGDHSNVSTLAAILTAACGVPVAKHGNRAATSRSGAADVLAAL-GVKIGLPPEALA
TRPD_DESRM      VQTKRRNLVDTCGTGGDGANTSTACAFVLAGAGLPVAKHGNRSVSSKCGSADVLEQL-GVFVQLTPEEAG
DXS_MYCSS       ----------------------------------------------------------------------
DXS_MYCSK       ----------------------------------------------------------------------
DXS_MYCSJ       ----------------------------------------------------------------------
TRPD_CHLSY      HVYFDGPVIDTCGTGGDGAHTSTTAAFVAAGAGLTVAKHGNRAMSSVCGSADVLEGL-GVQIELDAEGVA
TRPD_CHLAA      HVYFDGPVIDTCGTGGDGAHTSTTAAFVAAGAGLTVAKHGNRAMSSVCGSADVLEGL-GVQIELDAEGVA
TRPD2_RALSO     -VKAPADAVDIVGTGGDNAGTSTCAAFIVAGAGVPVAKHGNRALSSKSGAADVLSAL-------------
TRPD_SYNJA      LPLLVXXXXXXXXXXXXFNIST-AVAFVVSAAGIPVVKHGNRSASGKVGSADVLEAL-GVNLSAEPEQVR
TRPD_METSB      AMDIVGTGGDGHSTYNVSTLAALIVS----ACGVPVAKHGNRAASSQSGASDVLSAL-GVKIGLDSREVE
TRPD_HALHL      VGDDFHRLVDTCGTGGDARGTLNVAAFVTAAGGIPVAKHGNRSVSGRSGSADLLEAC-GATLELSSEAVA
TRPD_DICTD      NKDVCGTGGDKSNTFNI----STAVAFTLASLGIKVAKHGNRAMSSKAGSIDVIEAL-GFKCSDNPEE--
TRPD_SYNWW      CGMEVXXXXXXXXXXXXXFNISTASALVVASCGVAVAKHGNRAVTGKVGSADVLEAL-GVEVQLEPDEAR
TRPD_THEVO      ATDIVGTGGDKKNTINVSTASAIVAASL----GIPVAKFGNRSSTGAYGSAD------------------
TRPD_MYCUA      ---------------------------VVAAAGVPVVKHGNRAASSLAGGADTLESL-GVRIDLGPDQVA
TRPD_METS3      --EIVGTGGD----GXXXXXXXXXXXXXXXAAGVPVAKHGNRSASSKCGAADVLEAL-GVNIYIEPEKSL
B3GTB_ARATH     ----------------------------------------------------------------------
ATPA_CARHZ      ----------------------------------------------------------------------
TRPD_SULTO      FP----SALDTAGTGGDGLNTLNVAVALLISQVYPVAKHGNRAVSGKSGSADVLEAL-------------
TRPD_SULAC      YPEXXXXXXXXXXXXXXINVST--ITAIILSQLFPVAKHGNRSVSGKSGSADVLEAL-GYNINIAPELAN
TRPD_SORC5      FARPAYVYADCCGTGGDGQSTVNVVAFVAAEAGLPVAKHGNRSVSSQCGSADALEAL-------------
TRPD_MYCMM      ---------------------------VVAAAGVPVVKHGNRAASSLAGGADTLEAL-GVRIDLGPDQVA
TRPD_METRJ      RVAAPENAVDVVGTGGDHSNVSTLAAIVVAACGVPVAKHGNRAATSRSGAADVLAAL-------------


                         +         .         .         .         .         *         .:210
query           KNVKKYGIAIVGQTGNLVPADKKIYALRDATATVDEISLIASSIMSKKLAGGSDAFVLDVKFGTGAFMKG
PDP_BACST       DLVNKNKIAVVGQSGNLTPADKKLYALRDVTATVNSIPLIASSIMSKKIAAGADAIVLDVKTGVGAFMXX
PDP_STAHJ       KLVNENQVAVIGQSGNLTPADKKLYALRDVTGTVNSIPLIASSIMSKKIAAGADAIVLDVKTGNGAFMKT
PDP_STAAC       KLVNENKVAVVGQSGNLTPADKKLYALRDVTGTVNSIPLIASSIMSKKIAAGADAIVLDVKTGSGAFMKT
PDP_STAA8       KLVNENKVAVVGQSGNLTPADKKLYALRDVTGTVNSIPLIASSIMSKKIAAGADAIVLDVKTGSGAFMKT
PDP_STAA3       KLVNENKVAVVGQSGNLTPADKKLYALRDVTGTVNSIPLIASSIMSKKIAAGADAIVLDVKTGSGAFMKT
PDP_STAEQ       KLVNDNQVAVIGQSGNLTPADKKLYALRDVTGTVNSIPLIASSIMSKKIAAGADAIVLDVKTGSGAFMKT
PDP_STAAB       KLVNENKVAVVGQSGNLTPADKKIYALRDVTGTVNSIPLIASSIMSKKIAAGADAIVLDVKTGSGAFMKT
PDP_STAAW       KLVNENKVAVVGQSGNLTPADKKLYALRDVTGTVNSIPLIASSIMSKKIAAGADAIVLDVKTGSGAFMKT
PDP_STAAS       KLVNENKVAVVGQSGNLTPADKKLYALRDVTGTVNSIPLIASSIMSKKIAAGADAIVLDVKTGSGAFMKT
PDP_STAAN       KLVNENKVAVVGQSGNLTPADKKLYALRDVTGTVNSIPLIASSIMSKKIAAGADAIVLDVKTGSGAFMKT
PDP_STAAM       KLVNENKVAVVGQSGNLTPADKKLYALRDVTGTVNSIPLIASSIMSKKIAAGADAIVLDVKTGSGAFMKT
PDP_STAES       KLVNDNQVAVIGQSGNLTPADKKLYALRDVTGTVNSIPLIASSIMSKKIAAGADAIVLDVKTGSGAFMKT
PDP_STAAR       KLVNENKVAVVGQSGNLTPADKKLYALRDVTGTVNSIPLIASSIMSKKIAAGADAIVLDVKTGSGAFMKT
PDP_BACSU       KLVNRDKVAVIGQSGNLTPADKKLYALRDVTGTVNSIPLIASSIMSKKIAAGADAIVLDVKTGAGAFMKT
TYPH_SHEWM      KVVKEAGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLAAGLDALAMDVKVGSGAFMPT
TYPH_COLP3      RIVKDVGVAIISQTDNLAPADKRLYSIRDVTATVESIPLITASILSKKLAAGLDVLVMDVKVGNGAMMNN
TYPH_RHISN      QIVDEVGCAIIGQTANLAPADKRLYAIRDVTATVDSVPLITASILSKKLAAGLQSLVLDVKLGNGSFMTD
TYPH_SHEPW      KVVKEAGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLAAGLDALAMDVKVGTGAFMPT
TYPH_SHELP      KVVKEAGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLAAGLDALAMDVKVGSGAFMPT
TYPH_SHEDO      KVVKEAGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLAAGLDALVMDVKVGSGAFMPS
TYPH_PSYIN      KIVKEVGVAIIGQTGDLAPADKRFYATRDITATVESIPLITASILSKKLAAGIDALVMDVKAGSGAFMPT
TYPH_SHEHH      KVVKEAGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLAAGLDALAMDVKVGTGAFMPT
TYPH_SHESH      KVVKEAGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLAAGLDALAMDVKVGSGAFMPT
TYPH_SHEB5      KVVKEVGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLACNLDALAMDVKVGSGAFMPT
TYPH_SHEPA      KVVKEAGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLAAGLDALAMDVKVGTGAFMPT
TYPH_SHEB2      KVVKDVGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLACNLDALAMDVKVGSGAFMPT
TYPH_RHILO      QAVLETGCAIIGQTADLAPADRRLYAIRDVTGTVESVPLITASILSKKLAAGLGSLVLDVKVGNGAFMER
TYPH_SHEFN      KVVKDAGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLAAGLDALAMDVKVGSGAFMPT
TYPH_SHESW      KVVKEVGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLACNLDALAMDVKVGSGAFMPT
TYPH_SHEPC      KVVKEVGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLACNLDALAMDVKVGSGAFMPT
TYPH_RHIME      RVADEVGCAIIGQTADLAPADKRLYAIRDVTATVDSVPLITASILSKKLAAGLRSLVLDVKLGNGSFMTD
TYPH_SHEB9      KVVKEVGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLACNLDALAMDVKVGSGAFMPT
TYPH_SHEB8      KVVKEVGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLACNLDALAMDVKVGSGAFMPT
TYPH_SALHS      EIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SHEON      KVVKDVGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLACSLDALAMDVKVGSGAFMPT
TYPH_SHESR      KVVKDVGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLACSLDALAMDVKVGSGAFMPT
TYPH_SHESM      KVVKDVGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLACSLDALAMDVKVGSGAFMPT
TYPH_SALPK      EIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SALPA      EIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SALSV      EIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SALTY      EIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SALTI      EIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SALNS      EIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SALG2      EIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SALEP      EIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SALDC      EIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SALA4      EIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SHEAM      KVVKEAGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLAAGLDALAMDVKVGSGAFMPT
TYPH_ENT38      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SALCH      EIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SALAR      DIIQDVGVAIIGQTNSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_KLEP7      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_VIBPA      QVTKDAGVAIIGQTGDLAPADKRVYATRDITATVDNISLITASILSKKLAAGLESLVMDVKVGSGAFMPT
TYPH_SHESA      KVVKDVGVAIIGQTGDLVPADKRFYSIRDNTATVESISLITASILSKKLACSLDALAMDVKVGSGAFMPT
TYPH_PROMH      DIIRHVGVAIIGQTNSLAPADKRFYATRDITATVDSIPLITASILGKKLAEGLDALVMDVKVGSGAFMPT
TYPH_KLEP3      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_AERHH      KVVKEAGVAIIGQTGDLAPADKRIYAVRDITATVESIAMITGSILSKKLASGLEALVMDVKVGSGAFMPT
TYPH_SODGM      SQVKQVGVAIMGQTHSLAPADKRIYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGALMPT
TYPH_VIBF1      KVTKEAGVAIIGQTGDLAPADKRVYATRDVTATVDNISLITASILSKKLAAGLDSLVMDVKVGSGAFMPT
TYPH_ALISL      KVTKEAGVAIIGQTGDLAPADKRVYATRDVTATVDNISLITASILSKKLAAGLDSLVMDVKVGSGAFMPT
TYPH_VIBFM      KVTKEAGVAIIGQTGDLAPADKRVYATRDVTATVDNISLITASILSKKLAAGLDSLVMDVKVGSGAFMPT
TYPH_YERE8      KIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_AERS4      KVVKEAGVAIIGQTGDLAPADKRIYAVRDITATVESIAMITGSILSKKLASGLEALVMDVKVGSGAFMPT
TYPH_AGRT5      RTVQSVGCAIIGQTGDLAPADKRLYAIRDVTATVDSIPLITASILSKKLAAGLETLVLDVKVGNGAFMQS
TYPH_IDILO      DTVKQAGVAIIGQTGRLAPADSRFYATRDVTATVESIPLITASILAKKLAEGLDGLVMDVKAGNGAFMPG
TYPH_SERP5      KIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SHIDS      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_CHRVO      KVVKDVGVAIIGQTSDLAPADRRFYATRDVTATVESIALITASILSKKLAAGLDVLVMDVKAGSGAFMPT
TYPH_MYCTU      EQLCDVGAAIFA-AGQLAPADAKLYALRDITGTVESLPLIASSIMSKKLAEGAGALVLDVKVGSGAFMRS
TYPH_BURCJ      RTVREVGVAIIGQTARLAPADKRIYAIRDVTATVESVAMITASILSKKLAAGLDGLVMDVKVGSGAFMPT
TYPH_BURCC      RTVREVGVAIIGQTARLAPADKRIYAIRDVTATVESVAMITASILSKKLAAGLDGLVMDVKVGSGAFMPT
TYPH_SINMW      RVVDEVGCAIIGQTANLAPADKRLYAIRDVTATVDSVPLITASILSKKLAAGLQSLVLDVKLGNGSFMTD
TYPH_VIBVY      QVTKEAGVAIIGQTGDLAPADKRVYATRDITATVDNISLITASILSKKLAAGLESLVMDVKVGSGAFMPT
TYPH_VIBVU      QVTKEAGVAIIGQTGDLAPADKRVYATRDITATVDNISLITASILSKKLAAGLESLVMDVKVGSGAFMPT
TYPH_ERWCT      RXXXXXXXXXXXXTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_PHOPR      QVTKDAGVAIIGQTGDLAPADKRVYATRDVTATVDNISLITASILSKKLAAGLGSLVMDVKVGSGAFMPT
TYPH_VIBCH      KVTKQAGVAIIGQTGDLAPADKRVYATRDITATVDNISLITASILSKKLAAGLESLVMDVKVGSGAFMPT
TYPH_ESCF3      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ENTS8      DIIKNVGVAIIGQTNSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SHIFL      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SHIF8      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ECOLI      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ECODH      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ECO45      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ECO27      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SHISS      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_SHIB3      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ECOSM      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ECOSE      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ECOLU      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ECOLC      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ECOL6      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ECOHS      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ECO8A      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ECO7I      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ECO5E      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ECO57      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ECO55      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ECO24      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_BURS3      RAVRDVGVAIIGQTARLAPADMRIYAIRDVTATVESVAMITASILSKKLAAGLDGLVMDVKVGSGAFMPT
TYPH_SHIBS      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_YERPY      KIIQNVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_YERPS      KIIQNVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_YERP3      KIIQNVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_YERPE      KIIQNVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_ECO81      EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
TYPH_BURP0      RVVRDAGLAIVGQTAQLAPADKRIYAVRDVTATVESISLITASILSKKLAAGVSALAMDVKVGSGAFMPS
TYPH_RAT        QILEEVGCCIVGQSEKLVPADGILYAARDVTATVDSVPLITASILSKKAVEGLSTLVVDVKFGGAAVFPD
TYPH_BURPS      RVVRDAGLAIVGQTAQLAPADKRIYAVRDVTATVESISLITASILSKKLAAGVGALAMDVKVGSGAFMPS
TYPH_BURMS      RVVRDAGLAIVGQTAQLAPADKRIYAVRDVTATVESISLITASILSKKLAAGVGALAMDVKVGSGAFMPS
TYPH_BURMA      RVVRDAGLAIVGQTAQLAPADKRIYAVRDVTATVESISLITASILSKKLAAGVGALAMDVKVGSGAFMPS
TYPH_BURM7      RVVRDAGLAIVGQTAQLAPADKRIYAVRDVTATVESISLITASILSKKLAAGVGALAMDVKVGSGAFMPS
TYPH_MOUSE      HILEEVGCCIVGQSAKLVPADGILYAARDVTATVDSVPLITASILSKKAVEGLSTLVVDVKFGGAAVFPD
TYPH_MYCGE      ACLDKNDCFIIGQSKDIAPVDKVLYGLRDITGTVDSLPLIASSIMSKKLAVMNEYIFIDLKYGKGAFCKT
TYPH_BURCH      RTVREVGVAIIGQTARLAPADKRIYAIRDVTATVESVAMITASILSKKLAAGLDGLVMDVKVGSGAFMPT
TYPH_BURCA      RTVREVGVAIIGQTARLAPADKRIYAIRDVTATVESVAMITASILSKKLAAGLDGLVMDVKVGSGAFMPT
TYPH_MYCPN      NLLDQNDCFIIGQSEGIAPVDKVLYALRDTTATVDSLPLIASSVMSKKLAINNDYIFIDLKYGKGAFCKT
TYPH_HUMAN      VLLDQAGCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAAVFPN
TYPH_ERWT9      EIIKQVGIAIVGQTRSLAPADKRFYATRDITATVDSIPLIAASILGKKLAEGLDALVMDVKVGSGALMPT
TYPH_MYCPI      KILNIANMFIVGQTNDIVPADKLLYALRDVTGTVDSLPLIAASILSKKFALESDYIFIDIKYGQGAFCHD
TYPH_BURP6      RVVRDAGLAIVGQTAQLAPADKRIYAVRDVTATVESISLITASILSKKLAAGVGALAMDVKVGSGAFMPS
TYPH_THEON      RIVEKIGACMVGGALNLAPADD-ITIKAERALSIDPVGLMLASIMSKKYAMGSQYVLIDIPTGKGVKVET
TYPH_METBU      RMTEEVGGVLVGGATNIAPADDKLIKV-EYPLSIDPHCQMLASIMAKKGAIGADHVVMDIPTGPGTKIKN
TYPH_UNCMA      KMTTKVGGCLVGGATNIAPADDKIINV-EYPLSIDPKSQLLASVMAKKFAVGADTMVLDIPCGNETKIPT
TYPH_PYRHO      RIVEKIGACLVGGALNLAPADDLTIHV-ERRLSLDPRGLMLASIMSKKYAIGSQYILIDIPTGKGAKVET
TYPH_MYCHO      --------------------DKKIYALRDVTGTVQSIPLIASSIMSKKLATGSNCILLDVKCGNGAFMKD
TYPH_PYRAB      RIVEKIGACLVGGALNLAPADDLTIHV-ERRLSLDPRGLMLASIMSKKYAIGSQYILIDIPTGKGAKVET
TYPH_METHJ      ETIKTGGVIVWGGATNIAPADDKII-IQEYPFKIDQIGQMIASVMAKKFAVGADVVAIDIPVGKYCKVHT
TYPH_METBF      EITEKVGGALVGGATNIAPADDKLIRV-EYPLSIDPYYQMLASIMAKKGAIGADNVVMDIPVGPSTKVPT
TYPH_THESM      RIVEKIGACLVGGALNLAPADD-LTIKAERALSIDPRGLMLASIMSKKYAMGSQYVLIDIPTGEGVKVEK
TYPH_PYRKO      RIVEKVGACLVGGALNLAPADD-ITIKAERALSIDPTGLMLASIMSKKYAMGSQYVLIDIPTGKGVKVET
TYPH_METMA      EITEKVGGALVGGATNIAPADDKLIKI-EYPLSIDPYYQMLASIMAKKGAIGADNVVMDIPVGPGTKVPT
TYPH_METAC      EIAEKVGGALVGGATNIAPADDKLIRV-EYPLSIDPYYQMLASIMAKKGAIGAENVVMDIPIGPSTKVPT
TYPH_THEGJ      RIVEKVGACLVGGALNLAPADD-ITIKAERALSVDPRGLMLASIMSKKYAMGSQYVLIDIPTGKGVKVET
TYPH1_ARCFU     EITERVGGVIAGGATNIAPADDKIIRV-EHPLSIDPRPQLLASVMAKKGSVGAKHVVIDIPVGEGAKIEK
TYPH_THEPD      RIVEKTNACLVGGALNLAPADDIIIRV-EYPLGIDPFYI--PSILAKKLAVGSTHVVLDVPTGRGTKVKT
TYPH_META3      RVAKTTGGCLAGGAVNLAPADDIIINV-ERPLSIDPQPQLLASVMAKKIATGIDYTVIDIPVGYGVKIKN
TYPH_METB6      EMTEKVGGTIVGGATNIAPADDRII-LQEYPFKIDARGQMLASVMAKKYAVGANLVVIDIPVGSHTKVPT
TYPH_METJA      RVVKETGCMVWGGALDLAPADD-ITINVERPLGIDPEPLLLSSVMAKKLAMGVNKLLIDIPTGYGAKVKS
TYPH_METLZ      TMTEKAGGVIVGGATNIAPADDMIVTY-EYPLKIDARGQMLASIMAKKMAVGSDTCVIDIPIGPGTKIPD
TYPH_PYRFU      --VEKIGACLVGGALNLAPADDLMIHV-ERRLSLDPRGLMLASIMAKKYAIGSQYILIDIPTGKGAKVES
TYPH_METVS      RVVKATGCLVWGGGVNLAPADDIIINV-ERPVSIDPQPQLLASVMAKKVATGIKYAVIDIPVGKGVKIKN
TYPH_LEGPC      E--QENGCIVWGGAVSLSPADDVLIRVERAIDLDSEGQLVAS-ILSKKIATGATHAVIDIPVGPTAKVRN
TYPH2_ARCFU     EITEEVGIAWNAPTG-IAPADEKIIRVEYQLELSPKPHLMAS-VLSKKLGSGARFVAIDIPVGKKAKVEN
TYPH_METMJ      EKVG--GAIVWGGATNIAPADDKIYPLR-----IDARGQMIASVMAKKFAVGADLVVIDIPVGRNTKIAT
TYPH_LEGPN      E--QENGCIVWGGAVSLSPADDVLIRVERAIDLDSEGQLVAS-ILSKKIATGATHAVIDIPVGPTAKVRN
TYPH_LEGPH      E--QENGCIVWGGAVSLSPADDVLIRVERAIDLDSEGQLVAS-ILSKKIATGATHAVIDIPVGPTAKVRN
TYPH_METMP      RIVKTTGCLVWGGGVNLAPADDIIINV-ERPVSIDPQPQLLASVMAKKIATGIKYSVIDIPVGKGVKIKN
TYPH_METCA      RLVRERGCLAWGGTTRLAPVDDMLISV-ERPLGIDSQGQMVASILSKKLAAGATHLLLDIPVGPTAKVRQ
TYPH_PSEU5      EMVREEGCLAWGGSSDLSPADDVLIAV-ERPLSIDSPGQMVASILSKKIAAGSTHLLLDIPIGPTAKVRS
TYPH_METM5      RIVKTTGCLAWGGGVNLAPADDIIINV-ERPVSIDPQPQLLASVMAKKIATGIKYTVIDIPVGKGVKIKN
TYPH_METTP      ETVG--GVIAWGGATNIAPADDRLIKAEYALA-IDPYSQMLASIMXXXXXXXXXXXXXXMPTGPGTKLET
TYPH_LEGPA      E--QENGCIVWGGAVSLSPADDVLIRVERAIDLDSEGQLVAS-ILSKKIATGATHAVIDIPVGPTAKVRN
TYPH_HYPBU      MALRARGLIVWGGALNLAPAD-DIFVRVERRIGVDPPTQMVASILAKKLAMSVSRLVIDLPTGRGAKVQD
TYPH_HAHCH      KVVEQEGGCIAGGSVSLSPADDVLIRIERALDLDSEGQLVAS-VISKKVAAGSTHVLIDIPIGMTAKVRS
TYPH_METM6      RIVKTTGCLAWGGGVNLAPADDIIINV-ERPVSIDPQPQLLASVMAKKIATGIKYTVIDIPVGKGVKIKN
TYPH_PARL1      KVVEKEGGCVAGGAMHLSPADD-IFVRIERELDIDTQGQLIASVLSKKIAAGATHIVIDIPVGPTAKVRS
TYPH_RHOPS      RVVTTCGGCLIGGHVNLSPADDILISV-ERPLSLDTPEQMVASIMSKKLAAGSTRLLIDFPVGPSAKIAS
TYPH_METM7      RIVKTTGCLAWGGGVNLAPADDIIINV-ERPVSIDPQPQLLASVMAKKIATGIKYTVIDIPVGKGVKIKN
TYPH_TOLAT      KVVEKEGGCVAGGAMHLSPADD-IFVRIERELDIDTQGQLIASVLSKKIAAGATHIVIDIPVGPTAKVRS
TYPH_BRASO      SIVAACGCVIWGGHVNLSPADDILISV-ERPLSLDTREQMVASILSKKLAAGSTHLLLDLPVGPTAKLTS
TYPH_BRASB      SIVAACGCVIWGGHVNLSPADDILISV-ERPLSLDTREQMVASILSKKLAAGSTHLLLDLPVGPTAKLSS
TYPH_BRAJA      AIVSSCGCLIWGGHVNLSPADDVLISV-ERPLSLDTREQMVASIMSKKIAAGSTHLLIDIPVGPTAKVTG
TYPH_RHOFD      DIVRTHGCLAWGGAAHLSPADDVLISVERPLA-IDSPGQMVASILSKKIAAGSTHLVLDIPIGPSAKVRS
TYPH_RHOPT      QVVHACGGCLVGGHVNLSPADDILISV-ERPLSLDTPEQMVASIMSKKLAAGSTRLLIDFPVGPSAKVTS
TYPH_NATPD      DIVTETGGCLVGGAVDLSPVDDKVIRAQ-RPLSLDPPGQVIASVLSKKQSAGSSHIVVDIPYGAGAKVTS
TYPH_RHOPB      EIVAACGCLIWGGHVNLSPADDILISV-ERPLCLDTREQMVASIMSKKLAAGSTHLLVDLPVGPTAKVAS
TYPH_RALSO      RVVDRVGASLAGGALSLSPADDVLIRVERAL-DVDSDAQLAASILSKKIAAGSTHVLIDVPVGPTAKVRS
TYPH1_ACISJ     RTVERTGGCIVGGSVRLSPADDVLIRV-ERPLDLDSEGQLVASVLSKKAAAGSTHVLIDLPVGPTAKVRS
TYPH_RHOPA      QVVHACGGCLVGGHVNLSPADDILISV-ERPLSLDTPEQMVASIMSKKLAAGSTRLLIDFPVGPSAKVTN
TYPH_NITHX      DIVAACGCLVWGGHVNLSPADDILISV-ERPLGLDTREQMVASILSKKLAAGSTHLLIDLPVGPTAKLVN
TYPH_ROSDO      KSVVEQTNGCIAWNGNLTPVDDVMNAINRPLGLQSTL-LDVSSIMSKKLAAGSTHVLIDMPVGPKAKTRT
TYPH_RHOP5      EIVAACGCLIWGGHVNLSPADDILISV-ERPLCLDTREQMVASIMSKKLAAGSTHLLVDLPLGPSAKVIS
TYPH_MARMM      RVVETVGGCIVGGAVALSPVDDTLIRIERAL-DIDSDGQLVASVLSKKIAAGATHLVIDMPVGPTAKVRT
TYPH1_RALEH     RVVEQVGAALVGGALSLSPADDVLIRVERAL-DIDSDAQLVASILSKKIAAGSTHVLIDVPVGPTAKIRE
TYPH_MESSB      RVVEAEGGCIAGGAVHLSPADD-IFVRVERELDVDTEGQLIASVLSKKISAGSTHVVIDIPVGPTAKVRG
TYPH_SPHAL      RRVVDHGCIVWGGAVSLSPADDIIIGV-ERVLDLDAAGQLVASVLSKKLAAGATHLVVDMPIGPTAKVRS
TYPH_POLSJ      RVVERTGGCVVGGAVRLSPADDILIRV-ERPLDLDSQGQLVASILSKKVAAGSTHVLIDMPVGPTAKVRS
TYPH2_RALEJ     HVVERVGASLVGGALNLSPADDILIRVERAL-DIDSDAQLVASILSKKVAAGSTHILIDVPVGPTAKVRE
TYPH_AZOC5      RTVER-ARGCIAWNGRLSHS-----ALDDVMNAIDSTRWSVASILSKKLAAGSTHVVIDLPFGARARVKG
TYPH2_ACISJ     RVVERTGGCIVGGSVRLSPADDILIRV-ERPLDLDSEGQLVASVLSKKAAAGSTHVLIDLPVGATAKVRS
TYPH1_RALEJ     RCVAQARACIAGRLNHSVIDDVMNAITRPLG--LDSRRWAVASILSKKATAGATHVIVDIPYGPQTKLSA
TYPH2_RALEH     RCVAQARACIAGRLNHSVVDDVMNAITR--PLRLDSRRWSVASILSKKYTAGATHVIVDLPYGPQTKLAT
TRPD_CORJK      QDAHDTGFAFM-----------------------------------------------------------
TRPD_BRASB      RCVQEAGIGFMFAPAH-HPAMKNVGPTRVELAT-------------------------------------
TRPD_BRAJA      RCVRECGIGFMFAPAH-HPAMKNVGPTRVELAT-------------------------------------
TRPD_AGRRK      RCIREAGIGFM-----------------------------------------------------------
TRPD_BRASO      RCIREAGIGFMFAPAH-HPAMKNVGPTRVELAT-------------------------------------
TRPD_RHOPS      RCVTEAGIGFM-----------------------------------------------------------
TRPD_GLUOX      ----------------------------------------------------------------------
TRPD_XANP2      RCIAEAGIGFM-----------------------------------------------------------
TRPD_RHIL3      RCIAEAGVGFM-----------------------------------------------------------
TRPD_LISMF      YLLEKVGIAFL-----------------------------------------------------------
TRPD_LISMC      YLLEKVGIAFL-----------------------------------------------------------
TRPD_CHLL2      ELYARTGFSFL-----------------------------------------------------------
TRPD_CHLCV      SCVQEVGIGFM-----------------------------------------------------------
TRPD_CARHZ      RCVDEIGIGFL-FAPNLHPAMRHVAKTR------------------------------------------
TRPD_RHISN      RCIREAGVGFM-----------------------------------------------------------
TRPD_MANSM      KALDEIGIAIFAQQYHL--GFKYAGPVRQATRTIFNIPLINPANPKRQLLGVYSPELLKIVHGCGLDEVA
TRPD_PETMO      RCLKEINIAFL-----------------------------------------------------------
TRPD_STRZT      KVFDKTGIVFLFAK-NMHPAMKYIMPARLELGTIMNLTLIHPMALETQLLGISRPELLE---STAQVLKN
TRPD_STRPJ      KVFDKTGIVFLFAK-NMHPAMKYIMPARLELGTIMNLTLIHPMALETQLLGISRPELLE---STAQVLKN
TRPD_EXIS2      TLLETNGIAFL-----------------------------------------------------------
TRPD_RHILW      RCIAEAGVGFM-----------------------------------------------------------
TRPD_CHLFF      SCIQEVGIGFM-----------------------------------------------------------
TRPD_RHIE6      ----------------------------------------------------------------------
TRPD_MESSB      ACIAEAGVGFM-----------------------------------------------------------
TRPD_IGNH4      EVFERTGFVYL-FAPLYHPAMKNVAHVR-KNLGIRTIFNLAGPLSNPQLVGVSEPWMLDV------FAKA
TRPD_CHLTE      ELFRETGFAFLFAP-LYHPSMKAVAAIRKELGIKTIFNMLGPIIVRRQLIGVFDPSVMDI-YAEVLLLNG
TRPD_STRZP      KVFDKTGIVFLFAK-NMHPAMKYIMPARLELGTIMNLTLIHPMALETQLLGISRPELLE---STAQVLKN
TRPD_STRZJ      KVFDKTGIVFLFAK-NMHPAMKYIMPARLELGTIMNLTLIHPMALETQLLGISRPELLE---STAQVLKN
TRPD_STRR6      KVFDKTGIVFLFAK-NMHPAMKYIMPARLELGTIMNLTLIHPMALETQLLGISRPELLE---STAQVLKN
TRPD_STRPS      KVFDKTGIVFLFAK-NMHPAMKYIMPARLELGTIMNLTLIHPMALETQLLGISRPELLE---STAQVLKN
TRPD_STRPN      KVFDKTGIVFLFAK-NMHPAMKYIMPARLELGTIMNLTLIHPMALETQLLGISRPELLE---STAQVLKN
TRPD_STRPI      KVFDKTGIVFLFAK-NMHPAMKYIMPARLELGTIMNLTLIHPMALETQLLGISRPELLE---STAQVLKN
TRPD_STRP7      KVFDKTGIVFLFAK-NMHPAMKYIMPARLELGTIMNLTLIHPMALETQLLGISRPELLE---STAQVLKN
TRPD_STRP4      KVFDKTGIVFLFAK-NMHPAMKYIMPARLELGTIMNLTLIHPMALETQLLGISRPELLE---STAQVLKN
TRPD_STRP2      KVFDKTGIVFLFAK-NMHPAMKYIMPARLELGTIMNLTLIHPMALETQLLGISRPELLE---STAQVLKN
TRPD_STRMU      QVLDETGIVFL-FAQKMHPAMRYISPARQALGIPTVMNLIGPLTLETQLLG---LYQADLQDDLAQVLKL
TRPD_RHIEC      ----------------------------------------------------------------------
TRPD_LISIN      YLLEKVGIAFL-----------------------------------------------------------
TRPD_LACLS      QVFDKVGLVFL-FAQNLHPAMKYFTPVRRQLEIPTIMNLTGPLILDTQLLGTSRPDLLEL---TANVLKG
TRPD_LACLM      QVFDKVGLVFL-FAQNLHPAMKYFTPVRRQLEIPTIMNLTGPLILDTQLLGTSRPDLLEL---TANVLKG
TRPD_ARTS2      RNAEEAGI--------------------------------------------------------------
ATPA_LEPIN      ----------------------------------------------------------------------
ATPA_LEPIC      ----------------------------------------------------------------------
TRPD_LISW6      YLLEKVGIAFL-----------------------------------------------------------
TRPD_LISMO      YLLEKVGIAFL-----------------------------------------------------------
TRPD_AQUAE      RLIEEVGFGFM-FAPLFHPAMKRVVSPRREVGVRSIFNLIGPGVFSKKNLGVKKAFVV---HGEG----G
TRPD1_STRCO     EVAEEAGI--------------------------------------------------------------
TRPD_SINMW      RCIGEAGLGFM-----------------------------------------------------------
TRPD_RHIME      ----------------------------------------------------------------------
TRPD_DICT6      RDIDEKGIGII-----------------------------------------------------------
ATPA_LEPBL      ----------------------------------------------------------------------
ATPA_LEPBJ      ----------------------------------------------------------------------
TRPD_TRIEI      SALSEVGITFLFAPG-WHPAMKCVVPLRRTLKVRTVFNLLGNSTLVKTVAQALG--ILGVEYAIALHGRE
TRPD_CHLPB      MLFRETGFAFL-----------------------------------------------------------
TRPD_STRAW      EVAEEAGITI------------------------------------------------------------
TRPD_MYCGI      RCVAEVGI--------------------------------------------------------------
TRPD_CLOB8      KIIEENGMAFL-----------------------------------------------------------
TRPD_RHOPA      RCVNEAGIGFM-----------------------------------------------------------
TRPD_CHLCH      SLFKKTGFAFL-----------------------------------------------------------
TRPD_RHOPT      RCVNEAGIGFM-----------------------------------------------------------
TRPD_LISMH      YLLEKVGIAFL-----------------------------------------------------------
TRPD_LEGPC      ----------------------------------------------------------------------
TRPD_LACLA      QVFDKVGLVFL-FAQNLHPAMKYFTPVRRQLEIPTIMNLTGPLILDTQLLGTSRPDLLEL---TANVLKG
TRPD_GRABC      ----------------------------------------------------------------------
TRPD_PERMH      EAIDRIGLGFL-----------------------------------------------------------
TRPD_LEGPL      ----------------------------------------------------------------------
TRPD_LEGPH      ----------------------------------------------------------------------
TRPD_LEGPA      ----------------------------------------------------------------------
TRPD_IDILO      ----------------------------------------------------------------------
TRPD_BEII9      ----------------------------------------------------------------------
TRPD_STRGG      EVAEAAGI--------------------------------------------------------------
TRPD_NOCFA      RCVREVGI--------------------------------------------------------------
TRPD_CLOPH      KILEEMGLCFM-----------------------------------------------------------
TRPD_CLOCE      EILQKIGMCFM-----------------------------------------------------------
TRPD_ACIBY      RCIREMGVGFL-----------------------------------------------------------
TRPD_ACIBT      RCIREMGVGFL-----------------------------------------------------------
TRPD_ACIBS      RCIREMGVGFL-----------------------------------------------------------
TRPD_SYNFM      EAIGRIGIGFL-----------------------------------------------------------
TRPD_PELPB      ELFQESGFAFL-----------------------------------------------------------
TRPD_HAES2      ----------------------------------------------------------------------
TRPD_ACIAD      RCIREMGVGFL-----------------------------------------------------------
TRPD_SYNJB      ----------------------------------------------------------------------
TRPD_RHOPB      RCIKEAGIGFM-----------------------------------------------------------
TRPD_OLICO      ACIAKAGIGFM-----------------------------------------------------------
TRPG_THEMA      RELKETGFSFL-----------------------------------------------------------
TRPD_STAES      LNLK--GLAFISATDS-YPMMKKLQSIRKSIATPTIFNLIGPLINPFKL---------------------
TRPD_STAEQ      LNLK--GLAFISATDS-YPMMKKLQSIRKSIATPTIFNLIGPLINPFKL---------------------
TRPD_NOVAD      ----------------------------------------------------------------------
TRPD_LEUMM      ----------------------------------------------------------------------
TRPD_CHLAD      RCLRDAGIGFM-----------------------------------------------------------
TRPD_AZOC5      RCIAETGIGFM-----------------------------------------------------------
TRPD_PASMU      QALDEIGLCFL-----------------------------------------------------------
TRPD_NITHX      RCVNEAGIGFMFAPSH-HPAMKNVGPTRVELAT-------------------------------------
TRPD_METEP      RCLSEAGLCFM-----------------------------------------------------------
TRPD_METC4      RCLSEAGLCFM-----------------------------------------------------------
TRPD_DESRM      LCLDQVGIAFL-----------------------------------------------------------
DXS_MYCSS       ----------------------------------------------------------------------
DXS_MYCSK       ----------------------------------------------------------------------
DXS_MYCSJ       ----------------------------------------------------------------------
TRPD_CHLSY      RCLREAGIGFM-----------------------------------------------------------
TRPD_CHLAA      RCLREAGIGFM-----------------------------------------------------------
TRPD2_RALSO     ----------------------------------------------------------------------
TRPD_SYNJA      AAVAEVGITFL-----------------------------------------------------------
TRPD_METSB      ACLEAAGVAFM-----------------------------------------------------------
TRPD_HALHL      ECIRRVNVGFL-----------------------------------------------------------
TRPD_DICTD      ----------------------------------------------------------------------
TRPD_SYNWW      QLLDKAGITFL-FAPHYHPILKQVGGLRRGIATIFNFPLLNPCRPSYQVLGISDSNLQEAVAGTALVVHA
TRPD_THEVO      ----------------------------------------------------------------------
TRPD_MYCUA      RSLNENGI--------------------------------------------------------------
TRPD_METS3      KILKEINLCFL-----------------------------------------------------------
B3GTB_ARATH     ----------------------------------------------------------------------
ATPA_CARHZ      ----------------------------------------------------------------------
TRPD_SULTO      ----------------------------------------------------------------------
TRPD_SULAC      KLIKE-----------------------------------------------------------------
TRPD_SORC5      ----------------------------------------------------------------------
TRPD_MYCMM      RSLNEIGI--------------------------------------------------------------
TRPD_METRJ      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FEDAKKLAFLMLRIAQQHGKKAVAVLSNMDQPLGKAVGNSLEVIEAIETLKGNGPEDLKELSLTLGALML
PDP_BACST       XXXXXXXXXXMVDIGNRVGRKTMAIISDMSQPLGYAIGNALEVKEAIDTLKGEGPEDFQELCLVLGSHMV
PDP_STAHJ       LEDAEALAHAMVSIGNNVGRNTMAIISDMSQPLGRAIGNALELKEAIDTLNGKGPEDLTELVLTLGSQMV
PDP_STAAC       LEDAEALAHAMVRIGNNVGRNTMAIISDMNQPLGRAIGNALELQEAIDTLKGQGPKDLTELVLTLGSQMV
PDP_STAA8       LEDAEALAHAMVRIGNNVGRNTMAIISDMNQPLGRAIGNALELQEAIDTLKGQGPKDLTELVLTLGSQMV
PDP_STAA3       LEDAEALAHAMVRIGNNVGRNTMAIISDMNQPLGRAIGNALELQEAIDTLKGQGPKDLTELVLTLGSQMV
PDP_STAEQ       LDDAEALAHAMVRIGNNVGRNTMAIISDMSQPLGNAIGNALELKEAIATLKGNGPKDLTELVLTLGSQMV
PDP_STAAB       LEDAEALAHAMVRIGNNVGRNTMAIISDMNQPLGRAIGNALELQEAIDTLKGQGPKDLTELVLTLGSQMV
PDP_STAAW       LEDAEALAHAMVRIGNNVGRNTMAIISDMNQPLGRAIGNALELQEAIDTLKGQGPKDLTELVLTLGSQMV
PDP_STAAS       LEDAEALAHAMVRIGNNVGRNTMAIISDMNQPLGRAIGNALELQEAIDTLKGQGPKDLTELVLTLGSQMV
PDP_STAAN       LEDAEALAHAMVRIGNNVGRNTMAIISDMNQPLGRAIGNALELQEAIDTLKGQGPKDLTELVLTLGSQMV
PDP_STAAM       LEDAEALAHAMVRIGNNVGRNTMAIISDMNQPLGRAIGNALELQEAIDTLKGQGPKDLTELVLTLGSQMV
PDP_STAES       LDDAEALAHAMVRIGNNVGRNTMAIISDMSQPLGNAIGNALELKEAISTLKGNGPKDLTELVLTLGSQMV
PDP_STAAR       LEDAEALAHAMVRIGNNVGRNTMAIISDMNQPLGRAIGNALELQEAIDTLKGQGPKDLTELVLTLGSQMV
PDP_BACSU       EEDAAELAKAMVRIGNNVGRQTMAVISDMSQPLGFAIGNALEVKEAIDTLKGEGPEDLHELVLTLGSQMV
TYPH_SHEWM      YEASEELARSITAVANGAGTKTTALLTDMNQVLASCAGNAVEVKEAIDFLTGRNPR-LYEVTMGLCAEML
TYPH_COLP3      LDDAKALAQSITSVANGAGVKTQAIITDMNQVLGTSAGNAIEMYETVKYLTGKQREPLHKIVQALASAML
TYPH_RHISN      ARATKTLARSLVDVANGAGVNTLALITDMNEPLADAVGNALEVENCLAYLRGSGTRLDQXXXXXXXXXXX
TYPH_SHEPW      YEASEELARSITAVANGAGTKTTALLTDMNQVLASCAGNAVEVKEAVDFMTGRNPR-LYEVTMGLCAEML
TYPH_SHELP      YEASEELARSITAVANGAGTKTTALLTDMNQVLASCAGNAVEVKEAVDFLTGRNPR-LYEVTMGLCAEML
TYPH_SHEDO      YAASEELARSIAAVANGAGTKTTALLTDMNQVLASCAGNAVEVVEAINFLTGRNPR-LYEVTMGLCAEML
TYPH_PSYIN      FEQSEALANSIVGVANGAGCKTSALITNMDQVLASSAGNAVEVREAVRFLKGENPR-LHEVTMALCAEML
TYPH_SHEHH      YELSEELARSITAVANGAGTKTTALLTDMNQVLASCAGNAVEVKEAVDFMTGRNPR-LYEVTMGLCAEML
TYPH_SHESH      YEASEELARSITAVANGAGTKTTALLTDMNQVLASCAGNAVEVKEAVDFLTGRNPR-LYEVTMGLCAEML
TYPH_SHEB5      YEASEELARSIAAVANGAGTKTTALLTDMNQVLASCAGNAVEVKEAIDFLTGRNPR-LYEVTMGLCAEML
TYPH_SHEPA      YEASEELARSITAVANGAGTKTTALLTDMNQVLASCAGNALEVKEAVDFMTGRNPR-LYEVTMGLCAEML
TYPH_SHEB2      YEASEELARSIAAVANGAGTKTTALLTDMNQVLASCAGNAVEVKEAIDFLTGRNPR-LYEVTMGLCAEML
TYPH_RHILO      SRDATALANSLVEVASGAGLKVSALITGMNEPLASAAGNAVEVHNAVDFLTGRRDRRLEDVTLALAAEML
TYPH_SHEFN      YEASEELARSITAVANGAGTKTTALLTDMNQVLASCAGNAVEVREAINFLTGRNPR-LYAVTMGLCAEML
TYPH_SHESW      YEASEELARSITAVANGAGTKTTALLTDMNQVLASCAGNAVEVKEAIDFLTGRNPR-LYEVTMGLCAEML
TYPH_SHEPC      YEASEELARSITAVANGAGTKTTALLTDMNQVLASCAGNAVEVKEAIDFLTGRNPR-LYEVTMGLCAEML
TYPH_RHIME      PAETEVLARSLVEVANGAGVRTSALITDMNEPLADAAGNALEIENCLAYLRGEGTRLDQXXXXXXXXXXX
TYPH_SHEB9      YEASEELARSIAAVANGAGTKTTALLTDMNQVLASCAGNAVEVKEAIDFLTGRNPR-LYEVTMGLCAEML
TYPH_SHEB8      YEASEELARSIAAVANGAGTKTTALLTDMNQVLASCAGNAVEVKEAIDFLTGRNPR-LYEVTMGLCAEML
TYPH_SALHS      YELSKALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_SHEON      YEASEELARSIAAVANGAGTKTTALLTDMNQVLASCAGNALEVKEAIDFLTGRNPR-LYAVTMGLCAEML
TYPH_SHESR      YEASEELARSIAAVANGAGTKTTALLTDMNQVLASCAGNAVEVKEAIDFLTGRNPR-LYAVTMGLCAEML
TYPH_SHESM      YEASEELARSIAAVANGAGTKTTALLTDMNQVLASCAGNAVEVKEAIDFLTGRNPR-LYAVTMGLCAEML
TYPH_SALPK      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_SALPA      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_SALSV      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_SALTY      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_SALTI      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_SALNS      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_SALG2      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_SALEP      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_SALDC      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_SALA4      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_SHEAM      YEASLELARSITAVANGAGTKTTALLTDMNQVLASCAGNALEVKEAVDFLTGRNPR-LYEVTMGLCAEML
TYPH_ENT38      FELSAALAEAIVGVSNGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_SALCH      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_SALAR      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNALEVREAVQFLTGRNPR-LFDVTMALCIEML
TYPH_KLEP7      YELSAALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_VIBPA      YEASEELAKSIVAVANGAGTKTTAILTDMNQVLASSAGNAVEVREAVRFLTGRNPR-LLEVTMASCAEML
TYPH_SHESA      YEASEELARSIAAVANGAGTKTTALLTDMNQVLASCAGNAVEVKEAIDFLTGRNPR-LYAVTMGLCAEML
TYPH_PROMH      YQKSEELAESIVQVANGAGCQTTALLTDMNEVLASSAGNAVEVREAVQFLTGRNPR-LFEVTMALCVEML
TYPH_KLEP3      YELSAALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_AERHH      FEASEELAKSIVAVANGAGCRTSALLTDMNQVLASSAGNAVEVREAVRYLTGRNPR-IHAVTMALCAEML
TYPH_SODGM      LAGSEALAQAIVGVANGAGCRTIALLTDMNQVLASSAGNALEVREAVRFLTNDERNPLFEVTMALCSEML
TYPH_VIBF1      YEASEELAKSIVAVANGAGTKTTALLTDMNQVLASTAGNALEVREAIRFLTGRNPR-LYEVTMALCAEML
TYPH_ALISL      YEASEELAKSIVAVANGAGTKTTALLTDMNQVLASTAGNALEVREAIRFLTGRNPR-LYEVAMALCAEML
TYPH_VIBFM      YEASEELAKSIVAVANGAGTKTTALLTDMNQVLASTAGNALEVREAIRFLTGRNPR-LYEVTMALCAEML
TYPH_YERE8      YQLSEDLAKAIVGVANGAGCKTTALLTDMNQVLASSAGNAVEVREAVRFLTGRNPR-LLEVTMALCVEML
TYPH_AERS4      FEASEELAKSIVAVANGAGCRTSALLTDMNQVLASSAGNGVEVREAVRYLTGRNPR-IHEVTMSLCAEML
TYPH_AGRT5      LEDARILARALVDVANGAGLPTTALITDMNQPLCDAAGNAVEIVNCLEFLAGKAGTRLEKVVLSFAAEML
TYPH_IDILO      YDESRELAQSLVSVGRKLGVETTALITDMNQALGSAAGNAVEVQLAVDYLTGKRRDKLHQVTKALSAELL
TYPH_SERP5      YALSADLAQAIVGVANGAGCKTTALLTDMNQVLASSAGNAVEVREAVRFLTGRNPR-LLEVTMALCVEML
TYPH_SHIDS      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_CHRVO      MQKSIELAERIVKVGNGAGVATTALITEMSQPLASTAGNSIETREAVRYLKGDQRNPLHEVTMALCAQML
TYPH_MYCTU      PVQARELAHTMVELGAAHGVPTRALLTEMNCPLGRTXXXXXXXXXXXXXXXXXXPPDVVELTLRLAGEML
TYPH_BURCJ      AEKSAELARSIVDVGNGAGMKTTAILTDMNQSLAPCAGNALEVACAIDYLTGKSPARLHDVTMALSAELL
TYPH_BURCC      AEKSAELARSIVDVGNGAGMKTTAILTDMNQSLAPCAGNALEVACAIDYLTGKSPARLHDVTMALSAELL
TYPH_SINMW      PAETEILARSLVEVANGAGVRTSALITDMNEPLADAAGNALEVENCLAYLSGKAGTRLDRVVMXXXXXXX
TYPH_VIBVY      YEASEELAKSIVAVANGAGTKTTAILTDMNQVLASSAGNAVEVREAVRFLKGRNPR-LLEVTMASCAEML
TYPH_VIBVU      YEASEELAKSIVAVANGAGTKTTAILTDMNQVLASSAGNAVEVREAVRFLKGRNPR-LLEVTMASCAEML
TYPH_ERWCT      YELSEQLAQAIVGVANNAGCRTSALLTDMNQVLASSAGNALEVREAVRFLTGESRNPLYDVTMALCGEML
TYPH_PHOPR      YEASEDLAKSIVAVANGAGTKTTALLTDMNQVLASTAGNALEVREAVQFLTGRNPR-LFEVTMALCAEML
TYPH_VIBCH      YEASEELAKSIXXXXXXXXXXXXXILTDMNQVLASSAGNAVEVREAVRFLTGRNPR-LLEVTMASCAEML
TYPH_ESCF3      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_ENTS8      YALSEELAQAIVGVANGAGVRTTALLTDMNEVLASSAGNAVEVREAVRFLTGDNPR-LLEVTMALCVEML
TYPH_SHIFL      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_SHIF8      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_ECOLI      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_ECODH      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_ECO45      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_ECO27      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_SHISS      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_SHIB3      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_ECOSM      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_ECOSE      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_ECOLU      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_ECOLC      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_ECOL6      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_ECOHS      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_ECO8A      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_ECO7I      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_ECO5E      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_ECO57      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_ECO55      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_ECO24      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_BURS3      AEQSAELARSIVDVGNGAGMKTTAILTDMNQSLAPCAGNALEVACAIDYLTGKSPARLHDVTMALSAELL
TYPH_SHIBS      YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_YERPY      YSLSADLAQAIVGVANGAGCKTTALLTDMNQVLASSAGNGVEVREAVRFLTGRNPR-LLEVTMALCVEML
TYPH_YERPS      YSLSADLAQAIVGVANGAGCKTTALLTDMNQVLASSAGNGVEVREAVRFLTGRNPR-LLEVTMALCVEML
TYPH_YERP3      YSLSADLAQAIVGVANGAGCKTTALLTDMNQVLASSAGNGVEVREAVRFLTGRNPR-LLEVTMALCVEML
TYPH_YERPE      YSLSADLAQAIVGVANGAGCKTTALLTDMNQVLASSAGNGVEVREAVRFLTGRNPR-LLEVTMALCVEML
TYPH_ECO81      YELSEALAEAIVGVANGARVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGRNPR-LFDVTMALCVEML
TYPH_BURP0      AEQSAELARSIVDVGNGAGMRTAATLTDMNQALAPCAGNAIEVRCAIDFLTGAAPARLEAVSFALAAQML
TYPH_RAT        QEKARELAKMLVRVGMGLGLQVAAALTAMDNPLGRNVGHTLEVEEALLCLDGAGPPDLRDLVIRLGGAIL
TYPH_BURPS      AEQSAELARSIVDVGNGAGMRTAATLTDMNQALAPCAGNAIEVRCAIDFLTGAAPARLEAVSFALAAQML
TYPH_BURMS      AEQSAELARSIVDVGNGAGMRTAATLTDMNQALAPCAGNAIEVRCAIDFLTGAAPARLEAVSFALAAQML
TYPH_BURMA      AEQSAELARSIVDVGNGAGMRTAATLTDMNQALAPCAGNAIEVRCAIDFLTGAAPARLEAVSFALAAQML
TYPH_BURM7      AEQSAELARSIVDVGNGAGMRTAATLTDMNQALAPCAGNAIEVRCAIDFLTGAAPARLEAVSFALAAQML
TYPH_MOUSE      QEKARELAKMLVRVGVSLGLKVAAALTAMDNPLGRSVGHTLEVEEALLCLDGAGPPDLRDLVIRLGGAIL
TYPH_MYCGE      KKIANELAKLMQSIAKSFKRKLSVKLSDMNQVLGKAVGNVIEVNEAVNFLKQDGQDFIDLMQTIVINILL
TYPH_BURCH      AEKSAELARSIVDVGNGAGMKTTAILTDMNQSLAPCAGNALEVACAIDYLTGKSPARLHDVTMALSAELL
TYPH_BURCA      AEKSAELARSIVDVGNGAGMKTTAILTDMNQSLAPCAGNALEVACAIDYLTGKSPARLHDVTMALSAELL
TYPH_MYCPN      KTMAKELAQYMYSIAKQFKRKLYIKLSDMNQVLGKTIGNALEVLEVVHFLKRNGADFIQLMEQIVTEILI
TYPH_HUMAN      QEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPPDLRDLVTTLGGALL
TYPH_ERWT9      LEQSEALAQAIFGVANGAGCKTTVLLTDMNQPLASSAGNALEVREAVQFLTGRNPR-LLEVTMALCREML
TYPH_MYCPI      IETAKKISNIMKNLAKKFKRKVYFVLSDMNEVLGNTVGNAIEVKEAIDFLKNNSDVGFKKLMFDLVTLLL
TYPH_BURP6      AEQSAELARSIVDVGNGAGMRTAATLTDMNQALAPCAGNAIEVRCAIDFLTGAAPARLEAVSFALAAQML
TYPH_THEON      VDEARALARDFIELGKRLGQYVEVAITYGGQPIGHTVGPALEAREALQALSGTGPGSLIEKATGLAGILL
TYPH_METBU      VQEGRKLARDLINLGDRLGMDVDCALTYGASPVGRTIGPALEVIEALKVLESEGPNSLIEKSASLAGMLL
TYPH_UNCMA      VQEGRKLARDFMELGDRLGMKIECALTYGGTPLGRAIGGGVEVREAMVMLKFEGPRSLLEKTIAISGMML
TYPH_PYRHO      MDEARTLAKDFIELGKKLGQYVEVAITYGGQPIGYAIGPALEAKEALETLTGKGPGSLVEKATGLAGILL
TYPH_MYCHO      INEAKKLGKLMIEIGKKLNRKIAVEITNMQQPLGKTIGNKIEVLEAIDTLNGHGPKDFTEIIYSSGSTLL
TYPH_PYRAB      MEEARSLAKDFIELGKKLGQYVEVAITYGGQPIGYTVGPALEAKEALETLTGKGPGSLVEKALGLAGILL
TYPH_METHJ      IEEGKKLARQFIDLGERLNMRVECALTYGDAPVGRAIGPKLEIKEALSVLEGDSPRSLIQKSCVIAGIAL
TYPH_METBF      VQEGQKLARDLINLGHRLGMNVECAITYGSSPIGRKVGPSLEVREALKVLESEGPNSLIEKSAALAGILL
TYPH_THESM      VEDARSLAKDFIELGKRLGQYVETAITYGGQPIGHTVGPALEAKEALETIEGKGPGSLVEKATGLAGILL
TYPH_PYRKO      VEEARSLARDFIELGKRLGQYVEVAITYGGQPIGHTVGPALEAREALSALTGKGPGSLIEKATGLAGILL
TYPH_METMA      VQEGQKLARDLINLGHRLGMNVECAITYGSSPIGRRVGPSLEVKEAMKVLESEGPNSLIEKSAALAGILL
TYPH_METAC      VQEGQKLARDLINLGHRLGMNVECAITYGSSPIGRRVGPCLEVREAMKVLESEGPNSLIEKSAALAGILL
TYPH_THEGJ      MDEARALARDFIELGKRLGQYVEVAITYGGQPIGHTVGPALEAREALSALTGKGPGSLIEKALGLAGILL
TYPH1_ARCFU     VEVGRSLANDFIELGRRLGLNVMAAITYGGQPVGRAIGPALEAREALKTMEDRGPSSLVEKSLGIAGILF
TYPH_THEPD      LEEAKRISQSFFEIARMFGMNLQAVATYAEEPIGHAIGPXXXXXXXXXXXXXXXPGDLVDKAASLAGTLL
TYPH_META3      EKEGNQLARKFIELGELLGIRVECVLTYGGQPIGRAIGPALEIKEALMALHDSAPNSLIEKSVSLAGVLL
TYPH_METB6      VQEGRKLAREFIELGERLGMKVECALTYGDIPVGYSIGPNLEVREALRVLEGTEPNSFIQKSVSLAGIAL
TYPH_METJA      IKEASSLARKFIELSDRLRIVTECAITYGGQPIGRAIGPXXXXXXXXXXXXDQAPTSLVEKSISLAGILL
TYPH_METLZ      EAEGRVLANELITLGNRLGIRVECAVTFGGSPIGRNIGVNLEVSEALSLLEGRGANSLVQKSVAIAGIAL
TYPH_PYRFU      MEEARSLARDFIELGKRLGQYVEVAITYGGQPIGYTVGPALEAKEALETLTGRGPGSLVEKXXXXXXXXX
TYPH_METVS      EAEGAKLARKFIELGELLNIRVECVLTYGGQPLGRAIGXXXXXXXXXXTDPKSAPKSLIEKAISLAGILL
TYPH_LEGPC      QSMALLLKQSLEEVGNELGLVVHTILTDGSQPVGHGIGPSLEARDVMSVLQGDAPNDLRERALTLAGAAL
TYPH2_ARCFU     VDVGRGFANAMMEIGRNLNLKVATALTDGSQPLGRAIGPALEAREVLEVMERKVEGDLLEKSLGIAGILF
TYPH_METMJ      AQEGRKLAREFIDLGERLGMRVECALSYGESLVGHTIGPNLEVREALAVLEGTEPNSLIQKSLSLAGIAL
TYPH_LEGPN      QSMALLLKQSLEEVGNELGLVVRALFTDGSQPVGHGIGPSLEARDVLAVLQGDAPNDLRERALTLAGAAL
TYPH_LEGPH      QSMALLLKQSLEEVGNELGLVVRALFTDGSQPVGHGIGPSLEARDVLAVLQGDAPNDLRERALTLAGAAL
TYPH_METMP      EAEGAKLARKFIELGELLNIKVECVLTYGGQPLGRAIGPALEAKEAIEALQDNAPKSLIEKXXXXXXXXX
TYPH_METCA      MRDAMSLRKLFEYVGDRVGLHLEAVITDGAQPVGRGIGPVLEVRDVMQVLENDAPVDLREKSLRLAGRIL
TYPH_PSEU5      MAEAQRLRKLFEFVATRLGLTLDVVITDGRQPIGNGIGPVLEARDVIQVLQNDAPIDLRQKALRLAGRML
TYPH_METM5      EAEGAKLARKFIELGESLNIKVECVLTYGGQPLGRAIGPALEAREAIEALQDNAPKSLIEKXXXXXXXXX
TYPH_METTP      PEKARVLAKDLTDLGERLGIRVECAMTFGGSPVGRTVGPALEVREALKMLEGEGPNSLREKSLALAGILL
TYPH_LEGPA      QSMALLLKQXXXXXXXXXXXXXRTLLTDGSQPVGHGIGPSLEARDVMAVLQGDAPNDLRERALTLAGAAL
TYPH_HYPBU      ESEAELLASMFLAQAGRLNIAMRVAITFGGEPIGFSVGPALEAREALQTLKGDGASSLVEKACSLAGLVF
TYPH_HAHCH      PEYAERLASHMRYTGVKLGIQVEAMFTDGAQPVGRGIGPALEARDILAVLRNQAPADLRVRALTLAGRLL
TYPH_METM6      EAEGAKLARKFIELGELLNIKVECVLTYGGQPLGRAIGPALEAREAIEALQDNAPKSLIEKXXXXXXXXX
TYPH_PARL1      RETAEHLAHHLSEVAASFGLVLRCLFTDGNQPVGRGIGPALEARDVLAVLRADAPQDLCDRVALVAGAVL
TYPH_RHOPS      ASEAMRLRKLFEFVGDHFGIAVEVVTTDGRQPIGRGIGPVLEARDVMAVLEPNAPADLREKSLRLAAHLL
TYPH_METM7      EAEGAKLARKFIELGEMLNIKVECVLTYGGQPLGRAIGPALEAKEAIESLQDNAPKSLIEKXXXXXXXXX
TYPH_TOLAT      RETAEHLAHHLSEVAASFGLVLRCLFTDGNQPVGRGIGPALEARDVLAVLRADAPQDLCDRVALVAGAVL
TYPH_BRASO      GAEAMRLRKLFEFVGDRFGLKVEVITTDGRQPIGHGIGPVLEARDVMAVL-GNEPQDLREKSLRLAAHLL
TYPH_BRASB      GAEAMRLRKLFEFVGDRFGLNVEVITTDGRQPIGNGIGPVLEARDVMAVLEPGAPADLREKSLRLAAHLL
TYPH_BRAJA      AVEAMRLRKLFEFVGDRFGRTVEVITTDGRQPIGNGIGPVLEANDVMAVLGNDAPRDLREKSLRLAAHLL
TYPH_RHOFD      MPEAQRLRRLFEYVAGRMHLSLDVVVTDGRQPIGNGIGPVLEARDVMRVLENDAPNDLRQKSLRLAGRLI
TYPH_RHOPT      ANEAMRLRKLFEFVGDHFGISVEVVTTDGRQPIGRGIGPVLEARDVMAVLKPGAPADLREKSLRLAAHLL
TYPH_NATPD      LSEARDLADDFRRVGDHLGLTIECALTRGSDPIGHGIGPVLEARDVLAVLEGEGPEPLRIKSLRLADIIF
TYPH_RHOPB      ALDAMRLRKLFEFVGDHFGIAVETITTDGRQPIGNGIGPVLEAQDVMAVL-GNDPKDLREKSLRLAAHLL
TYPH_RALSO      LQDLERLRMLLERVARSFGVRVTIVRTDGSQPVGRGIGPALEARDVLAVLQRSAPFDLRERSLLLAATLL
TYPH1_ACISJ     TEAAQSLGRRLVEVGRAIGLQVTLRITDGLQPVGRGVGPALEARDVLAVLRGDAPDDLRQRALRLAGDIL
TYPH_RHOPA      ANEAMRLRKLFEFVGDHFGISVEVVTTDGRQPIGRGIGPVLEARDVMAVLEPGAPADLREKSLRLAAHLL
TYPH_NITHX      EMEAMRLRKLFEFVGDHYGISVEVVVTDGRQPIGNGIGPVLEAQDVMAVLANDAPADLREKSLRLAAHLL
TYPH_ROSDO      QGEAGALKNLFESVGQGIGLNTKVQISDGTKPIGRGVGPVLEALDVLSVLRGGAPTDLLDKSIGYAATIL
TYPH_RHOP5      PIDAMRLRKLFEFVGDHFGIAVETITTDGRQPIGNGIGPVLEAQDVMAVL-GNDPKDLREKSLRLAGHLL
TYPH_MARMM      EEAAARLEGLFARVGSNLGLNLKIMRTDGSQPVGRGIGPALEAWDVLAVLEGHNVPDLTVQATLLAGELL
TYPH1_RALEH     DSDLARLDLAMTKVADAFGLKLRILRTDGSQPVGRGVGPALEALDVLAVLQPTAPADLRERSLLLAGELL
TYPH_MESSB      EDAASHLASRITAVASRFGLAATCVQTDGSQPVGRGIGPALEAFDVLAVLQNXXXXXXXXXXXXXXXXXX
TYPH_SPHAL      PADAAALSGALQKVAAEFGLILKVMQGDGREPIGRGIGPALEARDILAVLEGDPPPDLARRACELAGALI
TYPH_POLSJ      AEAADLLGRLLGQVGQTLGLRMRVVQTDGLAPVGRGIGPALEARDVLAVLRATAPADLAQRSLLLAGEVL
TYPH2_RALEJ     DRDLERLEAAMRHVAGAFGLHILMVRTDGTQPLGRGIGPALEARDILAVLQRTAPPDLRERSVMLAGALL
TYPH_AZOC5      AGEAHEMARLFEQVGAGLGLTVEAIPTDGSAPIGRGIGPALEVRDVLWVLESEAPPDLKEKALFFASRIL
TYPH2_ACISJ     AHAAASLGRRLQEVGGAIGLQVFLRVTDGEQPVGRGIGPALEARDVLAVLQGTXXXXXXXXXXXXXXXXX
TYPH1_RALEJ     RADADALAGLFEEVGKGLGLHVRALVTDGSRPIGRGVGPALEVRDVRQVLENDAPMDLREKALRFGEIIA
TYPH2_RALEH     RADAEALGALFEHVGKGLGLHVRALVTDGSGPIGRGIGPALEVRDVRLVLDNDAPADLRDKALRFAGEII
TRPD_CORJK      ----------------------------------------------------------------------
TRPD_BRASB      ----------------------------------------------------------------------
TRPD_BRAJA      ----------------------------------------------------------------------
TRPD_AGRRK      ----------------------------------------------------------------------
TRPD_BRASO      ----------------------------------------------------------------------
TRPD_RHOPS      ----------------------------------------------------------------------
TRPD_GLUOX      ----------------------------------------------------------------------
TRPD_XANP2      ----------------------------------------------------------------------
TRPD_RHIL3      ----------------------------------------------------------------------
TRPD_LISMF      ----------------------------------------------------------------------
TRPD_LISMC      ----------------------------------------------------------------------
TRPD_CHLL2      ----------------------------------------------------------------------
TRPD_CHLCV      ----------------------------------------------------------------------
TRPD_CARHZ      ----------------------------------------------------------------------
TRPD_RHISN      ----------------------------------------------------------------------
TRPD_MANSM      IHGLTQVAEL------RDGKIEYYNLSPKDQPLESLRGGAPEENAKILTLQGKGSEQQAQAVAMNTALLM
TRPD_PETMO      ----------------------------------------------------------------------
TRPD_STRZT      M--GRKRAIVVLDEAGLNGTTKIALLENGEISLSSFTPEDLGMEDAMEDIRGGNAQENAEILLSVGLGFY
TRPD_STRPJ      M--GRKRAIVVLDEAGLNGTTKIALLENGEISLSSFTPEDLGMEDAMEDIRGGNAQENAEILLSVGLGFY
TRPD_EXIS2      ----------------------------------------------------------------------
TRPD_RHILW      ----------------------------------------------------------------------
TRPD_CHLFF      ----------------------------------------------------------------------
TRPD_RHIE6      ----------------------------------------------------------------------
TRPD_MESSB      ----------------------------------------------------------------------
TRPD_IGNH4      LKNLG-----VERAAVVHGRPGIDEVSKISYSVIDVEDFGAKPLESLEPLKVRDIKEAKEKFLRAAAMAI
TRPD_CHLTE      CEDEPSVCGPTSMIELHQGQIIRHTVEPEDFGLGRAGGDSHVNAQIIEILDGSAPQAKIDAALFASAITC
TRPD_STRZP      M--GRKRAIVVLDEAGLNGTTKIALLENGEISLSSFTGNAQENAEILSVLKNEASPFLETTVLNAGLGFY
TRPD_STRZJ      M--GRKRAIVVLDEAGLNGTTKIALLENGEISLSSFTGNAQENAEILSVLKNEASPFLETTVLNAGLGFY
TRPD_STRR6      M--GRKRAIVVLDEAGLNGTTKIALLENGEISLSSFTGNAQENAEILSVLKNEASPFLETTVLNAGLGFY
TRPD_STRPS      M--GRKRAIVVLDEAGLNGTTKIALLENGEISLSSFTGNAQENAEILSVLKNEASPFLETTVLNAGLGFY
TRPD_STRPN      M--GRKRAIVVLDEAGLNGTTKIALLENGEISLSSFTGNAQENAEILSVLKNEASPFLETTVLNAGLGFY
TRPD_STRPI      M--GRKRAIVVLDEAGLNGTTKIALLENGEISLSSFTGNAQENAEILSVLKNEASPFLETTVLNAGLGFY
TRPD_STRP7      M--GRKRAIVVLDEAGLNGTTKIALLENGEISLSSFTGNAQENAEILSVLKNEASPFLETTVLNAGLGFY
TRPD_STRP4      M--GRKRAIVVLDEAGLNGTTKIALLENGEISLSSFTGNAQENAEILSVLKNEASPFLETTVLNAGLGFY
TRPD_STRP2      M--GRKRAIVVLDEAGLNGTTKIALLENGEISLSSFTGNAQENAEILSVLKNEASPFLETTVLNAGLGFY
TRPD_STRMU      L--GRKRAVIIMDEAALYGKNHYTLLDNGQISQGSFTGDAKENAQILVSVLKNEPSPYLETTLLNAGLGF
TRPD_RHIEC      ----------------------------------------------------------------------
TRPD_LISIN      ----------------------------------------------------------------------
TRPD_LACLS      LGRKRALVITGMDEATPFGLNHYALLENGEVTLHKAADVGMSEVALNDIRGGEAPENLKNVLENCSSAFL
TRPD_LACLM      LGRKRALVITGMDEATPFGLNHYALLENGEVTLHKAADVGMSEVALNDIRGGEAPENLKNVLENCSSAFL
TRPD_ARTS2      ----------------------------------------------------------------------
ATPA_LEPIN      -----------------------------------ASGNRPAVDVGISVSRVGSAAQIKAMKQVAGKMKL
ATPA_LEPIC      -----------------------------------ASGNRPAVDVGISVSRVGSAAQIKAMKQVAGKMKL
TRPD_LISW6      ----------------------------------------------------------------------
TRPD_LISMO      ----------------------------------------------------------------------
TRPD_AQUAE      IDEVSVEGETYVTEVSEEGIRSFTFLGVKRKSLSEVRVNSPEVKVALSVLRGGTPRDMVLLNASFGILVS
TRPD1_STRCO     ----------------------------------------------------------------------
TRPD_SINMW      ----------------------------------------------------------------------
TRPD_RHIME      ----------------------------------------------------------------------
TRPD_DICT6      ----------------------------------------------------------------------
ATPA_LEPBL      -----------------------------------ASGNRPAVDVGISVSRVGSAAQIKAMKQVAGKMKL
ATPA_LEPBJ      -----------------------------------ASGNRPAVDVGISVSRVGSAAQIKAMKQVAGKMKL
TRPD_TRIEI      KLDEAGLGDITDIAILSHGEKATSILGLNYAPISTLQGGDVEQNAEINVLQGKGTSQQTDVVALNSSLAL
TRPD_CHLPB      ----------------------------------------------------------------------
TRPD_STRAW      ----------------------------------------------------------------------
TRPD_MYCGI      ----------------------------------------------------------------------
TRPD_CLOB8      ----------------------------------------------------------------------
TRPD_RHOPA      ----------------------------------------------------------------------
TRPD_CHLCH      ----------------------------------------------------------------------
TRPD_RHOPT      ----------------------------------------------------------------------
TRPD_LISMH      ----------------------------------------------------------------------
TRPD_LEGPC      ----------------------------------------------------------------------
TRPD_LACLA      LGRKRALVITGMDEATPFGLNHYALLENDKVTLHERGGEAPENAEILKNVLENQPSAFLETTVLNAGLGF
TRPD_GRABC      ----------------------------------------------------------------------
TRPD_PERMH      ----------------------------------------------------------------------
TRPD_LEGPL      ----------------------------------------------------------------------
TRPD_LEGPH      ----------------------------------------------------------------------
TRPD_LEGPA      ----------------------------------------------------------------------
TRPD_IDILO      ----------------------------------------------------------------------
TRPD_BEII9      ----------------------------------------------------------------------
TRPD_STRGG      ----------------------------------------------------------------------
TRPD_NOCFA      ----------------------------------------------------------------------
TRPD_CLOPH      ----------------------------------------------------------------------
TRPD_CLOCE      ----------------------------------------------------------------------
TRPD_ACIBY      ----------------------------------------------------------------------
TRPD_ACIBT      ----------------------------------------------------------------------
TRPD_ACIBS      ----------------------------------------------------------------------
TRPD_SYNFM      ----------------------------------------------------------------------
TRPD_PELPB      ----------------------------------------------------------------------
TRPD_HAES2      ----------------------------------------------------------------------
TRPD_ACIAD      ----------------------------------------------------------------------
TRPD_SYNJB      ----------------------------------------------------------------------
TRPD_RHOPB      ----------------------------------------------------------------------
TRPD_OLICO      ----------------------------------------------------------------------
TRPG_THEMA      ----------------------------------------------------------------------
TRPD_STAES      ----------------------------------------------------------------------
TRPD_STAEQ      ----------------------------------------------------------------------
TRPD_NOVAD      ----------------------------------------------------------------------
TRPD_LEUMM      ----------------------------------------------------------------------
TRPD_CHLAD      ----------------------------------------------------------------------
TRPD_AZOC5      ----------------------------------------------------------------------
TRPD_PASMU      ----------------------------------------------------------------------
TRPD_NITHX      ----------------------------------------------------------------------
TRPD_METEP      ----------------------------------------------------------------------
TRPD_METC4      ----------------------------------------------------------------------
TRPD_DESRM      ----------------------------------------------------------------------
DXS_MYCSS       ----------------------------------------------------------------------
DXS_MYCSK       ----------------------------------------------------------------------
DXS_MYCSJ       ----------------------------------------------------------------------
TRPD_CHLSY      ----------------------------------------------------------------------
TRPD_CHLAA      ----------------------------------------------------------------------
TRPD2_RALSO     ----------------------------------------------------------------------
TRPD_SYNJA      ----------------------------------------------------------------------
TRPD_METSB      ----------------------------------------------------------------------
TRPD_HALHL      ----------------------------------------------------------------------
TRPD_DICTD      ----------------------------------------------------------------------
TRPD_SYNWW      FNGMDEISPEGKTRVFDVGEHGLEVFDIDPEELGIG-GFSLDAIQVIKVLQGEPGPYRDTVILNTAAALL
TRPD_THEVO      ----------------------------------------------------------------------
TRPD_MYCUA      ----------------------------------------------------------------------
TRPD_METS3      ----------------------------------------------------------------------
B3GTB_ARATH     ----------------------------------------------------------------------
ATPA_CARHZ      -----------------------------------------------------GAAQIKAMKQVAGSLRL
TRPD_SULTO      ----------------------------------------------------------------------
TRPD_SULAC      ----------------------------------------------------------------------
TRPD_SORC5      ----------------------------------------------------------------------
TRPD_MYCMM      ----------------------------------------------------------------------
TRPD_METRJ      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ELAGVADFEEGKKILQEKLETGEALDKFRLLVKAQGGNERVVDDPWRVLPVAEQVVEFSAAREGFVSKID
PDP_BACST       YLAEKASLEEARHMLEKAMKDGSALQTFKTFLAAQGGDASVVDDPSK-LPQAKYIIELEAKEDGYVSEIV
PDP_STAHJ       VLANRANLEEARQLLNEAIENGSALEKFKTFLENQGGDVSVVDAP-ELLPTATYQIEYKAQSSGVVSELI
PDP_STAAC       VLANKAELEEARALLIEAINSGAALEKFKTFIKNQGGDETVIDHPER-LPQAQYQIEYKAKKSGYVTELV
PDP_STAA8       VLANKAELEEARALLIEAINSGAALEKFKTFIKNQGGDETVIDHPER-LPQAQYQIEYKAKKSGYVTELV
PDP_STAA3       VLANKAELEEARALLIEAINSGAALEKFKTFIKNQGGDETVIDHPER-LPQAQYQIEYKAKKSGYVTELV
PDP_STAEQ       VLAEQASLDEARQMLIDAIKTGKALNKFKTFLSNQGGDDSIVDSPEK-LPSAKYQVEFKAKKDGYITEII
PDP_STAAB       VLANKAELEEARALLIEAIDSGAALEKFKTFIKNQGGDETVIDHPER-LPQAQYQIEYKAKKSGYVTELV
PDP_STAAW       VLANKAELEEARALLIEAINSGAALEKFKTFIKNQGGDETVIDHPER-LPQAQYQIEYKAKKSGYVTELV
PDP_STAAS       VLANKAELEEARALLIEAINSGAALEKFKTFIKNQGGDETVIDHPER-LPQAQYQIEYKAKKSGYVTELV
PDP_STAAN       VLANKAELEEARALLIEAINSGAALEKFKTFIKNQGGDETVIDHPER-LPQAQYQIEYKAKKSGYVTELV
PDP_STAAM       VLANKAELEEARALLIEAINSGAALEKFKTFIKNQGGDETVIDHPER-LPQAQYQIEYKAKKSGYVTELV
PDP_STAES       VLAEQASLDEARQMLIDAIKTGKALNKFKTFLSNQGGDDSIVDSPEK-LPSAKYQVEFKAKKDGYITEII
PDP_STAAR       VLANKAELEEARALLIEAIDSGAALEKFKTFIKNQGGDKTVIDHPER-LPQAQYQIEYKAKKSGYVTELV
PDP_BACSU       VLAKKADLDEARAKLEEVMKNGKALEKFKDFLKNQGGDSSIVDDPSK-LPQAAYQIDVPAKEAGVVSEIV
TYPH_SHEWM      MLGGIASTEQAREKLNAVLDNGKAAEIFGRMISGLGGPTDFVENPGLYLPESKIIRPVYAEQTGFATSMD
TYPH_COLP3      INTNLASSEDAREKIDKVLNSGLAAEKFDRMVSALGGPKNFIEKPWDSMKKANVITEVRALQHGYIAQTD
TYPH_RHISN      XXXXXXXXXXXXXXXRQALESGDAMERFALMVHRLGGPADFVDRSEAYLEKAPAVVIVPANRDGYLAACE
TYPH_SHEPW      TLGGIASNEEARAKLNEVLDNGKAAEIFGRMVSGLGGPTDFVENYSKYLPDSQIIRPVYAEQTGFATAMD
TYPH_SHELP      QLGGLAASEDAREKLNRVLDNGKAADIFGRMIAGLGGPADFIENYAKYLPQSQIIRPVYADRSGFAASMD
TYPH_SHEDO      VLGGIAQNEEARTKLNTVLDNGKAAEVFGKMIAGLGGPTDFIEAYDKYLPQAKIIRPVFSDAQGYAHSMD
TYPH_PSYIN      LLSGLADIKEAQAKLQKVLDNGKAAEVFAKMVGALGGPADFIENQDNYLQKSAIVRPVYAQHSGIVQSMD
TYPH_SHEHH      VLGGIASNEEARVKLNAVLDNGKAAEIFGRMVSGLGGPADFVENYSKYLPDSQIIRPVYADRAGFASAMD
TYPH_SHESH      QLGGIASSEEAREKLNRVLDNGKAAEIFGRMISGLGGPADFIENTGLYLPESKIIRPVYADQTGFASAMD
TYPH_SHEB5      LLGGLASNEDARAKLNRVLDNGRAAELFGKMVSGLGGPADFVENYSKYLPQSQIIRPVFADMQGYAYSMD
TYPH_SHEPA      VLGGLASNEEARVKLNTVLDNGKAAEIFGRMVSGLGGPADFVENYSKYLPDSQIIRPVYADRSGFASAMD
TYPH_SHEB2      LLGGLASNEDARAKLNRVLDNGRAAELFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADMQGYAYSMD
TYPH_RHILO      QSTGVSSNQDGLRRATETLTSGRAAATFARMVAVLGGPADFIEKPEKYLAVAPTEFAVRATTDGFVTGIA
TYPH_SHEFN      ILGGIAQNEEARHKLNTVLDNGKAAEAFAKMVSGLGGPTDFVEAYDKYLPHAKIVRPVYANTSGFAYKMD
TYPH_SHESW      LLGGLASNEEARAKLNRVLDNGRAAEIFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADAKGYAYSMD
TYPH_SHEPC      LLGGLASNEEARAKLNRVLDNGRAAEIFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADAKGYAYSMD
TYPH_RHIME      XXXXXXXXXXXXXXXRRVLGSGEAMERFGLMVHRLGGPADFVDRPGAYLAKAPAILAVPAGRHGYLTSCK
TYPH_SHEB9      LLGGLASNEDARAKLNRVLDNGRAAELFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADMQGYAYSMD
TYPH_SHEB8      LLGGLASNEDARAKLNRVLDNGRAAELFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADMQGYAYSMD
TYPH_SALHS      ISGQLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMD
TYPH_SHEON      LLGGLADEADARAKLNRVLDNGRAAEIFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADTQGYAHSMD
TYPH_SHESR      LLGGLADEADARAKLNRVLDNGRAAEIFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADTQGYAHSMD
TYPH_SHESM      LLGGLADEADARAKLNRVLDNGRAAEIFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADTQGYAHSMD
TYPH_SALPK      ISGNLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMD
TYPH_SALPA      ISGNLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMD
TYPH_SALSV      ISGQLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMD
TYPH_SALTY      ISGQLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMD
TYPH_SALTI      ISGQLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMD
TYPH_SALNS      ISGQLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMD
TYPH_SALG2      ISGQLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMD
TYPH_SALEP      ISGQLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMD
TYPH_SALDC      ISGQLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMD
TYPH_SALA4      ISGQLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMD
TYPH_SHEAM      VLGGLANDADARTKLNTVLDNGRAAEIFGKMVSGLGGPADFVESYDKYLPKASIIRPVYAERDGFAYSMV
TYPH_ENT38      ISGKLADDAEARAKLQAVLDNGKAAEIFGRMVAAQKGPNDFVENYAKYLPTAMLSKAVYADTEGFVSAMD
TYPH_SALCH      ISGQLADDAEARTKLQAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMD
TYPH_SALAR      ISGQLADDAQARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYDKYLPAAMLSKAVYADTEGFVSAMD
TYPH_KLEP7      -ISGAADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPSDFVENYANYLPTAMLSKAVYADTEGFISAMD
TYPH_VIBPA      VLAKLAETDDARAKLMEVLDNGKAAACFGKMVAGLGGPADFVENYDNYLEKAEIIKPVYATETGIVSAMD
TYPH_SHESA      LLGGLADEADARAKLNRVLDNGRAAEIFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADTQGYAYSMD
TYPH_PROMH      VSGRLADSQQARQKLQDVLDNGKAAEVFARMVAAQNGPTDFVENYNKYLPTAVLSKPVFAEKAGFVTEMD
TYPH_KLEP3      -ISGAADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYDHYLPTAMLSKAVYADTEGFISAMD
TYPH_AERHH      ISAGLADDGEARRKLQAVLDNGKAAEIFGRMVTGLGGPSDFMERYDHHLPKAAIVRPVYAANSGFVTAMD
TYPH_SODGM      MIAGLAHSEDARTALVRALDSGEAAERFGRMVAVQGGPADFVQRYDLYLPVATLSKPVFPAGEGYIRSMD
TYPH_VIBF1      VIANLADEQDARAKLQTVLDNGKAAECFGKMVFGLGGPSDIIENYDNHLESAQIIKPVFADTTGFVQAMD
TYPH_ALISL      VIANLADEQEACIKLQAVLDNGKAAECFGKMVFGLGGPNDIIENYDNHLETAQIIKPVFADKSGFVNTMD
TYPH_VIBFM      VIANLADEQDARAKLQTVLDNGKAAECFGKMVFGLGGPSDIIENYDNHLESAQIIKPVFADTTGFVHAMD
TYPH_YERE8      LSGGLAQNDDARAKLQAVLDNGKAAEIFGRMVAAQKGPSDFVERYDSYLPAAMLSKPVFAERSGIITAMD
TYPH_AERS4      ISAHLADDADARRKLQAVLDNGKAAEIFGRMVTGLGGPSDFMERYDSYLPKAAIVRPVYAANAGFVTAMD
TYPH_AGRT5      QARKXXXXXXXXXXXXXXXXXXXXMEIFARMVSVLGGPSDFIENPSRYLACAPIILPVPAARSGWLASCA
TYPH_IDILO      VSGNLAKSTDQAEVMVENLGSGLAAERFAKMVGSLGGPHDFLEKSDQYLPQARKPLKLPAEYHGYLSEVN
TYPH_SERP5      LSGGXXXXXXXXXXXXXXLDNGKAAEVFGRMVAAQQGPTDFVERYDSYLPAATLSKPVYAEKQGIISAMD
TYPH_SHIDS      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_CHRVO      -IGGAADEADARAKLQAALDSGRAAEIFGRMVTALGGPADFMEHYDRHLAPAPIMRPVYADRAGYVGAMD
TYPH_MYCTU      ELAGIHGRDPA-----QTLRDGTAMDRFRRLVAAQGG------DLSKPLPIGSHSETVTAGASGTMGDID
TYPH_BURCJ      VTGGLADVGHAREKLQQALDSGAAAERFARMVVALGGPADLLDAPARHLARXXXXXXXXXXXXXXXQRVD
TYPH_BURCC      VTGGLADAAHAREKLQQALDSGAAAERFARMVVALGGPADLLDAPARHLXXXXXXXXXXXXXXXXXQRVD
TYPH_SINMW      XXXGVAHKAEGEAMARRALESGEALERFGLMVHRLGGPADFVERPEAYLEXXXXXXXXXXXXDGYLAACE
TYPH_VIBVY      VLGKLAETEDARAKLMEVLDNGKAAECFGKMVAGLGGPVDFMDNYDNYLDKAEIIKPVYAKETGVVSAMD
TYPH_VIBVU      VLGKLAETEDARAKLMEVLDNGKAAECFGKMVAGLGGPVDFMDNYDNYLDKAEIIKPVYAKETGVVSAMD
TYPH_ERWCT      LAGGLASADDAHSRLQAVLDNGKAADVFGRMVAAQRGPGDFVEHYDRYLPVATLSKPVFATREGVVTAMD
TYPH_PHOPR      VNSGLADIEQAREQLQAVLDNGKAATCFGKMVAGLGGPVDFMENYDNYLEKAEIAKPVFAETTGYAYAMD
TYPH_VIBCH      VLGKLADTAQAREKLQAVLDNGQAADRFGKMVAGLGGPSDFVENYDKYLAKAEIIRPVYAQQSGVISAMD
TYPH_ESCF3      TSGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_ENTS8      LSGGLADETEARAKLQQVLDNGQAAEIFGRMVAAQSGPADFVDNYERYLPAATLSKAVYADRSGFVTQMD
TYPH_SHIFL      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_SHIF8      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_ECOLI      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_ECODH      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_ECO45      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_ECO27      ISSKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_SHISS      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_SHIB3      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_ECOSM      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_ECOSE      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_ECOLU      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_ECOLC      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_ECOL6      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_ECOHS      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_ECO8A      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_ECO7I      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_ECO5E      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_ECO57      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_ECO55      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_ECO24      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_BURS3      VTGGLADVXXXXXXXXXXXXSGAAAERFARMVTALGGPADLIDAPARHLXXXXXXXXXXXXXSGVVQRVD
TYPH_SHIBS      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_YERPY      LSGGLADEADARAKLQAVLDNGKAAEVFGRMVAAQKGPVDFVERYDSYLPVATLSKPVFAEQTGIITAMD
TYPH_YERPS      LSGGLADEADARAKLQAVLDNGKAAEVFGRMVAAQKGPVDFVERYDSYLPVATLSKPVFAEQTGIITAMD
TYPH_YERP3      LSGGLADEADARAKLQAVLDNGKAAEVFGRMVAAQKGPVDFVERYDSYLPVATLSKPVFAEQTGIITAMD
TYPH_YERPE      LSGGLADEADARAKLQAVLDNGKAAEVFGRMVAAQKGPADFVERYDSYLPVATLSKPVFAEQTGIITAMD
TYPH_ECO81      ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMD
TYPH_BURP0      TMGGXXXXXXXXXXXXXXLESGXXXXXXXXXXXXLGGPADLVERPERHLXXXXXXXXXXXXXXGWIERID
TYPH_RAT        WLSGQAETDQGAARVAAALDDGSALHRFQLMLSAQGGLARALTQRRQLLPHARKQEELLSPADGIVECVR
TYPH_BURPS      TMGGXXXXXXXXXXXXXXLESGXXXXXXXXXXXXLGGPADLVERPERHLXXXXXXXXXXXXXXGWIERID
TYPH_BURMS      TMGGXXXXXXXXXXXXXXLESGXXXXXXXXXXXXLGGPADLVERPERHLXXXXXXXXXXXXXXGWIERID
TYPH_BURMA      TMGGXXXXXXXXXXXXXXLESGXXXXXXXXXXXXLGGPADLVERPERHLXXXXXXXXXXXXXXGWIERID
TYPH_BURM7      TMGGXXXXXXXXXXXXXXLESGXXXXXXXXXXXXLGGPADLVERPERHLXXXXXXXXXXXXXXGWIERID
TYPH_MOUSE      WISGQAETDQGAARVAAALDDGSARRRFQLMLSAQGVDPGLATQRRQLLPHAREQEELLAPADGIVECVR
TYPH_MYCGE      ETKQAKTKQKAIELYQDVLTSKKAWNRFLSFIESQGGNVELFTQKEGFFK-PKYKASIKAEKSGFTDPID
TYPH_BURCH      VTGGLADAAHAREKLQQALDSGXXXXXXXXXXXXXXXXXXXXXXXXRHLARXXXXXXXXXXXXXXXQRVD
TYPH_BURCA      VTGGLADAAHAREKLQQALDSGXXXXXXXXXXXXXXXXXXXXXXXXRHLARXXXXXXXXXXXXXXXQRVD
TYPH_MYCPN      ETKRAPNKRAAVALYHATLEGEKPWQRF