[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tmar0:AAD36800.1

[Show Plain Result]


## Summary of Sequence Search
    1::1074
   64::253     1e-05  26%  759 aa  LPTD_PSEA6 RecName: Full=LPS-assembly protein lptD;AltName:
   69::216     9e-05  27%  757 aa  LPTD_IDILO RecName: Full=LPS-assembly protein lptD;AltName:
  157::338     3e-04  26%  938 aa  LPTD_PSEMY RecName: Full=LPS-assembly protein lptD;AltName:
   71::149     4e-04  27%  360 aa  Y871_RICPR RecName: Full=Uncharacterized protein RP871;
  157::221     6e-04  31%  771 aa  LPTD_COLP3 RecName: Full=LPS-assembly protein lptD;AltName:
   18::126     8e-04  29%  257 aa  FENR_BUCAP RecName: Full=Ferredoxin--NADP reductase;       
    1::1074

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LPTD_PSEA6      ----------------------------------------------------------------------
LPTD_IDILO      ----------------------------------------------------------------------
LPTD_PSEMY      ----------------------------------------------------------------------
Y871_RICPR      ----------------------------------------------------------------------
LPTD_COLP3      ----------------------------------------------------------------------
FENR_BUCAP      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxAIFWTFSRLSEERELMAIQVHGISQKNLIVPFLILGALLSIAVFFLSDQIVPEYQS
LPTD_PSEA6      ----------------------------------------------------------------------
LPTD_IDILO      ----------------------------------------------------------------------
LPTD_PSEMY      ----------------------------------------------------------------------
Y871_RICPR      --------------AVLYIYNNLKVERQLIILQTSGVNNIQLALPALYVALTIMLLAYYISSTILP----
LPTD_COLP3      ----------------------------------------------------------------------
FENR_BUCAP      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KAEEAMSKYVLKKPEVFVVENVISKIGDDQYFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LPTD_PSEA6      ----------------------------------------------------------------------
LPTD_IDILO      ----------------------------------------------------------------------
LPTD_PSEMY      ----------------------------------------------------------------------
Y871_RICPR      -----LSHINLKSRLNFIKNNYISSMIEEKTF--------------------------------------
LPTD_COLP3      ----------------------------------------------------------------------
FENR_BUCAP      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LPTD_PSEA6      ----------------------------------------------------------------------
LPTD_IDILO      ----------------------------------------------------------------------
LPTD_PSEMY      ----------------------------------------------------------------------
Y871_RICPR      ----------------------------------------------------------------------
LPTD_COLP3      ----------------------------------------------------------------------
FENR_BUCAP      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LPTD_PSEA6      ----------------------------------------------------------------------
LPTD_IDILO      ----------------------------------------------------------------------
LPTD_PSEMY      ----------------------------------------------------------------------
Y871_RICPR      ----------------------------------------------------------------------
LPTD_COLP3      ----------------------------------------------------------------------
FENR_BUCAP      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSSQVVIVSDRMEKFPEEMVFHGSVEI
LPTD_PSEA6      --------------------------------------------NGQIQVISNQQDNFAE---FEGDVEI
LPTD_IDILO      -----------------------------------------------------------EKAYFTGNVII
LPTD_PSEMY      ---------------------------------------------------ASRYEQEKQIATLAGDVVL
Y871_RICPR      ----------------------------------------------------------------------
LPTD_COLP3      ----------------------------------------------------------------------
FENR_BUCAP      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AYKDMTVQASEATIQLTEEGKAKKLEASGGVIYRKADTILMGEHLIFYLENEKSVLTHIRGSTVLXXXXX
LPTD_PSEA6      TNKDSQIIANKAQIDRTTQ----QLIATGDVSYQNPQLSVTSQKVLLNTQNNRMEIANARGQAELLVVDQ
LPTD_IDILO      QRNGQWLSTSKATI----DQQRGEILASDGITFNDGYLSVTGDSLSLDLNDDQAKLYNS------DYRLQ
LPTD_PSEMY      RQSGMQVEADEASLHQAEN----RGELVGNVRLRDKGTLVVGDRAELQLDNGEARIAHVRGSAL------
Y871_RICPR      ----------------------------------------------------------------------
LPTD_COLP3      ----------------------------------------------------------------------
FENR_BUCAP      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           XXXXYLSGEDLTSEGSRTIVDMGSISTCSETPPHYKLKARYIEIKENDYLLAKDVVFYLLEIPLFYQPIF
LPTD_PSEA6      TQGLELNGV--------------TFSTCPTGQEDWLVHADSITVKPDETRVARNAFFYVQDIPIFYLPYY
LPTD_IDILO      NHNARGHAELLSLSRQEVLLQDSSFTTCPGETPAWQLRAERIEINESDFGEAWHARFELFDVPVLYLPYF
LPTD_PSEMY      ----YAKRE----ETAIIRLKDGTYTRCEPGDNAWHLKGNNVTLNPTGFGTATNVTLRVKDIPVFYTPYI
Y871_RICPR      ----------------------------------------------------------------------
LPTD_COLP3      ----------INSDGMMSLVD-STFTTCLQEVPDWQIKASEINLSKGDFGEAYHAQFRVLDVPVFYVPYF
FENR_BUCAP      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           FTSLSDKPQPFSVEVGVGNNPHLKTSYNVSYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LPTD_PSEA6      SFPVTDARETGLLFPQVGSSSSTGFAYEQPY---------------------------------------
LPTD_IDILO      NFPLSD----------------------------------------------------------------
LPTD_PSEMY      YFPIDDRRQPPSLGTSSSNGFSLQTPY-------------------------------------------
Y871_RICPR      ----------------------------------------------------------------------
LPTD_COLP3      SFPIS-----------------------------------------------------------------
FENR_BUCAP      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LPTD_PSEA6      ----------------------------------------------------------------------
LPTD_IDILO      ----------------------------------------------------------------------
LPTD_PSEMY      ----------------------------------------------------------------------
Y871_RICPR      ----------------------------------------------------------------------
LPTD_COLP3      ----------------------------------------------------------------------
FENR_BUCAP      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LPTD_PSEA6      ----------------------------------------------------------------------
LPTD_IDILO      ----------------------------------------------------------------------
LPTD_PSEMY      ----------------------------------------------------------------------
Y871_RICPR      ----------------------------------------------------------------------
LPTD_COLP3      ----------------------------------------------------------------------
FENR_BUCAP      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNLFTTTLRVPLGPFSFESYYKLFTVSGENLRKFSQNESKN
LPTD_PSEA6      ----------------------------------------------------------------------
LPTD_IDILO      ----------------------------------------------------------------------
LPTD_PSEMY      ----------------------------------------------------------------------
Y871_RICPR      ----------------------------------------------------------------------
LPTD_COLP3      ----------------------------------------------------------------------
FENR_BUCAP      ------------------------------NLFSLILNAEIAPFQAGQFTKL-ALNEENIN-FSNNVKKK


                         +         .         .         .         .         *         .:910
query           EVDLKVSFSYENFKSSLETTYDFLEKEFSDPYLKTSYSFKTGDITHTVDSTTRFVLDEISRSYTTWNFQQ
LPTD_PSEA6      ----------------------------------------------------------------------
LPTD_IDILO      ----------------------------------------------------------------------
LPTD_PSEMY      ----------------------------------------------------------------------
Y871_RICPR      ----------------------------------------------------------------------
LPTD_COLP3      ----------------------------------------------------------------------
FENR_BUCAP      KIQRAYSFVNAPSNKNLEI---YIVRILNGKLSNLLYNLKSGDNLFIKEKSFGFTLDEIPNCKTLWMFAT


                         .         .         .         +         .         .         .:980
query           RMGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LPTD_PSEA6      ----------------------------------------------------------------------
LPTD_IDILO      ----------------------------------------------------------------------
LPTD_PSEMY      ----------------------------------------------------------------------
Y871_RICPR      ----------------------------------------------------------------------
LPTD_COLP3      ----------------------------------------------------------------------
FENR_BUCAP      GTG-------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LPTD_PSEA6      ----------------------------------------------------------------------
LPTD_IDILO      ----------------------------------------------------------------------
LPTD_PSEMY      ----------------------------------------------------------------------
Y871_RICPR      ----------------------------------------------------------------------
LPTD_COLP3      ----------------------------------------------------------------------
FENR_BUCAP      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxx
LPTD_PSEA6      ------------------------
LPTD_IDILO      ------------------------
LPTD_PSEMY      ------------------------
Y871_RICPR      ------------------------
LPTD_COLP3      ------------------------
FENR_BUCAP      ------------------------