[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tmar0:AAD36835.1

[Show Plain Result]


## Summary of Sequence Search
    1::497
   33::548     5e-88  37%  548 aa  Y1202_STAAR RecName: Full=Uncharacterized protein SAR1202;
   33::548     7e-88  36%  548 aa  Y1240_STAAC RecName: Full=Uncharacterized protein SACOL1240;
   33::548     7e-88  36%  548 aa  Y1226_STAAM RecName: Full=Uncharacterized protein SAV1226;
   33::548     7e-88  36%  548 aa  Y1193_STAA8 RecName: Full=Uncharacterized protein SAOUHSC_01193;
   33::548     7e-88  36%  548 aa  Y1160_STAAS RecName: Full=Uncharacterized protein SAS1160;
   33::548     7e-88  36%  548 aa  Y1119_STAA3 RecName: Full=Uncharacterized protein SAUSA300_1119;
   33::548     7e-88  36%  548 aa  Y1069_STAAN RecName: Full=Uncharacterized protein SA1069;
   33::548     8e-87  36%  548 aa  Y1109_STAAW RecName: Full=Uncharacterized protein MW1109;
   33::548     8e-87  36%  548 aa  Y1090_STAAB RecName: Full=Uncharacterized protein SAB1090;
   33::552     3e-85  36%  552 aa  Y792_STAEQ RecName: Full=Uncharacterized protein SERP0792;
   33::552     6e-85  36%  552 aa  Y901_STAES RecName: Full=Uncharacterized protein SE_0901;
   33::552     3e-82  35%  552 aa  Y1546_STAS1 RecName: Full=Uncharacterized protein SSP1546;
   33::552     8e-82  34%  552 aa  Y1689_STAHJ RecName: Full=Uncharacterized protein SH1689;
   32::557     3e-55  32%  557 aa  Y369_MYCGE RecName: Full=Uncharacterized protein MG369;
   32::509     6e-45  31%  558 aa  Y547_MYCPN RecName: Full=Uncharacterized protein MG369 homolog;
  248::414     5e-04  24%  743 aa  NDC80_NEUCR RecName: Full=Probable kinetochore protein ndc-80;
    1::497

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFPVPDGDTGSNMCSTMLEACKYIDNVKSDDLIEVWKAVKEGALMGARGNSGVILSQILRGMADASPREY
Y1202_STAAR     VYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTFSKGLLMGARGNSGVILSQLFRGFCNIESESE
Y1240_STAAC     VYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTFSKGLLMGARGNSGVILSQLFRGFCNIESESE
Y1226_STAAM     VYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTFSKGLLMGARGNSGVILSQLFRGFCNIESESE
Y1193_STAA8     VYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTFSKGLLMGARGNSGVILSQLFRGFCNIESESE
Y1160_STAAS     VYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTFSKGLLMGARGNSGVILSQLFRGFCNIESESE
Y1119_STAA3     VYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTFSKGLLMGARGNSGVILSQLFRGFCNIESESE
Y1069_STAAN     VYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTFSKGLLMGARGNSGVILSQLFRGFCNIESESE
Y1109_STAAW     VYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTFSKGLLMGARGNSGVILSQLFRGFCNIESESE
Y1090_STAAB     VYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTFSKGLLMGARGNSGVILSQLFRGFCNIESESE
Y792_STAEQ      VYPVPDGDTGTNMNLTITSGREEVENNLSQNIGELGKTFSKGLLMGARGNSGVILSQLFRGFCNIEGEKE
Y901_STAES      VYPVPDGDTGTNMNLTITSGREEVENNLSQNIGELGKTFSKGLLMGARGNSGVILSQLFRGFCNIEEEKE
Y1546_STAS1     VYPVPDGDTGTNMNLTMTSGREAVENNLSQQIGELGKTFSKGLLMGARGNSGVILSQLFRGFSKSETYET
Y1689_STAHJ     VYPVPDGDTGTNMNLTITSGREEVENNLSQSIGELGKTFSKGLLMGARGNSGVILSQLFRGFCNIETENE
Y369_MYCGE      VFPVPDGDTGTNMKVTITEAIKKLENEKSHSFSELGKNFTRDLLLFSRGNSGVIFSQIMKGFFSTSNNSE
Y547_MYCPN      VFPVPDGDTGTNMKVTLSEAFKKLESEISHSFSDLGKSFTRDLLLFSRGNSGVIFSQIMKGFSDMISTKT
NDC80_NEUCR     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ITPADFVKMISNARKVAYSAVMRPVEGTMLTVVRVLDERLQGKNFETFEELFDWIVEIARDTVNRTPHML
Y1202_STAAR     INSKLLAESFQAGVETAYKAVMKPVEGTILTVXXXXXXXXXXNNTEDCIELMEYIIVKANESLENTPNLL
Y1240_STAAC     INSKLLAESFQAGVETAYKAVMKPVEGTILTVXXXXXXXXXXNNTEDCIELMEYIIVKANESLENTPNLL
Y1226_STAAM     INSKLLAESFQAGVETAYKAVMKPVEGTILTVXXXXXXXXXXNNTEDCIELMEYIIVKANESLENTPNLL
Y1193_STAA8     INSKLLAESFQAGVETAYKAVMKPVEGTILTVXXXXXXXXXXNNTEDCIELMEYIIVKANESLENTPNLL
Y1160_STAAS     INSKLLAESFQAGVETAYKAVMKPVEGTILTVXXXXXXXXXXNNTEDCIELMEYIIVKANESLENTPNLL
Y1119_STAA3     INSKLLAESFQAGVETAYKAVMKPVEGTILTVXXXXXXXXXXNNTEDCIELMEYIIVKANESLENTPNLL
Y1069_STAAN     INSKLLAESFQAGVETAYKAVMKPVEGTILTVXXXXXXXXXXNNTEDCIELMEYIIVKANESLENTPNLL
Y1109_STAAW     INSKLLAESFQAGVETAYKAVMKPVEGTILTVXXXXXXXXXXNNTEDCIELMEYIIVKANESLENTPNLL
Y1090_STAAB     INSKLLAESFQAGVETAYKAVMKPVEGTILTXXXXXXXXXXXNNTEDCIELMEYIIVKANESLENTPNLL
Y792_STAEQ      ISVQQFAESFQAGVETAYKAVMKPVEGTILTVAKDAAKAAMDDQAEDCVDLMVHVIEAASESLDNTPNLL
Y901_STAES      ISVQQFAESFQAGVETAYKAVMKPVEGTILTVAKDAAKAAMDDQAEDCVDLMAHLIEAASESLDNTPNLL
Y1546_STAS1     INAKQFAESFKAGVDTAYKAIMKPVEGTILTVXXXXXXXXIQKAEETDDELMAYILEEAEVSLENTPNLL
Y1689_STAHJ     INAQQLASSFQAGVDTAYKAVMKPVEGTILTXXXXXXXXXXXXXEETDDEVMEYTIAEAEKSLNNTPNLL
Y369_MYCGE      LSIEDVANAFIVAQEVAYKNVSKPVEGTMLTVARLISNEFKSQKNKTLEKLFEQAVKVAWQAVKKTPQML
Y547_MYCPN      ATETDFATAFIKAEEVAYKNVSKPVEGTMLTVIRLIDFKNQKNRAKTVQKLFEQVIKTAWQTVKKTPQML
NDC80_NEUCR     -----------------------------------------GQNWSTFLGLLHWMMQLAQMLEGYARHQY


                         +         .         .         .         .         *         .:210
query           QKLREAGVVDAGAKGLYYIFEGMRDAVKGNIQVNLEEVEQASVEELQRMAFEEITNRYCTEVAVRRNQVV
Y1202_STAAR     AVLKEVGVVDSGGKGLLCVYEGFLKALKG------EKVE-AKVAKLDKDEFEDIIYGYCTEMMVRNKKAF
Y1240_STAAC     AVLKEVGVVDSGGKGLLCVYEGFLKALKG------EKVE-AKVAKIDKDEFEDIIYGYCTEMMVRNKKAF
Y1226_STAAM     AVLKEVGVVDSGGKGLLCVYEGFLKALKG------EKVE-AKVAKIDKDEFEDIIYGYCTEMMVRNKKAF
Y1193_STAA8     AVLKEVGVVDSGGKGLLCVYEGFLKALKG------EKVE-AKVAKIDKDEFEDIIYGYCTEMMVRNKKAF
Y1160_STAAS     AVLKEVGVVDSGGKGLLCVYEGFLKALKG------EKVE-AKVAKIDKDEFEDIIYGYCTEMMVRNKKAF
Y1119_STAA3     AVLKEVGVVDSGGKGLLCVYEGFLKALKG------EKVE-AKVAKIDKDEFEDIIYGYCTEMMVRNKKAF
Y1069_STAAN     AVLKEVGVVDSGGKGLLCVYEGFLKALKG------EKVE-AKVAKIDKDEFEDIIYGYCTEMMVRNKKAF
Y1109_STAAW     AVLKEVGVVDSGGKGLLCVYEGFLKALKG------EKVE-AKVAKIDKDEFEDIIYGYCTEMMVRNKKAF
Y1090_STAAB     AVLKEVGVVDSGGKGLLCVYEGFLKALKG------EKVE-AKVAKLDKDEFEDIIYGYCTEMMVRNKKAF
Y792_STAEQ      AVLKEVGVVDSGGKGLLCVYEGFLKGLKG------EKVE-AQAPKLDTESFEDIVYGYCTEMMVRNKKAF
Y901_STAES      AVLKEVGVVDSGGKGLLCVYEGFLKGLKG------EKIE-AQAPKLDTESFEDIVYGYCTEMMVRNKKAF
Y1546_STAS1     PVLKEVGVVDSGGKGLAIVYAGFLKALKGETKLNKESLVNEEHDFHGVINTEDIVYGYCTEMMVRNKKTF
Y1689_STAHJ     AVLKEVGVVDSGGKGLLCVYEGFLKGLTGQTKLNTEELVHEEHDFHGVINTEDIKYGYCTEMMVRFGKDK
Y369_MYCGE      PVLKASGVVDSGAYGFACFLEGMLSYYGG--ESNLDDNTLSTIEIKFNKFKEQHANEYCTEYVLRLNQTV
Y547_MYCPN      PVLKASGVVDSGAYGFACFLEGMLSFYGEKATLNDGKLTSAELSQMTISGEKHVTEEYCTEYVLKLSQEV
NDC80_NEUCR     DACMEAGVDIAGDQIIFFLTSAYQDWLNMDDEAGDEDVERALQPHVQGMAFERSNAKYIQELEILEGELK


                         .         .         .         +         .         .         .:280
query           EKSELEAFLNEIGDSVVLVEQDDLIKLHVHTNHPGQVLEKVIEFGEIVKVKIDNMKLQHEHVISTQPTKE
Y1202_STAAR     DEQEFRQDMSQFGDSLLVINDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQTVE
Y1240_STAAC     DEQEFRQDMSQFGDSLLVINDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQTVE
Y1226_STAAM     DEQEFRQDMSQFGDSLLVINDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQTVE
Y1193_STAA8     DEQEFRQDMSQFGDSLLVINDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQTVE
Y1160_STAAS     DEQEFRQDMSQFGDSLLVINDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQTVE
Y1119_STAA3     DEQEFRQDMSQFGDSLLVINDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQTVE
Y1069_STAAN     DEQEFRQDMSQFGDSLLVINDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQTVE
Y1109_STAAW     DEQEFRQDMSQFGDSLLVINDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQTVE
Y1090_STAAB     DEQEFRQDMSQFGDSLLVINDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQTVE
Y792_STAEQ      DEQEFRNDMSEFGDSLLVINDDEIVKVHVHTEHPGDVFNYGQKYGELIKLKVENMREQHREVIRKEQTVE
Y901_STAES      DEQEFRNDMSEFGDSLLVINDDEIVKVHVHTEHPGDVFNYGQKYGELIKLKVENMREQHREVIRKEQTVE
Y1546_STAS1     DEQNFREDMSQFGDSLLVINDEEIVKVHVHTEKPGDVFNYGQQYGELIKLKVENMREQHREVISTEETQA
Y1689_STAHJ     RAFDEQTFMSQFGDSLLVINDDEIVKVHVHTETPGEVFNYGQEYGELIKLKVENMREQHREVIRKEKTVE
Y369_MYCGE      EKKKFESKVNRIANSVVIASDKDFVKVHAHTLKPHLLLEMGLNYGEFEFVKIDNMNLQVNNK-NNSPTKR
Y547_MYCPN      EKKKFESKVSKIATSVVVASDKDFVKVHAHTEKPXXXXXXXXXXXXXXXVKIENMNLQVAKQKPAPVKRN
NDC80_NEUCR     EIQELEKSTPDILDNHFKIMEEDKIKFEEYNTLAMQRTEKYENRIQVLREELGKLHVE------------


                         .         *         .         .         .         .         +:350
query           IGVVAVSPGKGISDILKSLGVDVIVPGGQTMNPSFADLKAAVEQTHAKNVFLFPNNANVLLTAKQIAEAF
Y1202_STAAR     TAIITISMGEGISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIV
Y1240_STAAC     TAIITISMGEGISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIV
Y1226_STAAM     TAIITISMGEGISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIV
Y1193_STAA8     TAIITISMGEGISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIV
Y1160_STAAS     TAIITISMGEGISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIV
Y1119_STAA3     TAIITISMGEGISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIV
Y1069_STAAN     TAIITISMGEGISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIV
Y1109_STAAW     TAIITISMGEGISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIV
Y1090_STAAB     TAIITISMGEGISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIV
Y792_STAEQ      TAIVTISVGDGIAELFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNIMMASEQAASIV
Y901_STAES      TAIVTISVGDGIAELFKSMGATHIISGGQTMNPSTEDIVKVIEQSQCKRAIILPNNKNIMMASEQAASIV
Y1546_STAS1     VAVIAISMGEGISEIFKSMGATHMISGGQTMNPSTEDIVKIIEQSQCKRAIILPNNKNILMASEQAAEIV
Y1689_STAHJ     TAIIAISMGDGISELFTSMGATHIISGGQTMNPSTEDIVKVIEQSQCKRAIILPNNKNIRMSSDQAATLV
Y369_MYCGE      VAIVATVPTEAFAEIREDHDINAILCTDDTGAPSVFSLLEAVKLTNSSNVIFLLHDKNYFLSANETIKQL
Y547_MYCPN      IAIVVTVPTEAFADIREDYDIQAILCTDDTGAPSVFSLLEAVKLTHSSNIIFLLHDKNYFLSANEALKQL
NDC80_NEUCR     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DDRRVIVVPTSFVQECVAAMVEYDPDAEPEDLLKRFEEAISQCVPISVTRAVRDSRYGNRRIRKGEYLLF
Y1202_STAAR     D-AEAVVIPTKSIPQGISALFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGL
Y1240_STAAC     D-AEAVVIPTKSIPQGISALFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGL
Y1226_STAAM     D-AEAVVIPTKSIPQGISALFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGL
Y1193_STAA8     D-AEAVVIPTKSIPQGISALFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGL
Y1160_STAAS     D-AEAVVIPTKSIPQGISALFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGL
Y1119_STAA3     D-AEAVVIPTKSIPQGISALFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGL
Y1069_STAAN     D-AEAVVIPTKSIPQGISALFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGL
Y1109_STAAW     D-AEAVVIPTKSIPQGISALFQCDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGL
Y1090_STAAB     D-AEAVVIPTKSIPQGISALFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGL
Y792_STAEQ      E-AETVVIPTKSIPQGISALFQYDQESNLEDNKSHMNDALETVQSGSITFAVRDTKIDGIEIKKDEFMGL
Y901_STAES      E-AETVVIPTKSIPQGISALFQYDLESSLEDNKRHMSDALETVQSGSITFAVRDTKIDGIEIKKDEFMGL
Y1546_STAS1     -EADTIVIPTKSIPQGIAALFNYDETDSLESNKSRMVESLEAVRSGSVTYAVRDTKIDGVEIKKDAFMGL
Y1689_STAHJ     E-ADTVVIPTTSIPKGIAALFQYDPSSSLEDNHSHMTTALESVKSGSVTFAVRDTKIDGVEIKKGEFMGL
Y369_MYCGE      KHQKINAVITANPVESIAALTVFNSDLSIHTNVKAMKRFIKEFASATITQASKSYKENKVMVNKNDFIAV
Y547_MYCPN      KHQKISAVMTTNPIESLAALTVFNSDLNIHTNVKTMRRFVKGFASATITQASKKYKENRIEVNKGDFIAV
NDC80_NEUCR     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VRKELVSHGFSLVKVLKEALEKENAHEKEILTVFLGDNYRKPELEKIQKLIGEEFPNLDLEIYEGGQPHY
Y1202_STAAR     IEDKIVSSQSDQLTTVTELLNEMLADDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPIY
Y1240_STAAC     IEDKIVSSQSDQLTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPIY
Y1226_STAAM     IEDKIVSSQSDQLTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPIY
Y1193_STAA8     IEDKIVSSQSDQLTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPIY
Y1160_STAAS     IEDKIVSSQSDQLTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPIY
Y1119_STAA3     IEDKIVSSQSDQLTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPIY
Y1069_STAAN     IEDKIVSSQSDQLTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPIY
Y1109_STAAW     IEDKIVSSQSDQLTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPIY
Y1090_STAAB     IEDKIVSSKSDQLTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQNPDVEVEVHEGGQPIY
Y792_STAEQ      AEDKIVISDFNQFHAVKGLLSKLLNEDSEILTMISGEDADNSITNQIIDWIESEYPDVEVEQHEGGQPIY
Y901_STAES      AEDKIVTSDVNQFHAVKGLLSKLLNEDSEILTMISGEDADNSITNQIINWIESEYPDVEVEQHEGGQPIY
Y1546_STAS1     IEDKIVTSHADQFETVKGLMAEMINEDSEIITMIVGMDADKTVTSDIEDWMEATYPDVELEQHDGQQPVY
Y1689_STAHJ     SESKIVTSNDDEFVTVTGLLKSMLNEDSEILTIIAGEDANDDISDKLVEWVESEYPDVEVEEHNGGQPIY
Y369_MYCGE      TNKSIIASESQLTDCFFKTIDSKKVKKPEFLLAYYGKDITEQDAKKMQALVEKKY-KLFCEFSPGEQKVF
Y547_MYCPN      AEKELVQCVFNTIDHLLKKVKK------------------------------------------------
NDC80_NEUCR     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           PYLMLLQ
Y1202_STAAR     QYFFSVE
Y1240_STAAC     QYFFSVE
Y1226_STAAM     QYFFSVE
Y1193_STAA8     QYFFSVE
Y1160_STAAS     QYFFSVE
Y1119_STAA3     QYFFSVE
Y1069_STAAN     QYFFSVE
Y1109_STAAW     QYFFSVE
Y1090_STAAB     QYFFSVE
Y792_STAEQ      QYFFAVE
Y901_STAES      QYFFAVE
Y1546_STAS1     QYLFSVE
Y1689_STAHJ     QYLFSVE
Y369_MYCGE      SYIIGIQ
Y547_MYCPN      -------
NDC80_NEUCR     -------