[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tmar0:AAD36879.1

[Show Plain Result]


## Summary of Sequence Search
    1::124
   10::115     3e-07  28%  118 aa  Y580_METJA RecName: Full=Uncharacterized protein MJ0580;
    1::124

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIV
Y580_METJA      MKIALPIDNNR-----LSPHFGRCEKF-MXXXXXXXXXXXXXXXXXTARNGMHGVSASLIANMGVNAIIV


                         .         .         *         .         .         .         .:140
query           RGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQLKxxxxxxxxxxxxxxx
Y580_METJA      QNIGPKAYSVFKQLGIDVYKANTTSIDECIKLFLEGKLE---------------