[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tmar0:AAD35126.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bp8A.bssp"
#ERROR : Can't open dsspfile "1bg3A.bssp"
#ERROR : Can't open dsspfile "3bp8B.bssp"
#ERROR : Can't open dsspfile "1dgkN.bssp"
#ERROR : Can't open dsspfile "1czaN.bssp"
#ERROR : Can't open dsspfile "2ap1A.bssp"
#ERROR : Can't open dsspfile "1bg3B.bssp"
#ERROR : Can't open dsspfile "1bdgA.bssp"
#ERROR : Can't open dsspfile "2aa4A.bssp"
#ERROR : Can't open dsspfile "3b8aX.bssp"
#ERROR : Can't open dsspfile "2ch6C.bssp"
#ERROR : Can't open dsspfile "2ch6B.bssp"
#ERROR : Can't open dsspfile "3djcB.bssp"
#ERROR : Can't open dsspfile "3djcD.bssp"
#ERROR : Can't open dsspfile "2ch5A.bssp"
#ERROR : Can't open dsspfile "2ch6A.bssp"
#ERROR : Can't open dsspfile "2ch5C.bssp"
#ERROR : Can't open dsspfile "2b0lA.bssp"
#ERROR : Can't open dsspfile "2dbbA.bssp"
#ERROR : Can't open dsspfile "3cuoA.bssp"
#ERROR : Can't open dsspfile "2d1hA.bssp"
#ERROR : Can't open dsspfile "2d1hB.bssp"
#ERROR : Can't open dsspfile "2e2oA.bssp"
#ERROR : Can't open dsspfile "3cuoD.bssp"
#ERROR : Can't open dsspfile "2cg4A.bssp"
#ERROR : Can't open dsspfile "1bibA.bssp"
#ERROR : Can't open dsspfile "1biaA.bssp"
#ERROR : Can't open dsspfile "3cuoC.bssp"
#ERROR : Can't open dsspfile "2acjD.bssp"
#ERROR : Can't open dsspfile "3bf3C.bssp"
#ERROR : Can't open dsspfile "2a61A.bssp"
#ERROR : Can't open dsspfile "3bpxB.bssp"
#ERROR : Can't open dsspfile "3bpxA.bssp"
#ERROR : Can't open dsspfile "2e7wA.bssp"
#ERROR : Can't open dsspfile "2efqA.bssp"
#ERROR : Can't open dsspfile "2e1cA.bssp"
#ERROR : Can't open dsspfile "2dlbA.bssp"
#ERROR : Can't open dsspfile "3bddA.bssp"
#ERROR : Can't open dsspfile "2cfxA.bssp"
#ERROR : Can't open dsspfile "2eadB.bssp"
#ERROR : Can't open dsspfile "2efoA.bssp"
#ERROR : Can't open dsspfile "3e6mF.bssp"
#ERROR : Can't open dsspfile "2acjC.bssp"
#ERROR : Can't open dsspfile "3bpvA.bssp"
#ERROR : Can't open dsspfile "3e6mG.bssp"
#ERROR : Can't open dsspfile "2dbbB.bssp"
#ERROR : Can't open dsspfile "3deuB.bssp"
#ERROR : Can't open dsspfile "2e1nA.bssp"
#ERROR : Can't open dsspfile "3bj6A.bssp"
#ERROR : Can't open dsspfile "2d45B.bssp"
#ERROR : Can't open dsspfile "3bddB.bssp"
#ERROR : Can't open dsspfile "3broA.bssp"
#ERROR : Can't open dsspfile "3edpB.bssp"
#ERROR : Can't open dsspfile "2cyyA.bssp"
#ERROR : Can't open dsspfile "2ek5A.bssp"
#ERROR : Can't open dsspfile "2di3B.bssp"
#ERROR : Can't open dsspfile "2efnA.bssp"
#ERROR : Can't open dsspfile "2dqlA.bssp"
#ERROR : Can't open dsspfile "2ek5C.bssp"
#ERROR : Can't open dsspfile "2du9A.bssp"
#ERROR : Can't open dsspfile "2e1nB.bssp"
#ERROR : Can't open dsspfile "2di3A.bssp"
#ERROR : Can't open dsspfile "3bddD.bssp"
#ERROR : Can't open dsspfile "3by6A.bssp"
#ERROR : Can't open dsspfile "2bv6A.bssp"
#ERROR : Can't open dsspfile "3broC.bssp"
#ERROR : Can't open dsspfile "3boqA.bssp"

## Summary of PDB Search
:381
    8e-36  17%  3bp8A  [x.x.x] PUTATIVE NAGC-LIKE TRANSCRIPTIONAL REGULATOR
    1e-29  10%  1bg3A  [c.55.1 - c.55.1 - c.55.1 - c.55.1] HEXOKINASE
    7e-28  15%  3bp8B  [x.x.x] PUTATIVE NAGC-LIKE TRANSCRIPTIONAL REGULATOR
    9e-27  11%  1dgkN  [c.55.1 - c.55.1 - c.55.1 - c.55.1] HEXOKINASE TYPE I
    8e-25   9%  1czaN  [c.55.1 - c.55.1 - c.55.1 - c.55.1] HEXOKINASE TYPE I
    7e-24  22%  2ap1A  [x.x.x] PUTATIVE REGULATOR PROTEIN
    2e-23   7%  1bg3B  [c.55.1 - c.55.1 - c.55.1 - c.55.1] HEXOKINASE
    1e-22  12%  1bdgA  [x.x.x] HEXOKINASE
    2e-22  18%  2aa4A  [x.x.x] PUTATIVE N-ACETYLMANNOSAMINE KINASE
    1e-21  11%  3b8aX  [x.x.x] HEXOKINASE-1
    8e-18  11%  2ch6C  [x.x.x] NAGK PROTEIN
    5e-17  13%  2ch6B  [x.x.x] NAGK PROTEIN
    7e-16  14%  3djcB  [x.x.x] TYPE III PANTOTHENATE KINASE
    3e-15  13%  3djcD  [x.x.x] TYPE III PANTOTHENATE KINASE
    8e-13  10%  2ch5A  [x.x.x] NAGK PROTEIN
    4e-11  13%  2ch6A  [x.x.x] NAGK PROTEIN
    7e-10  14%  2ch5C  [x.x.x] NAGK PROTEIN
    2e-08  17%  2b0lA  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    2e-08  12%  2dbbA  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
    4e-08  28%  3cuoA  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    2e-07  19%  2d1hA  [x.x.x] 109AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    2e-07  19%  2d1hB  [x.x.x] 109AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    2e-07  12%  2e2oA  [x.x.x] HEXOKINASE
    4e-07  28%  3cuoD  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    4e-07  16%  2cg4A  [x.x.x] REGULATORY PROTEIN ASNC
    4e-07  22%  1bibA  [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]
    6e-07  21%  1biaA  [x.x.x] BIRA BIFUNCTIONAL PROTEIN[MASQUE : MEMB(X) 45 /
    1e-06  28%  3cuoC  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    2e-06  19%  2acjD  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    3e-06  11%  3bf3C  [x.x.x] TYPE III PANTOTHENATE KINASE
    3e-06  18%  2a61A  [x.x.x] TRANSCRIPTIONAL REGULATOR TM0710
    3e-06  20%  3bpxB  [x.x.x] TRANSCRIPTIONAL REGULATOR
    5e-06  16%  3bpxA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    6e-06  16%  2e7wA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    8e-06  17%  2efqA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    1e-05  22%  2e1cA  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
    2e-05  14%  2dlbA  [x.x.x] YOPT
    3e-05  18%  3bddA  [x.x.x] REGULATORY PROTEIN MARR
    3e-05  13%  2cfxA  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR LRPC
    3e-05   9%  2eadB  [x.x.x] ALPHA-FUCOSIDASE
    4e-05  15%  2efoA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    4e-05  27%  3e6mF  [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR
    5e-05  24%  2acjC  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    8e-05  20%  3bpvA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    8e-05  29%  3e6mG  [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR
    8e-05  10%  2dbbB  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
    1e-04  18%  3deuB  [x.x.x] TRANSCRIPTIONAL REGULATOR SLYA
    1e-04  17%  2e1nA  [x.x.x] PEX
    1e-04  19%  3bj6A  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
    2e-04  11%  2d45B  [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
    2e-04  20%  3bddB  [x.x.x] REGULATORY PROTEIN MARR
    2e-04   9%  3broA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    2e-04  20%  3edpB  [x.x.x] LIN2111 PROTEIN
    2e-04  17%  2cyyA  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
    2e-04  16%  2ek5A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    3e-04  10%  2di3B  [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
    3e-04  20%  2efnA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    4e-04  14%  2dqlA  [x.x.x] PEX PROTEIN
    4e-04  14%  2ek5C  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    5e-04  15%  2du9A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    5e-04  17%  2e1nB  [x.x.x] PEX
    7e-04  10%  2di3A  [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
    7e-04  17%  3bddD  [x.x.x] REGULATORY PROTEIN MARR
    8e-04  16%  3by6A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    8e-04  13%  2bv6A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR MGRA
    9e-04   9%  3broC  [x.x.x] TRANSCRIPTIONAL REGULATOR
    9e-04  10%  3boqA  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
:381

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MHKKLNPKSMKRENKKMVLRYLIESGPHSRVEIARKTGLAQSAIWRIIEELVNEGLVEEKGTATGRRRKA
3bp8A           ---------IKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEVGLVVETEA
1bg3A           ---------IAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDEILIDILTRFKKNGLSRDYNSVKMLPTFV
3bp8B           ---------IKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELVGLVVETEAW
1dgkN           -----------------------DDQVKKIDKYLYAMRLSDETLIDIMTRFRKEGLSRDFNTATVKMLPT
1czaN           -----------------------DDQVKKIDKYLYAMRLSDETLIDIMTRFRKEGLSRDFNPTAMLPTFV
2ap1A           ----------------------------------------------------------------------
1bg3B           ---------IAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDEILIDILTRFKKNGLSRDYNPTASVKMLT
1bdgA           -------------SDQQLFE-KVV-------EILKPFDLSVVDYEEICDRMGESGLQKSTNKSSIKMFPS
2aa4A           ----------------------------------------------------------------------
3b8aX           ------------------MADVPKELMDEIHQLEDMFTVDSETLRKVVKHFIDELLTKKGGNIPMIPGWV
2ch6C           ----------------------------------------------------------------------
2ch6B           ----------------------------------------------------------------------
3djcB           ----------------------------------------------------------------------
3djcD           ----------------------------------------------------------------------
2ch5A           ----------------------------------------------------------------------
2ch6A           ----------------------------------------------------------------------
2ch5C           ----------------------------------------------------------------------
2b0lA           MSKAVVQMAISSAIEHIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGTYIK
2dbbA           -----------------LVKILSENSRLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPDIDKLG
3cuoA           -------KAMSHPKRLLILCMLSGSPGTSAGELTRITGLSASATSQHLARMRDEGLIDSQ-----RDAQR
2d1hA           ------------DTDVAVLLKVEIEKPITSEELADIFKLSKTTVENSLKKLIELGLVVRTKTPKYYYSIS
2d1hB           ------------DTDVAVLLKVEIEKPITSEELADIFKLSKTTVENSLKKLIELGLVVRTKTPKYYYSIS
2e2oA           ----------------------------------------------------------------------
3cuoD           -------KAMSHPKRLLILCMLSGSPGTSAGELTRITGLSASATSQHLARMRDEGLIDSQ-----RDAQR
2cg4A           -----------------ILEALMGNARTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDVSPKQLG
1bibA           ---KDNTVPLK------LIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYSLP-
1biaA           ---------MKDTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYS---
3cuoC           -------KAMSHPKRLLILCMLSGSPGTSAGELTRITGLSASATSQHLARMRDEGLIDSQRDAQRIL---
2acjD           ------------QRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIA
3bf3C           ----------------------------------------------------------------------
2a61A           ------------PAQFDILQKIYFEGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYF
3bpxB           -----------------CLLRIHREPGIKQDELATFFHVDKGTIARTLRRLEESGFIEREQDPENRRRYI
3bpxA           -----------------CLLRIHREPGIKQDELATFFHVDKGTIARTLRRLEESGFIEREQDPENRRRYI
2e7wA           -----------------ILKILQYNAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIK--GYYAYINPAS
2efqA           -----------------ILKILQYNAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAYINPASLN
2e1cA           ---------------KKIIKILQNDGKAPLREISKITGLAESTIHERIRKLRESGVIKKFTAIIDPEALG
2dlbA           -----------------YLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLADGSVENFKL
3bddA           -----------------ILQTLLKDAPLHQLALQERLQIDRAAVTRHLKLLEESGYIIRKRNPDNQREVL
2cfxA           -----------------IIEELKKDSRLSMRELGRKIKLSPPSVTERVRQL------ESFGIIKQYTLEV
2eadB           -----------------------------------------SHLLGLFPGDLITIDNSEYMDAAKTSLRY
2efoA           -----------------ILKILQYNAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAYINPAS--
3e6mF           -----------------LLSSLSAYGELTV-GQLATLGVEQSTTSRTVDQLVDEGLAARSISQRKRT---
2acjC           ----------------KFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQEAGTPPLWK---
3bpvA           -----------------CLLRIHREPGIKQDELATFFHVDKGTIARTLRRLEESGFIEREQDPENRRRYI
3e6mG           -----------------LLSSLSAYGELT-VGQLATLGVEQSTTSRTVDQLVDEGLAARSISQRKRT---
2dbbB           ------------RVDMQLVKILSENSRLTYRELADILNTTRQRIARRIDKL------KKLGIIRKFTIIP
3deuB           -----------------TLHNIHQLPPDQSQQLAKAIGIEQPSLVRTLDQLEDKGLISRRIKLTEKAEPL
2e1nA           ------------LAVCYVLAVLRHEDSYHLETHWPNYRLSDTVLYTALKFLEDEQIIWKKVEGRGRPRRM
3bj6A           -----------------ILEGLSLTPGAT-APQLGAALQKRQYISRILQEVQRAGLIERRTNPEHARSHR
2d45B           -----------------VNIIWKKASANNIIEEIQQKDWSPKTIRTLITRLYKKGFID----RKKDNKIF
3bddB           -----------------ILQTLLKDAPLHQLALQERLQIDRAAVTRHLKLLEESGYIIRKETEQARE---
3broA           -----------------IDYLSRNKNKEVLQDLESEFSIKSSTATVLLQRE-IKKLLYRKVSGKDSRQKC
3edpB           --------------KDSINRDEYKTGPNET-ALQEIYSSSRTTIRRAVDLLVEEGLVV----RKNGVGLY
2cyyA           ---------------KKIIKILQNDGKAPLREISKITGLAESTIHERIRKLRESGVIKKFTAIIDPEALF
2ek5A           ------------------GTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGFVSAQA
2di3B           ------------------VTEELRSGIGDHLALSETLGVSRSSLREALRVLEALGTISTA-----TGSGP
2efnA           -----------------ILKILQYNAKYSLDEIAREIRIPKATLSYRIKKLEKDGVIKGYYAYINPAS--
2dqlA           ------------VAICYILYVLLQGESYQLETEHPTYRLSDTVLYSAIKFLEDNRAITYWKKLEGRGRPR
2ek5C           ------------------GTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGFVSAQA
2du9A           ------------------GTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGFVSAQA
2e1nB           ------------LAVCYVLAVLRHEDSYHLETHWPNYRLSDTVLYTALKFLEDEQIIWKKVEGRGRPRRM
2di3A           ------------------VTEELRSGIGDHLALSETLGVSRSSLREALRVLEALGTISTA-----TGSGP
3bddD           -----------------ILQTLLKDAPLHQLALQERLQIDRAAVTRHLKLLEESGYII------------
3by6A           -------QAMAITQKRPVIKNEVATDANDQLETALQEKINPNTVAKAYKELEAQKVIRTI-----PGKGT
2bv6A           -----------------VLTILWDESPVNVKKVVTELALDTGTVSPLL-KREQVDLIKRERSEVDQREVF
3broC           -----------------IDYLSRNKNKEVLQDLESEFSIKSSTATVLLQRE-IKKLLYRKVSGKDSRQKC
3boqA           ----------------DAAQLARN-PDGLSGKLSGALKVTNGNVSGLVNRLIKDGVVKAFSTDAGLT---


                         .         .         *         .         .         .         .:140
query           VTYGPTRSFITSIIYNVEVLETLVAVGFLDGAWRIIERFSTPKDFDEFKQRVTSSYENILKSHVLNKNIS
3bp8A           WHY---------LSLRISRGEIFLALRDLSSKLVVEESQELALKDDSLDRIISHIDQFFIRHQKKLERLT
1bg3A           RSIPDGSEKGDFIALDLGGSSFRILRVQVNVSMESEIYDTPENIVHGSGTQLFDHVADCLGDFMEKKKIK
3bp8B           HYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDSPLLDRIISHIDQFFIRHQKKLERLTSIAITLPG
1dgkN           FVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMEGSGSQLFDHVAECLGDFMEKRKIKDKKL
1czaN           RSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVSGSQLFDHVAECLGDFMEKRKIKDKKL
2ap1A           -----------AMYYGFDIGGTKIALGVFDSTRRLQWEKRVPTPHTSYSAFLDAVCELVEEADQRFGVKG
1bg3B           FVRSIPDGSEKGDFIALDLGGSSFRILRVQVNVSMESEIYDTGSGTQLFDHVADCLGDFMEKK---DKKL
1bdgA           YVTKTPNGTETGNFLALDLGGTNYRVLSVTLEGGKSPRIQERGSGTELFKYIAETLADFLENNGMKDKDL
2aa4A           ---------------------TKLAAALIGADGQIRDRRELPTPASQTPEALRDALSALVSPLQ--AHAQ
3b8aX           MEFPTGKESGNYLAIDLGGTNLRVVLVKLSGNHTFDTTQSKYKHQEELWSFIADSLKDFMEQELLNTDTL
2ch6C           ---------------------SEVLLVSEDGKILAEADGLSTNGTDKCVERINEMVNRAKRKAGV-----
2ch6B           ---------------------------------------------------------NHIGTD---KCVE
3djcB           -----------SLILCIDVGNSHIYGGVFDGDEIKLRHTSKVSTSDELGIFLKSVLRENNCSPETIRKIA
3djcD           -----------SLILCIDVGNSHIYGGVFDGDEIKLRFTSKVSTSDELGIFLKSVLRENNCSPETIRKIA
2ch5A           -----------------------VLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVN-----RAKR
2ch6A           ----------------------------------------------------------------------
2ch5C           ----------------------------------------------------------------------
2b0lA           V---------------------------------------------------------------------
2dbbA           YMYAIVLIKSKVPSDADKVIS------EISDIEYVKSVEKGVGRYNIVRLLLPKDIKD------AENLIS
3cuoA           ILYSIK----------------------------------------------------------------
2d1hA           S---------------------------------------------------------------------
2d1hB           S---------------------------------------------------------------------
2e2oA           ----------------------------------------------------------------------
3cuoD           ILYSIK----------------------------------------------------------------
2cg4A           YDVGCFIGIILKSAKDYPSALAKLESLD-----EVTEAYYTTGHYSIFIKVMCRSIDAL--QHVLINKIQ
1bibA           ----------------------------------------------------------------------
1biaA           ----------------------------------------------------------------------
3cuoC           ----------------------------------------------------------------------
2acjD           V---------------------------------------------------------------------
3bf3C           ---------------------------------------------------------PLLGDAMREIKGI
2a61A           LV--------------------------------------------------------------------
3bpxB           LE--------------------------------------------------------------------
3bpxA           LEVTRGEEIIPLILKVEERWEDLLFRDFTEDERKLFRKMCRREEAVRMRGE-------------------
2e7wA           LNLDYIVITSVKAKYGKNYHVELGNK--LAQIPGVWGVYFVLGDNDFIVMARYKTREEF--MEKFLERVM
2efqA           LDYIVITSVKAKYGKNYHVELGNKLAQI----PGVWGVYFVLGDNDFIVMARYKTREE------FMEKFL
2e1cA           YSMLAFILVKVKAGKYSEVASNLAKY------PEIVEVYETTGDYDMVVKIRTKNSEEL--NNFLDL---
2dlbA           SDEYE-----------------------------------------------------------------
3bddA           VW--------------------------------------------------------------------
2cfxA           -----------DQKKLGLPVSCIVEATVKNADYERFKSYIQTLPNIEFCYRIAGAACYMLKINAESEAVE
2eadB           RCFKGNVLQSNTGWAIGQRINSWARTGDGNTTYQLVELQMYANLFDYHAPFQIDGNFGNTSGVDEMLLQS
2efoA           --LNLDYIVITSVKAKYGKNAHVELGNKLAQIPGVWGVYFVLGDNDFIVMARYKTREEF--MEKFLERVM
3e6mF           ----------------------------------------------------------------------
2acjC           ----------------------------------------------------------------------
3bpvA           LE--------------------------------------------------------------------
3e6mG           ----------------------------------------------------------------------
2dbbB           DIDKLGYMYAIVLIKSKVPSDADKVISEISDIEYVKSVEKGVGRYNIVRLLLPKDIKD------AENLIS
3deuB           IA--------------------------------------------------------------------
2e1nA           YQ--------------------------------------------------------------------
3bj6A           YWLTP-----------------------------------------------------------------
2d45B           QYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDSQDEIEELRNI-------------------
3bddB           ----------------------------------------------------------------------
3broA           LK--------------------------------------------------------------------
3edpB           VQPKLTAQNILETGVLKKDIKDFYI---------------------------------------------
2cyyA           ILVKVKAGKYSEVASNLAKYPEIVEVYETTGDYDVVKRTKNSEELNNFLDLIGSIPGVEGTHTIVLKTHK
2ek5A           PALIR-----------------------------------------------------------------
2di3B           RSGTIITAAPGQALSLSVTLQ-------------------------------------------------
2efnA           ----------------------------------------------------------------------
2dqlA           RMYQVS----------------------------------------------------------------
2ek5C           PALIRERRDAAFAATYVAPIDESIHLGFTRARIHALLD--------------------------------
2du9A           PALIRERRDAAFAATYVAPLIDESIHLGFTRARIH-----------------------------------
2e1nB           YQ--------------------------------------------------------------------
2di3A           RSGTIITAAPGQALSLSVTLQ-------------------------------------------------
3bddD           ----------------------------------------------------------------------
3by6A           FITGNTASVKNSNQNRLADLSQVIA---------------------------------------------
2bv6A           IH--------------------------------------------------------------------
3broC           LK--------------------------------------------------------------------
3boqA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KVVFSLPGIVNTESKFLIHAPNLGWRNIDFRREFGNLDLEVLVENDSNLSLLAEEFFSQDVKESDVAFFL
3bp8A           SIAITLPGIIDTENGIVHRMPFYDVKEMPLGEALEQHGVPVYIQHDISAWTMAEALFGAS-RGARDVIQV
1bg3A           KLPVGFTFSFPCRQSKIDEAVLIGVEGADVVKLLNKIKKRGDYDANIVAVVNDTTMMTCGYDDQQCEVGL
3bp8B           IIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVY------IQHDISAWTMAEALFGASRGARDVIQVV
1dgkN           PVGFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNANIVAVVNDTVGTMMTCGY--DDQHCEVGL
1czaN           PVGFTFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNANIVAVVNDTV-GTMMTCGY-DDQHCEVGL
2ap1A           SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLARLDRDVRLDNDANCFALSEAWD-DEFTQYPLVMGL
1bg3B           PVGFTFSFPCRQSKIDEAVLITWRFKASGVEADVVKLLNKAIIVAVVNDT-VGTMMTCGYDDQQCE-VGL
1bdgA           GFTFSFPCVQKGLTHATLVRWTKGFSADGVEGHNVAELLQLNVKCVAVVNDTVGTLASCALEDPKCAVGL
2aa4A           RVAIASTGIIRDGSLLALPHNLGGLLHFPLVKTLEQTNLPTIAINDAQAAAWAE-FQALDGDITDMVFIT
3b8aX           PLGFTFSYPASQNKINLQRWTKGNVEGHDVVPLLNEISKRELPIEIVALINDTVTLIASYYTDPETKMGV
2ch6C           ----DPLVPLRSLGLSLSGGEDAGRILIEELRDRPYLSESYLITTDAAGSIATATPDVVLISGTGSNC-R
2ch6B           RINEMGVDPLVPLRSLGLSLSGGEDAGRILRDRFPYLSESYLITTDAAGSIATATPDGGV----------
3djcB           ICSVVPQVDYSLRSACVKYFSIPFLLQAGVKTGLNIYRNPVEVGADRIANAIAATHSF----PNQNIIVI
3djcD           ICSVVPQVDYSLRSACVKYFSIDFLLQAGVKTGLIKYRNPVEVGADRIANAIAATHSF----PNQNIIVI
2ch5A           KAGVDPLVPLRSLGLSLSDQEDAGRILIEELRDRFPYLSSYLITTDAAGSIATATPDGGVLISGTGSNCR
2ch6A           --------------------EDAGRILIEELRDRPYLSESYLITTDAAGSIATATPDGGVLISGTGSNCR
2ch5C           -------------------QEDAGRILIEELRDRPYLSESYLITTDAAGSIATATPDGGVVLISGTGCRL
2b0lA           ----------------------------------------------------------------------
2dbbA           EFLQRIKNAENVEVILIS----------------------------------------------------
3cuoA           ----------------------------------------------------------------------
2d1hA           ----------------------------------------------------------------------
2d1hB           ----------------------------------------------------------------------
2e2oA           ------------------------FDWENFTPLASLIAPKVIIQHDGVIALFAETLGEPGVVVIATGSVV
3cuoD           ----------------------------------------------------------------------
2cg4A           ----TIDEIQSTETLIVL----------------------------------------------------
1bibA           ----------------------------------------------------------------------
1biaA           ----------------------------------------------------------------------
3cuoC           ----------------------------------------------------------------------
2acjD           ----------------------------------------------------------------------
3bf3C           GVASVVPTQNTVIERFSQKYFHIPIWVKAKNGCVKWVKNPSEVGADRVANVVAFVKEYGKNG-----III
2a61A           ----------------------------------------------------------------------
3bpxB           ----------------------------------------------------------------------
3bpxA           ----------------------------------------------------------------------
2e7wA           ----SIPEVERTSTQVV-----------------------------------------------------
2efqA           ERVMSIPEVERTSAQVVV----------------------------------------------------
2e1cA           --IGSIPGVEGTHTMIVL----------------------------------------------------
2dlbA           ----------------------------------------------------------------------
3bddA           ----------------------------------------------------------------------
2cfxA           DFINKTSPYAQTVTHVIF----------------------------------------------------
2eadB           NSTFTDTAGKKYVNY-TNILPALAWAGGSVSGLVARGNFTVGTTWKNG----------------------
2efoA           S----IPEVERTSTQVV-----------------------------------------------------
3e6mF           ----------------------------------------------------------------------
2acjC           ----------------------------------------------------------------------
3bpvA           ----------------------------------------------------------------------
3e6mG           ----------------------------------------------------------------------
2dbbB           EFLQRIKNAENVEVILIS----------------------------------------------------
3deuB           ----------------------------------------------------------------------
2e1nA           ----------------------------------------------------------------------
3bj6A           ----------------------------------------------------------------------
2d45B           ----------------------------------------------------------------------
3bddB           ----------------------------------------------------------------------
3broA           ----------------------------------------------------------------------
3edpB           ----------------------------------------------------------------------
2cyyA           E---------------------------------------------------------------------
2ek5A           ----------------------------------------------------------------------
2di3B           ----------------------------------------------------------------------
2efnA           ----------------------------------------------------------------------
2dqlA           ----------------------------------------------------------------------
2ek5C           ----------------------------------------------------------------------
2du9A           ----------------------------------------------------------------------
2e1nB           ----------------------------------------------------------------------
2di3A           ----------------------------------------------------------------------
3bddD           ----------------------------------------------------------------------
3by6A           ----------------------------------------------------------------------
2bv6A           ----------------------------------------------------------------------
3broC           ----------------------------------------------------------------------
3boqA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YFGEGIGGAISVNGKIVRGENFAAGEIGHVVLDVKNGKEVEEFLSISKLVERMEKFVELQGESLDEKFRY
3bp8A           VIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCLETIASVDSILELAQLRLNQSMHGQPLTVDS
1bg3A           IIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMVS
3bp8B           ID-HNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCLETIASVDSILELAQLRLNQSMSSMLHGQDS
1dgkN           IIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRAIDAYSLNPGKQLFE----
1czaN           IIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRAIDAYSLNPGKQLFEKMVS
2ap1A           ILGTGVGGGLVLNGKPITGQSYITGEFGHMRLPVDALTLIENYLSGRGFAWL---YQHYYDQSLQAPE--
1bg3B           IIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRT-------------------EFDR
1bdgA           IVGTGTNVAYIEDSSKVELMDGVKEPEVVINTEWGAFGEKGELCWRTQFDKSMDIDSLHPGKQLYEKMHI
2aa4A           V-STGVGGGVVSGCKLLTGPGGLAGHIGHTLAD---PHGPVCGCGRTGCVEAIASAAAAQGELAGADAKT
3b8aX           IFGTGVNGAFYDVVSDIEKLEGKLADDIPSNSPMAINCEYGSFLPRTKYDVAVDEQSPRPGQQAFEKMT-
2ch6C           LINPDGSESGCGGWGHMMGDEGSAYWIAHQADIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFRK
2ch6B           --VLISGTGSNCRLINPDGSESGCGGWGHMMDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFRK
3djcB           DFGTATTFCAISHKKAYLGGAILPGLRLSADALSKNTAKLPSVEIIKTTIESIQSGVYYGVLGACKELQR
3djcD           DFGTATTFCAISHKKAYLGGAILPGLRLSA----------DALSKNTASVEI-----------IKTESVV
2ch5A           LINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIKQAMFHYFQVPDRLGILTHLYRDFDAGFCRK
2ch6A           LINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIDIGYVKQAMFHYFQVPDRTHLYRDFDKCRFAGFCRK
2ch5C           INPDGSESGCGGWGHM-MGDEGSAYWIAHQAVKIVIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAG
2b0lA           ----------------------------------------------------------------------
2dbbA           ----------------------------------------------------------------------
3cuoA           ----------------------------------------------------------------------
2d1hA           ----------------------------------------------------------------------
2d1hB           ----------------------------------------------------------------------
2e2oA           EGYNGKEFLRVGGRGWLLSDDGSAYWVGRKALRKILYNKVLKTINVKDLDELVMWYTSSCQIDLVASIKA
3cuoD           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------
1bibA           ----------------------------------------------------------------------
1biaA           ----------------------------------------------------------------------
3cuoC           ----------------------------------------------------------------------
2acjD           ----------------------------------------------------------------------
3bf3C           DMGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTA--------------------KLPLVEVKPADFV
2a61A           ----------------------------------------------------------------------
3bpxB           ----------------------------------------------------------------------
3bpxA           ----------------------------------------------------------------------
2e7wA           ----------------------------------------------------------------------
2efqA           ----------------------------------------------------------------------
2e1cA           ----------------------------------------------------------------------
2dlbA           ----------------------------------------------------------------------
3bddA           ----------------------------------------------------------------------
2cfxA           ----------------------------------------------------------------------
2eadB           ----------------------------------------------------------------------
2efoA           ----------------------------------------------------------------------
3e6mF           ----------------------------------------------------------------------
2acjC           ----------------------------------------------------------------------
3bpvA           ----------------------------------------------------------------------
3e6mG           ----------------------------------------------------------------------
2dbbB           ----------------------------------------------------------------------
3deuB           ----------------------------------------------------------------------
2e1nA           ----------------------------------------------------------------------
3bj6A           ----------------------------------------------------------------------
2d45B           ----------------------------------------------------------------------
3bddB           ----------------------------------------------------------------------
3broA           ----------------------------------------------------------------------
3edpB           ----------------------------------------------------------------------
2cyyA           ----------------------------------------------------------------------
2ek5A           ----------------------------------------------------------------------
2di3B           ----------------------------------------------------------------------
2efnA           ----------------------------------------------------------------------
2dqlA           ----------------------------------------------------------------------
2ek5C           ----------------------------------------------------------------------
2du9A           ----------------------------------------------------------------------
2e1nB           ----------------------------------------------------------------------
2di3A           ----------------------------------------------------------------------
3bddD           ----------------------------------------------------------------------
3by6A           ----------------------------------------------------------------------
2bv6A           ----------------------------------------------------------------------
3broC           ----------------------------------------------------------------------
3boqA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IKRLWFSGEKNVKETMEEFLQHVAVVLKNIIYFLNPGVIVLGGVVNDLWDTFGSFIKRELEKITDREIAN
3bp8A           LCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIRQQALPASQH
1bg3A           GMYM----GELVRLILVKMAKEGLLFGRITPELLTRGKFNTSDVSAIEKDKEGIQNAKEI--LTRLGVEP
3bp8B           LCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIRQQALPAYSH
1dgkN           ---------------KMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVEILTRLGVEP
1czaN           GMYL-------------------GELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEGLHNAK
2ap1A           IIALWEQGDEQAHAHVERYLDLLAVCLGNILTIVDPDLLVIGGGLSNFTA-ITTQLAERLPRHLLPVARA
1bg3B           ELDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTS------------
1bdgA           IVYLVEQKILFRGDLPERLKVRNSLLTRYLTDVERDPAHLLYNTHYMLTDDLHVPVVEPIDNRIVRYACE
2aa4A           IFTRAGQGDEQAQQLIHRSARTLARLIADIKATTDCQCVVVGGSVGLAEG-YLALVETYLAQEPAA----
3b8aX           ----------------------------------------------------------------------
2ch6C           IAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGVWKSWELLKEGFLLALTQGREIQAQN
2ch6B           IAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPLPILCVGSVWKSWELLKEGFLLALTQGREIQAQN
3djcB           IHHEAFNGDQILILATGGFASLFDKQ--GLYDHLVPDLVLQGIRL-------------------------
3djcD           GRSTIESIQSGVYYGVLGACKELIQRIHHEAFNGDQILILATGGFASLFDKQGLYD-HLVPDLVLQGIRL
2ch5A           IAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSWELLKEGFLLALTQGRAQ
2ch6A           IAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPLPILCVGSVWKSWELLKEGFLLALTQGREIQAQN
2ch5C           IAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQ
2b0lA           ----------------------------------------------------------------------
2dbbA           ----------------------------------------------------------------------
3cuoA           ----------------------------------------------------------------------
2d1hA           ----------------------------------------------------------------------
2d1hB           ----------------------------------------------------------------------
2e2oA           VDEAANEGDTVAMDILKQGAELLASQAVYLARKIGTNKVYLKGGMNIYHKFFTLYLEKEGIISDLGKRSP
3cuoD           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------
1bibA           ----------------------------------------------------------------------
1biaA           ----------------------------------------------------------------------
3cuoC           ----------------------------------------------------------------------
2acjD           ----------------------------------------------------------------------
3bf3C           VGKD--TEENIRLGVVNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKI----------------------
2a61A           ----------------------------------------------------------------------
3bpxB           ----------------------------------------------------------------------
3bpxA           ----------------------------------------------------------------------
2e7wA           ----------------------------------------------------------------------
2efqA           ----------------------------------------------------------------------
2e1cA           ----------------------------------------------------------------------
2dlbA           ----------------------------------------------------------------------
3bddA           ----------------------------------------------------------------------
2cfxA           ----------------------------------------------------------------------
2eadB           ----------------------------------------------------------------------
2efoA           ----------------------------------------------------------------------
3e6mF           ----------------------------------------------------------------------
2acjC           ----------------------------------------------------------------------
3bpvA           ----------------------------------------------------------------------
3e6mG           ----------------------------------------------------------------------
2dbbB           ----------------------------------------------------------------------
3deuB           ----------------------------------------------------------------------
2e1nA           ----------------------------------------------------------------------
3bj6A           ----------------------------------------------------------------------
2d45B           ----------------------------------------------------------------------
3bddB           ----------------------------------------------------------------------
3broA           ----------------------------------------------------------------------
3edpB           ----------------------------------------------------------------------
2cyyA           ----------------------------------------------------------------------
2ek5A           ----------------------------------------------------------------------
2di3B           ----------------------------------------------------------------------
2efnA           ----------------------------------------------------------------------
2dqlA           ----------------------------------------------------------------------
2ek5C           ----------------------------------------------------------------------
2du9A           ----------------------------------------------------------------------
2e1nB           ----------------------------------------------------------------------
2di3A           ----------------------------------------------------------------------
3bddD           ----------------------------------------------------------------------
3by6A           ----------------------------------------------------------------------
2bv6A           ----------------------------------------------------------------------
3broC           ----------------------------------------------------------------------
3boqA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VLIRDTIFKEISPSLVGGNVLAIEEFLRQIT
3bp8A           ISVESTQFSN-QGTMAGAALVKDAMY-----
1bg3A           SDVDCVSVQHICANLVAATLGAILNRLR---
3bp8B           ISVESTQFSN-MAGAALVKDAMYNGSLLI--
1dgkN           SDDDCVSVQHVSANLVAATLGAILNRLR---
1czaN           EILTRLGVE----------------------
2ap1A           PRIERARHGDAGG-MRGAAFLHLTD------
1bg3B           -------------------------------
1bdgA           MVVKR------AAYLAGAGIACILRRIN---
2aa4A           -------------------------------
3b8aX           -------------------------------
2ch6C           FFSSFTLMKLRHSSALGGASLGARHIGHLL-
2ch6B           FFSSFTLMKLRHSSALGGASLGARHMDYS--
3djcB           -------------------------------
3djcD           AAMMNT-------------------------
2ch5A           NFFSSFTLMKRHSSALGGASLGARHIGHLLP
2ch6A           FFSSFTLMKLRHSSALGGASLGARHIGHLLP
2ch5C           GREFFSSFTLMHSSALGGASLGARHIGH---
2b0lA           -------------------------------
2dbbA           -------------------------------
3cuoA           -------------------------------
2d1hA           -------------------------------
2d1hB           -------------------------------
2e2oA           EI-----------------------------
3cuoD           -------------------------------
2cg4A           -------------------------------
1bibA           -------------------------------
1biaA           -------------------------------
3cuoC           -------------------------------
2acjD           -------------------------------
3bf3C           -------------------------------
2a61A           -------------------------------
3bpxB           -------------------------------
3bpxA           -------------------------------
2e7wA           -------------------------------
2efqA           -------------------------------
2e1cA           -------------------------------
2dlbA           -------------------------------
3bddA           -------------------------------
2cfxA           -------------------------------
2eadB           -------------------------------
2efoA           -------------------------------
3e6mF           -------------------------------
2acjC           -------------------------------
3bpvA           -------------------------------
3e6mG           -------------------------------
2dbbB           -------------------------------
3deuB           -------------------------------
2e1nA           -------------------------------
3bj6A           -------------------------------
2d45B           -------------------------------
3bddB           -------------------------------
3broA           -------------------------------
3edpB           -------------------------------
2cyyA           -------------------------------
2ek5A           -------------------------------
2di3B           -------------------------------
2efnA           -------------------------------
2dqlA           -------------------------------
2ek5C           -------------------------------
2du9A           -------------------------------
2e1nB           -------------------------------
2di3A           -------------------------------
3bddD           -------------------------------
3by6A           -------------------------------
2bv6A           -------------------------------
3broC           -------------------------------
3boqA           -------------------------------