[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tmar0:AAD35255.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d2cA.bssp"
#ERROR : Can't open dsspfile "3ds8A.bssp"
#ERROR : Can't open dsspfile "1cuaA.bssp"
#ERROR : Can't open dsspfile "1cufA.bssp"
#ERROR : Can't open dsspfile "3ef3A.bssp"
#ERROR : Can't open dsspfile "1cuhA.bssp"
#ERROR : Can't open dsspfile "3d2bA.bssp"
#ERROR : Can't open dsspfile "1cuyA.bssp"
#ERROR : Can't open dsspfile "1cexA.bssp"
#ERROR : Can't open dsspfile "1cuxA.bssp"
#ERROR : Can't open dsspfile "1cujA.bssp"
#ERROR : Can't open dsspfile "3bdvA.bssp"
#ERROR : Can't open dsspfile "3d2aA.bssp"
#ERROR : Can't open dsspfile "3dd5C.bssp"
#ERROR : Can't open dsspfile "3bdvB.bssp"
#ERROR : Can't open dsspfile "3deaB.bssp"
#ERROR : Can't open dsspfile "2dstA.bssp"
#ERROR : Can't open dsspfile "1cubA.bssp"
#ERROR : Can't open dsspfile "3cxuA.bssp"
#ERROR : Can't open dsspfile "1cuzA.bssp"
#ERROR : Can't open dsspfile "2cjpA.bssp"
#ERROR : Can't open dsspfile "3deaA.bssp"
#ERROR : Can't open dsspfile "1agyA.bssp"
#ERROR : Can't open dsspfile "2cjpB.bssp"
#ERROR : Can't open dsspfile "3e0xB.bssp"
#ERROR : Can't open dsspfile "3dd5A.bssp"
#ERROR : Can't open dsspfile "1cugA.bssp"
#ERROR : Can't open dsspfile "1cqzB.bssp"
#ERROR : Can't open dsspfile "3e3aB.bssp"
#ERROR : Can't open dsspfile "1cuvA.bssp"
#ERROR : Can't open dsspfile "1cuwA.bssp"
#ERROR : Can't open dsspfile "3cxuB.bssp"
#ERROR : Can't open dsspfile "1cuuA.bssp"
#ERROR : Can't open dsspfile "1c4xA.bssp"
#ERROR : Can't open dsspfile "3dcnA.bssp"
#ERROR : Can't open dsspfile "2cutA.bssp"
#ERROR : Can't open dsspfile "1dwoA.bssp"
#ERROR : Can't open dsspfile "1bn6A.bssp"
#ERROR : Can't open dsspfile "1e89A.bssp"
#ERROR : Can't open dsspfile "3e0xA.bssp"
#ERROR : Can't open dsspfile "3b5eA.bssp"
#ERROR : Can't open dsspfile "1eh5A.bssp"
#ERROR : Can't open dsspfile "2a8lA.bssp"

## Summary of PDB Search
:771
    8e-08  17%  3d2cA  [x.x.x] LIPASE
    2e-07  13%  3ds8A  [x.x.x] LIN2722 PROTEIN
    2e-07   6%  1cuaA  [x.x.x] CUTINASE
    4e-07   7%  1cufA  [x.x.x] CUTINASE
    4e-07   9%  3ef3A  [x.x.x] CUTINASE-1
    5e-07   7%  1cuhA  [x.x.x] CUTINASE
    3e-06  17%  3d2bA  [x.x.x] LIPASE
    3e-06   7%  1cuyA  [x.x.x] CUTINASE
    4e-06   7%  1cexA  [c.69.1 (1xzkA)] CUTINASE
    4e-06   7%  1cuxA  [x.x.x] CUTINASE
    6e-06   7%  1cujA  [x.x.x] CUTINASE
    6e-06  11%  3bdvA  [x.x.x] UNCHARACTERIZED PROTEIN DUF1234
    1e-05  18%  3d2aA  [x.x.x] LIPASE
    1e-05   8%  3dd5C  [x.x.x] CUTINASE
    1e-05  14%  3bdvB  [x.x.x] UNCHARACTERIZED PROTEIN DUF1234
    2e-05   5%  3deaB  [x.x.x] CUTINASE
    2e-05  14%  2dstA  [x.x.x] HYPOTHETICAL PROTEIN TTHA1544
    2e-05   6%  1cubA  [c.69.1 (1cudA)] CUTINASE
    3e-05  17%  3cxuA  [x.x.x] EPOXIDE HYDROLASE
    3e-05   8%  1cuzA  [x.x.x] CUTINASE
    3e-05  17%  2cjpA  [x.x.x] EPOXIDE HYDROLASE
    4e-05   8%  3deaA  [x.x.x] CUTINASE
    5e-05   7%  1agyA  [x.x.x] CUTINASE
    6e-05  17%  2cjpB  [x.x.x] EPOXIDE HYDROLASE
    8e-05  14%  3e0xB  [x.x.x] LIPASE-ESTERASE RELATED PROTEIN
    8e-05   4%  3dd5A  [x.x.x] CUTINASE
    1e-04   6%  1cugA  [x.x.x] CUTINASE
    1e-04  22%  1cqzB  [c.108.1 - c.69.1] EPOXIDE HYDROLASE
    1e-04  24%  3e3aB  [x.x.x] POSSIBLE PEROXIDASE BPOC
    2e-04   7%  1cuvA  [x.x.x] CUTINASE
    2e-04   8%  1cuwA  [c.69.1] CUTINASE
    2e-04  18%  3cxuB  [x.x.x] EPOXIDE HYDROLASE
    2e-04   7%  1cuuA  [x.x.x] CUTINASE
    2e-04  17%  1c4xA  [c.69.1] PROTEIN (2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-
    2e-04   8%  3dcnA  [x.x.x] CUTINASE
    3e-04   7%  2cutA  [x.x.x] CUTINASE
    4e-04  14%  1dwoA  [c.69.1] HYDROXYNITRILE LYASE
    4e-04  15%  1bn6A  [c.69.1] HALOALKANE DEHALOGENASE
    6e-04  14%  1e89A  [c.69.1] HYDROXYNITRILE LYASE
    7e-04  14%  3e0xA  [x.x.x] LIPASE-ESTERASE RELATED PROTEIN
    8e-04  12%  3b5eA  [x.x.x] MLL8374 PROTEIN
    8e-04   9%  1eh5A  [c.69.1] PALMITOYL PROTEIN THIOESTERASE 1
    0.001  16%  2a8lA  [x.x.x] THREONINE ASPARTASE 1
:771

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d2cA           ----------------------------------------------------------------------
3ds8A           ----------------------------------------------------------------------
1cuaA           ----------------------------------------------------------------------
1cufA           ----------------------------------------------------------------------
3ef3A           ----------------------------------------------------------------------
1cuhA           ----------------------------------------------------------------------
3d2bA           ----------------------------------------------------------------------
1cuyA           ----------------------------------------------------------------------
1cexA           ----------------------------------------------------------------------
1cuxA           ----------------------------------------------------------------------
1cujA           ----------------------------------------------------------------------
3bdvA           ----------------------------------------------------------------------
3d2aA           ----------------------------------------------------------------------
3dd5C           ----------------------------------------------------------------------
3bdvB           ----------------------------------------------------------------------
3deaB           ----------------------------------------------------------------------
2dstA           ----------------------------------------------------------------------
1cubA           ----------------------------------------------------------------------
3cxuA           ----------------------------------------------------------------------
1cuzA           ----------------------------------------------------------------------
2cjpA           ----------------------------------------------------------------------
3deaA           ----------------------------------------------------------------------
1agyA           ----------------------------------------------------------------------
2cjpB           ----------------------------------------------------------------------
3e0xB           ----------------------------------------------------------------------
3dd5A           ----------------------------------------------------------------------
1cugA           ----------------------------------------------------------------------
1cqzB           ----------------------------------------------------------------------
3e3aB           ----------------------------------------------------------------------
1cuvA           ----------------------------------------------------------------------
1cuwA           ----------------------------------------------------------------------
3cxuB           ----------------------------------------------------------------------
1cuuA           ----------------------------------------------------------------------
1c4xA           ----------------------------------------------------------------------
3dcnA           ----------------------------------------------------------------------
2cutA           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1bn6A           ----------------------------------------------------------------------
1e89A           ----------------------------------------------------------------------
3e0xA           ----------------------------------------------------------------------
3b5eA           ----------------------------------------------------------------------
1eh5A           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPIRLKYYFDAKYLRGENYNNLTFAYATEDGGYRI
3d2cA           ----------------------------------------------------------------------
3ds8A           ----------------------------------------------------------------------
1cuaA           ----------------------------------------------------------------------
1cufA           ----------------------------------------------------------------------
3ef3A           ----------------------------------------------------------------------
1cuhA           ----------------------------------------------------------------------
3d2bA           ----------------------------------------------------------------------
1cuyA           ----------------------------------------------------------------------
1cexA           ----------------------------------------------------------------------
1cuxA           ----------------------------------------------------------------------
1cujA           ----------------------------------------------------------------------
3bdvA           ----------------------------------------------------------------------
3d2aA           ----------------------------------------------------------------------
3dd5C           ----------------------------------------------------------------------
3bdvB           ----------------------------------------------------------------------
3deaB           ----------------------------------------------------------------------
2dstA           ----------------------------------------------------------------------
1cubA           ----------------------------------------------------------------------
3cxuA           ----------------------------------------------------------------------
1cuzA           ----------------------------------------------------------------------
2cjpA           ----------------------------------------------------------------------
3deaA           ----------------------------------------------------------------------
1agyA           ----------------------------------------------------------------------
2cjpB           ----------------------------------------------------------------------
3e0xB           ----------------------------------------------------------------------
3dd5A           ----------------------------------------------------------------------
1cugA           ----------------------------------------------------------------------
1cqzB           ----------------------------------------------------------------------
3e3aB           ----------------------------------------------------------------------
1cuvA           ----------------------------------------------------------------------
1cuwA           ----------------------------------------------------------------------
3cxuB           ----------------------------------------------------------------------
1cuuA           ----------------------------------------------------------------------
1c4xA           ----------------------------------------------------------------------
3dcnA           ----------------------------------------------------------------------
2cutA           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1bn6A           ----------------------------------------------------------------------
1e89A           ----------------------------------------------------------------------
3e0xA           ----------------------------------------------------------------------
3b5eA           ----------------------------------------------------------------------
1eh5A           ----------------------------------------------------------------------
2a8lA           ------------------------------------PVSVANRLLCEGRIPPCFGEGAYRWAVDHGIPSC


                         +         .         .         .         .         *         .:210
query           IPGSMIGKDERGYYVEAFTYHLSVFGVVLRSAGFQKHGIRLLREAVNSSGPAVLLVPGEDPTFEGVVKDN
3d2cA           --------------------------------------------------NPVVMVHG----IGG---SS
3ds8A           -------------------------------------------------QIPIILIHGNASSLDKADQLY
1cuaA           ------------------------------------DDLINGNSA-SCADVIFIYARG----STETGNLG
1cufA           ------------------------------------DDLIN-GNSASCADVIFIYARGS--TETGNLGTL
3ef3A           ------------------------------------DDLINGNSA-SCADVIFIYARGSTETGNLGTLGP
1cuhA           -----------------------------------RDDLINGNSA-SCADVIFIYARGS--TETGNLGTL
3d2bA           --------------------------------------------------NPVVMVHG----IGG---AS
1cuyA           ------------------------------------DDLINGNSA-SCADVIFIYARG----STETGNLG
1cexA           -----------------------------------RDDLINGNSA-SCADVIFIYARGS--TETGNLGTL
1cuxA           ------------------------------------DDLINGNSA-SCADVIFIYARGS--TETGNLGTL
1cujA           ------------------------------------DDLIN-GNSASCADVIFIYARGS--TETGNLGTL
3bdvA           -------------------------------------TTEIDLRLTEVSQQLTVLVPG------------
3d2aA           --------------------------------------------------NPVVMVHG----IGG---AS
3dd5C           -----------------------------------RNELETGSSS-ACPKVIYIFARAS-TEPGNMGISA
3bdvB           ---------------------------------------EIDLRLTEVSQQLTVLVPG------------
3deaB           ------------------------------------NELET-GSSSACPKVIYIFARAS-TEPGNMGISA
2dstA           ------------------------------------------------KGPPVLLVAEEASRWPEALPEG
1cubA           ------------------------------------DDLIN-GNSASCADVIFIYARGS--TETGNLGTL
3cxuA           ---------------------------------VAVNGLNM-HLAELGEGPTILFIHG----FPE---LW
1cuzA           -----------------------------------RDDLINGNSA-SCADVIFIYARGS--TETGNLGTL
2cjpA           ------------------------------------------------EGPTILFIHG----FPE---LW
3deaA           ----------------------------------------------ACPKVIYIFARAS-TEPGNMGISA
1agyA           ------------------------------------DDLIN-GNSASCRDVIFIYARGS--TETGNLGTL
2cjpB           ------------------------------------------------EGPTILFIHG----FPE---LW
3e0xB           -------------------------------------ALHYVHVGNKKSPNTLLFVHG----SGCNLKIF
3dd5A           ------------------------------------NELETGSSS-ACPKVIYIFARAS-TEPGNMGISA
1cugA           ------------------------------------DDLIN-GNSASCADVIFIYARGS--TETGNLGTL
1cqzB           ------------------------------------------------SGPALCLCHG----FPE---SW
3e3aB           ----------------------------------------------------------------------
1cuvA           ------------------------------------DDLIN-GNSASCADVIFIYARGS--TETGNLGTL
1cuwA           ----------------------------------------------SCADVIFIYARGSTETGNLGTLGP
3cxuB           ------------------------------------------------EGPTILFIHG----FPE---LW
1cuuA           -----------------------------------RDDLINGNSA-SCADVIFIYARGS--TETGNLGTL
1c4xA           -------------------------------------TLASALVAGDPQSPAVVLLHGAGPGAHAA----
3dcnA           ------------------------------------NELETGSSS-ACPKVIYIFARASTEPGNGISAGP
2cutA           -----------------------------------------NGNSASCADVIFIYARGSTETGNLGTLGP
1dwoA           ----------------------------------------------KMVTAHFVLIHT----ICH---GA
1bn6A           -------------------------------------GERMYVDVGPRDGTPVLFLHG----NPT---SS
1e89A           ----------------------------------------------KMVTAHFVLIHT----ICH---GA
3e0xA           -------------------------------------ALHYVHVGNKKSPNTLLFVHG----SGCNLKIF
3b5eA           -------------------------------------AFPYLLGAGKESRECLFLLHGLVPLARRIAPTA
1eh5A           -----------------------------------------------PAPLPLVIWHG----MGDSCCN-
2a8lA           AVGAV-----------VVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHNPYSTAVSTSG


                         .         .         .         +         .         .         .:280
query           NIWETIFPDRTIMTYEYALYEPRSLAYSEMYRSFIEKEGRRSFIDFESDFLSQEILKYSQYEFDILAHGT
3d2cA           SNFEGIKSYLVSQGWSRDKLYAVDFWDKTGTNYN--------NGPVLSRFVQKVLDETGAKKVDIVAHSM
3ds8A           RSSNEALTTVNSEGKIK--FEGKLTKDAKRPIIKFGFEQNQATPDDWSKWLKEDLKSRYGFTQDGVGHSN
1cuaA           TLGPSIASNLESAFGKVWIQGVGGAYRATLGDNALPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQ
1cufA           GPSIASNLESAFGKDGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQ
3ef3A           SIASNLESAFGKDGVWIQGVGGAYRATLGDNAL--PRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQ
1cuhA           GPSIASNLESAFGKDGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQ
3d2bA           SNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTN--------YNNGPVLSRFVQKVLDETGAKKVDIVAHSM
1cuyA           TLGPSIASNLESAFGKVWIQGVGGAYRATLGDNALPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQ
1cexA           GPSIASNLESAFGKDGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQ
1cuxA           GPSIASNLESAFGKDGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLGLFQQANTKCPDATYIAGGYSQ
1cujA           GPSIASNLESAFGKDGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYCQ
3bdvA           ------------LRDSDDEHWQSHWERRFPHWQRIRQREWYQADLDRWVLAIRRELSVCTQPVILIGHSF
3d2aA           FNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYN--------NGPVLSRFVQKVLDETGAKKVDIVAHSM
3dd5C           GPIVADALERIYGANDVWVQGVGGPYLADLASNFLPDGTSSAAINEARRLFTLANTKCPNAAIVSGGYSQ
3bdvB           ------LRD-SDDEHWQSHWERRFPHWQRIRQRE----WYQADLDRWVLAI-RRELSVCTQPVILIGHSF
3deaB           GPIVADALERIYGANDVWVQGVGGPYLADLASNFLPDGTSSAAINEARRLFTLANTKCPNAAIVSGGYSQ
2dstA           --YAFYLLDL------------PGYGRTEGPR-------MAPEELAHFVAGFAVMMNLGAPWVLLRGLGL
1cubA           GPSIASNLESAFGKDGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQ
3cxuA           YSWRHQMVYLAERGYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVAL-LEAIAPNEEKVFVVAHDW
1cuzA           GPSIASNLESAFGKDGVWIQGVGGAYRATGGDNALPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQ
2cjpA           YSWRHQMVYLAERGYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGD-VVALLEAIAPNEEKVFVVAHDW
3deaA           GPIVADALERIYGANDVWVQGVGGPYLADLASNFLPDGTSSAAINEARRLFTLANTKCPNAAIVSGGYSQ
1agyA           GPSIASNLESAFGKDGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQ
2cjpB           YSWRHQMVYLAERGYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVALLE-AIAPNEEKVFVVAHDW
3e0xB           GELEKYLEDYNCILLDLKGH---------GESKGQCPSTVYGYIDNVANFITNSEVTKHQKNITLIGYSG
3dd5A           GPIVADALERIYGANDVWVQGVGGPYLADLASNFLPDGTSSAAINEARRLFTLANTKCPNAAIVSGGYSQ
1cugA           GPSIASNLESAFGKDGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQ
1cqzB           FSWRYQIPALAQAGFRVLAIDMKGYGDSSSPPE-----IEEYAMELLCKEMVTFLDKLGIPQAVFIGHDW
3e3aB           --------------------------------------------------------------ARVVGVSM
1cuvA           GPSIASNLESAFGKDGVWIQGVGGAYRATLGDNFLPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQ
1cuwA           SIASNLE--SAFGKDGVWIQGVGGAYRATLADNFLPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQ
3cxuB           YSWRHQMVYLAERGYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVAL-LEAIAPNEEKVFVVAHDW
1cuuA           GPSIASNLESAFGKDGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQ
1c4xA           SNWRPIIP---DLAENFFVVAPDLIGFGQSEYPETYPGHIMSWVGMRVEQILGLMNHFGIEKSHIVGNSM
3dcnA           IVADALERIYGANDVWVQGVGGPYLADLASN--FLPDGTSSAAINEARRLFTLANTKCPNAAIVSGGYSQ
2cutA           SIASNLE--SAFGKDGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQ
1dwoA           WIWHKLKPALERAGHKVTALDMA------ASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGEC
1bn6A           YLWRNIIP---HVAPSHRCIAPDLIGMGKSDK-----PDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDW
1e89A           WIWHKLKPALERAGHKVTALDMA------ASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEVIIVGEAC
3e0xA           GELEKYLEDYNCILLDLKGHG---------ESKGQCPSTVYGYIDNVANFITNSEVTKHQKNITLIGYSG
3b5eA           TLV-AARGRIPQEDGFRW---FERIDPTRFEQKSILAE-TAAFAAFTNEAAKRHGLNLDH--ATFLGYSN
1eh5A           --PLSMGAIKKMVEKKIPGIHVLSLEIGKTLREDVENSFFLNVNSQVTTVCQILAKDPKLQQGYNAMFSQ
2a8lA           CGEHLV---RTILARECSHA-----------------LQAEDAHQALLETMQNKFISS--PFLASEDGVL


                         .         *         .         .         .         .         +:350
query           GGLIVLRMLQRHPEVNNVRKVVLLSTPVQGTNVVNPLYFSSIFYGKDPEVLEDIFGIEWTKLKMLTLHIR
3d2cA           GGANTLYYIKYLDGGNKVANVVTLGGANRLTTDKAPPGTDPNQKILYTSIYSSDDMIVMNYLSRLDGARN
3ds8A           GGLALTYYAEDYAGDKTLRKLVAIGSPFNDPNDNGDLSFKKLPNSTPQDYFIKNQTEVSPDLEVLAIA--
1cuaA           GAALAAASIEDLDS--AIRDKIAGTVL-------------------------------------------
1cufA           GAALAAASIEDLDSAIRDKGTVLFGYTKNLQNLGRIP---------------------------------
3ef3A           GAALAAASIEDLDSRDKIAGTVLFGYTKNLQNRGRIP---------------------------------
1cuhA           GAALAAASIEDLDS--AIRDKIAGTVLF------------------------------------------
3d2bA           GGANTLYYIKYLDGGNKVANVVTLGGANRLTTGKAPPGYTSIYSSDDMIVMNYLSRLDGARNVQIHGVGH
1cuyA           GAALAAASIEDLDSAIRIAGTVLFGYTKNLQNRGRIP---------------------------------
1cexA           GAALAAASIEDLDS--AIRDKIAGTVLFGY---TKNLQNRGRIPNYPADRTKVFCN--------------
1cuxA           GAALAAASIEDLDS--AIRDKIAGTVLFGY---TKNLQNRGRIPNYPADRTKVFCN--------------
1cujA           GAALAAASIEDLDSRDKIAGTVLFGYTKNLQNRGRIP---------------------------------
3bdvA           GALAACHVVQQGQE--GIAGVLVAPAEPRFEIDDRIQA--------------------------------
3d2aA           GGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKAPPGT-------------------------------
3dd5C           GTAVMAGSISGLSTKNQIKGVVLFGYTKNLQNLGRIPNF-------------------------------
3bdvB           GALAACHVVQQGQE--GIAGVLVAPAEPRFEIDDRIQA--------------------------------
3deaB           GTAVMAGSISGLST--TIKNQIKGVVLFGY---TKNLQNLGRIPNFETSKTEVYCD--------------
2dstA           ALGPHLEALGLRAL--PAEGVEVAEVLSSKLS--------------------------------------
1cubA           GAALAAASIEDLDS--AIRDKIAGTVLF------------------------------------------
3cxuA           GALIAWHLCLFRPD--KVKALVNLSVHFSKRNPKMNVV--------------------------------
1cuzA           GAALAAASIEDLDSAIRIAGTVLFGYTKNLQNRGRIP---------------------------------
2cjpA           GALIAWHLCLFRPD--KVKALVNLSVHFSKRNPKMNVV--------------------------------
3deaA           GTAVMAGSISGLSTTNQIKGVVLFGYTKNLQNLGRIP---------------------------------
1agyA           GAALAAASIEDLDSAIR-DKIAGTVLFGYTKNLQNRGRIPNYPADRTKVFCNTGDLVCTGSLIVAAPHLA
2cjpB           GALIAWHLCLFRPD--KVKALVNLSVHF------------------------------------------
3e0xB           GAIVLGVALKKLPN--VRKVVSLSGGA-------------------------------------------
3dd5A           GTAVMAGSISGLST--TIKNQIKGVVLF------------------------------------------
1cugA           GAALAAASIEDLDS--------------------------------------------------------
1cqzB           AGVMVWNMALFYPE--RVRAVASLNTPF------------------------------------------
3e3aB           GAFIAQELMVVAPEL--VSSAVLMATR-------------------------------------------
1cuvA           GAALAAASIEDLDS--AIRDKIAGTVLF---GYTKNLQNRGRIPNYPADRTKVFCN--------------
1cuwA           GAALAAASIEDLDS--AIRDKIAGTVLF------------------------------------------
3cxuB           GALIAWHLCLFRPD--KVKALVNLSVHFSKRNPKMNVV--------------------------------
1cuuA           GAALAAASIEDLDS--------------------------------------------------------
1c4xA           GGAVTLQLVVEAPE--RFDKVALMGSV-------------------------------------------
3dcnA           GTAVMAGSISGLSTTIKIKGVVLFGYTKNLQNLGRI----------------------------------
2cutA           GAALAAASIEDLDS--AIRDKIAG----------------------------------------------
1dwoA           AGLNIAIAADRYVD--KIAAGVFHN-SLLPDTVHSPSYTVEKLLESFPDWRDTEY---------------
1bn6A           GSALGFHWAKRNPE--RVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIE-----
1e89A           AGLNIAIAADRYVD--KIAAGVFHNSLL------------------------------------------
3e0xA           GAIVLGVALKKLPN--VRKVVSLSGGA-------------------------------------------
3b5eA           GANLVSSLLLHPGI--VRLAALLRPPVLDHVPATDLAG--------------------------------
1eh5A           GGQFLRAVAQRCPS--PPMVNLISVGG-------------------------------------------
2a8lA           GGVIVLR---------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           NLIDTLGEVVQEILPDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d2cA           VQIHGVGHMGLLYSSQ------------------------------------------------------
3ds8A           ----------------------------------------------------------------------
1cuaA           ----------------------------------------------------------------------
1cufA           ----------------------------------------------------------------------
3ef3A           ----------------------------------------------------------------------
1cuhA           ----------------------------------------------------------------------
3d2bA           MGLLYSSQVYSLIK--------------------------------------------------------
1cuyA           ----------------------------------------------------------------------
1cexA           ----------------------------------------------------------------------
1cuxA           ----------------------------------------------------------------------
1cujA           ----------------------------------------------------------------------
3bdvA           ----------------------------------------------------------------------
3d2aA           ----------------------------------------------------------------------
3dd5C           ----------------------------------------------------------------------
3bdvB           ----------------------------------------------------------------------
3deaB           ----------------------------------------------------------------------
2dstA           ----------------------------------------------------------------------
1cubA           ----------------------------------------------------------------------
3cxuA           ----------------------------------------------------------------------
1cuzA           ----------------------------------------------------------------------
2cjpA           ----------------------------------------------------------------------
3deaA           ----------------------------------------------------------------------
1agyA           ----------------------------------------------------------------------
2cjpB           ----------------------------------------------------------------------
3e0xB           ----------------------------------------------------------------------
3dd5A           ----------------------------------------------------------------------
1cugA           ----------------------------------------------------------------------
1cqzB           ----------------------------------------------------------------------
3e3aB           ----------------------------------------------------------------------
1cuvA           ----------------------------------------------------------------------
1cuwA           ----------------------------------------------------------------------
3cxuB           ----------------------------------------------------------------------
1cuuA           ----------------------------------------------------------------------
1c4xA           ----------------------------------------------------------------------
3dcnA           ----------------------------------------------------------------------
2cutA           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1bn6A           ----------------------------------------------------------------------
1e89A           ----------------------------------------------------------------------
3e0xA           ----------------------------------------------------------------------
3b5eA           ----------------------------------------------------------------------
1eh5A           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d2cA           ----------------------------------------------------------------------
3ds8A           ----------------------------------------------------------------------
1cuaA           ----------------------------------------------------------------------
1cufA           ----------------------------------------------------------------------
3ef3A           ----------------------------------------------------------------------
1cuhA           ----------------------------------------------------------------------
3d2bA           ----------------------------------------------------------------------
1cuyA           ----------------------------------------------------------------------
1cexA           ----------------------------------------------------------------------
1cuxA           ----------------------------------------------------------------------
1cujA           ----------------------------------------------------------------------
3bdvA           ----------------------------------------------------------------------
3d2aA           ----------------------------------------------------------------------
3dd5C           ----------------------------------------------------------------------
3bdvB           ----------------------------------------------------------------------
3deaB           ----------------------------------------------------------------------
2dstA           ----------------------------------------------------------------------
1cubA           ----------------------------------------------------------------------
3cxuA           ----------------------------------------------------------------------
1cuzA           ----------------------------------------------------------------------
2cjpA           ----------------------------------------------------------------------
3deaA           ----------------------------------------------------------------------
1agyA           ----------------------------------------------------------------------
2cjpB           ----------------------------------------------------------------------
3e0xB           ----------------------------------------------------------------------
3dd5A           ----------------------------------------------------------------------
1cugA           ----------------------------------------------------------------------
1cqzB           ----------------------------------------------------------------------
3e3aB           ----------------------------------------------------------------------
1cuvA           ----------------------------------------------------------------------
1cuwA           ----------------------------------------------------------------------
3cxuB           ----------------------------------------------------------------------
1cuuA           ----------------------------------------------------------------------
1c4xA           ----------------------------------------------------------------------
3dcnA           ----------------------------------------------------------------------
2cutA           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1bn6A           ----------------------------------------------------------------------
1e89A           ----------------------------------------------------------------------
3e0xA           ----------------------------------------------------------------------
3b5eA           ----------------------------------------------------------------------
1eh5A           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d2cA           ----------------------------------------------------------------------
3ds8A           ----------------------------------------------------------------------
1cuaA           ----------------------------------------------------------------------
1cufA           ----------------------------------------------------------------------
3ef3A           ----------------------------------------------------------------------
1cuhA           ----------------------------------------------------------------------
3d2bA           ----------------------------------------------------------------------
1cuyA           ----------------------------------------------------------------------
1cexA           ----------------------------------------------------------------------
1cuxA           ----------------------------------------------------------------------
1cujA           ----------------------------------------------------------------------
3bdvA           ----------------------------------------------------------------------
3d2aA           ----------------------------------------------------------------------
3dd5C           ----------------------------------------------------------------------
3bdvB           ----------------------------------------------------------------------
3deaB           ----------------------------------------------------------------------
2dstA           ----------------------------------------------------------------------
1cubA           ----------------------------------------------------------------------
3cxuA           ----------------------------------------------------------------------
1cuzA           ----------------------------------------------------------------------
2cjpA           ----------------------------------------------------------------------
3deaA           ----------------------------------------------------------------------
1agyA           ----------------------------------------------------------------------
2cjpB           ----------------------------------------------------------------------
3e0xB           ----------------------------------------------------------------------
3dd5A           ----------------------------------------------------------------------
1cugA           ----------------------------------------------------------------------
1cqzB           ----------------------------------------------------------------------
3e3aB           ----------------------------------------------------------------------
1cuvA           ----------------------------------------------------------------------
1cuwA           ----------------------------------------------------------------------
3cxuB           ----------------------------------------------------------------------
1cuuA           ----------------------------------------------------------------------
1c4xA           ----------------------------------------------------------------------
3dcnA           ----------------------------------------------------------------------
2cutA           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1bn6A           ----------------------------------------------------------------------
1e89A           ----------------------------------------------------------------------
3e0xA           ----------------------------------------------------------------------
3b5eA           ----------------------------------------------------------------------
1eh5A           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d2cA           ----------------------------------------------------------------------
3ds8A           ----------------------------------------------------------------------
1cuaA           ----------------------------------------------------------------------
1cufA           ----------------------------------------------------------------------
3ef3A           ----------------------------------------------------------------------
1cuhA           ----------------------------------------------------------------------
3d2bA           ----------------------------------------------------------------------
1cuyA           ----------------------------------------------------------------------
1cexA           ----------------------------------------------------------------------
1cuxA           ----------------------------------------------------------------------
1cujA           ----------------------------------------------------------------------
3bdvA           ----------------------------------------------------------------------
3d2aA           ----------------------------------------------------------------------
3dd5C           ----------------------------------------------------------------------
3bdvB           ----------------------------------------------------------------------
3deaB           ----------------------------------------------------------------------
2dstA           ----------------------------------------------------------------------
1cubA           ----------------------------------------------------------------------
3cxuA           ----------------------------------------------------------------------
1cuzA           ----------------------------------------------------------------------
2cjpA           ----------------------------------------------------------------------
3deaA           ----------------------------------------------------------------------
1agyA           ----------------------------------------------------------------------
2cjpB           ----------------------------------------------------------------------
3e0xB           ----------------------------------------------------------------------
3dd5A           ----------------------------------------------------------------------
1cugA           ----------------------------------------------------------------------
1cqzB           ----------------------------------------------------------------------
3e3aB           ----------------------------------------------------------------------
1cuvA           ----------------------------------------------------------------------
1cuwA           ----------------------------------------------------------------------
3cxuB           ----------------------------------------------------------------------
1cuuA           ----------------------------------------------------------------------
1c4xA           ----------------------------------------------------------------------
3dcnA           ----------------------------------------------------------------------
2cutA           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1bn6A           ----------------------------------------------------------------------
1e89A           ----------------------------------------------------------------------
3e0xA           ----------------------------------------------------------------------
3b5eA           ----------------------------------------------------------------------
1eh5A           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d2cA           ----------------------------------------------------------------------
3ds8A           ----------------------------------------------------------------------
1cuaA           ----------------------------------------------------------------------
1cufA           ----------------------------------------------------------------------
3ef3A           ----------------------------------------------------------------------
1cuhA           ----------------------------------------------------------------------
3d2bA           ----------------------------------------------------------------------
1cuyA           ----------------------------------------------------------------------
1cexA           ----------------------------------------------------------------------
1cuxA           ----------------------------------------------------------------------
1cujA           ----------------------------------------------------------------------
3bdvA           ----------------------------------------------------------------------
3d2aA           ----------------------------------------------------------------------
3dd5C           ----------------------------------------------------------------------
3bdvB           ----------------------------------------------------------------------
3deaB           ----------------------------------------------------------------------
2dstA           ----------------------------------------------------------------------
1cubA           ----------------------------------------------------------------------
3cxuA           ----------------------------------------------------------------------
1cuzA           ----------------------------------------------------------------------
2cjpA           ----------------------------------------------------------------------
3deaA           ----------------------------------------------------------------------
1agyA           ----------------------------------------------------------------------
2cjpB           ----------------------------------------------------------------------
3e0xB           ----------------------------------------------------------------------
3dd5A           ----------------------------------------------------------------------
1cugA           ----------------------------------------------------------------------
1cqzB           ----------------------------------------------------------------------
3e3aB           ----------------------------------------------------------------------
1cuvA           ----------------------------------------------------------------------
1cuwA           ----------------------------------------------------------------------
3cxuB           ----------------------------------------------------------------------
1cuuA           ----------------------------------------------------------------------
1c4xA           ----------------------------------------------------------------------
3dcnA           ----------------------------------------------------------------------
2cutA           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1bn6A           ----------------------------------------------------------------------
1e89A           ----------------------------------------------------------------------
3e0xA           ----------------------------------------------------------------------
3b5eA           ----------------------------------------------------------------------
1eh5A           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d2cA           ----------------------------------------------------------------------
3ds8A           ----------------------------------------------------------------------
1cuaA           ----------------------------------------------------------------------
1cufA           ----------------------------------------------------------------------
3ef3A           ----------------------------------------------------------------------
1cuhA           ----------------------------------------------------------------------
3d2bA           ----------------------------------------------------------------------
1cuyA           ----------------------------------------------------------------------
1cexA           ----------------------------------------------------------------------
1cuxA           ----------------------------------------------------------------------
1cujA           ----------------------------------------------------------------------
3bdvA           ----------------------------------------------------------------------
3d2aA           ----------------------------------------------------------------------
3dd5C           ----------------------------------------------------------------------
3bdvB           ----------------------------------------------------------------------
3deaB           ----------------------------------------------------------------------
2dstA           ----------------------------------------------------------------------
1cubA           ----------------------------------------------------------------------
3cxuA           ----------------------------------------------------------------------
1cuzA           ----------------------------------------------------------------------
2cjpA           ----------------------------------------------------------------------
3deaA           ----------------------------------------------------------------------
1agyA           ----------------------------------------------------------------------
2cjpB           ----------------------------------------------------------------------
3e0xB           ----------------------------------------------------------------------
3dd5A           ----------------------------------------------------------------------
1cugA           ----------------------------------------------------------------------
1cqzB           ----------------------------------------------------------------------
3e3aB           ----------------------------------------------------------------------
1cuvA           ----------------------------------------------------------------------
1cuwA           ----------------------------------------------------------------------
3cxuB           ----------------------------------------------------------------------
1cuuA           ----------------------------------------------------------------------
1c4xA           ----------------------------------------------------------------------
3dcnA           ----------------------------------------------------------------------
2cutA           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1bn6A           ----------------------------------------------------------------------
1e89A           ----------------------------------------------------------------------
3e0xA           ----------------------------------------------------------------------
3b5eA           ----------------------------------------------------------------------
1eh5A           ----------------------------------------------------------------------
2a8lA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           x
3d2cA           -
3ds8A           -
1cuaA           -
1cufA           -
3ef3A           -
1cuhA           -
3d2bA           -
1cuyA           -
1cexA           -
1cuxA           -
1cujA           -
3bdvA           -
3d2aA           -
3dd5C           -
3bdvB           -
3deaB           -
2dstA           -
1cubA           -
3cxuA           -
1cuzA           -
2cjpA           -
3deaA           -
1agyA           -
2cjpB           -
3e0xB           -
3dd5A           -
1cugA           -
1cqzB           -
3e3aB           -
1cuvA           -
1cuwA           -
3cxuB           -
1cuuA           -
1c4xA           -
3dcnA           -
2cutA           -
1dwoA           -
1bn6A           -
1e89A           -
3e0xA           -
3b5eA           -
1eh5A           -
2a8lA           -