[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tmar0:AAD35418.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dezB.bssp"
#ERROR : Can't open dsspfile "3dezA.bssp"
#ERROR : Can't open dsspfile "1cjbA.bssp"
#ERROR : Can't open dsspfile "2aeeB.bssp"
#ERROR : Can't open dsspfile "2dy0B.bssp"
#ERROR : Can't open dsspfile "2dy0A.bssp"
#ERROR : Can't open dsspfile "1a96D.bssp"
#ERROR : Can't open dsspfile "2aeeA.bssp"
#ERROR : Can't open dsspfile "1a97D.bssp"
#ERROR : Can't open dsspfile "1a95D.bssp"
#ERROR : Can't open dsspfile "1cjbC.bssp"
#ERROR : Can't open dsspfile "1a97B.bssp"
#ERROR : Can't open dsspfile "1a97A.bssp"
#ERROR : Can't open dsspfile "1a4xA.bssp"
#ERROR : Can't open dsspfile "1a95A.bssp"
#ERROR : Can't open dsspfile "3efhA.bssp"
#ERROR : Can't open dsspfile "1a3cA.bssp"
#ERROR : Can't open dsspfile "1a95B.bssp"
#ERROR : Can't open dsspfile "3dmpC.bssp"
#ERROR : Can't open dsspfile "2e55A.bssp"
#ERROR : Can't open dsspfile "1bzyA.bssp"
#ERROR : Can't open dsspfile "1dbrC.bssp"
#ERROR : Can't open dsspfile "2ehjA.bssp"
#ERROR : Can't open dsspfile "1a98A.bssp"
#ERROR : Can't open dsspfile "1bd3D.bssp"
#ERROR : Can't open dsspfile "1dbrB.bssp"
#ERROR : Can't open dsspfile "1dqnA.bssp"
#ERROR : Can't open dsspfile "1a98B.bssp"
#ERROR : Can't open dsspfile "1a4xB.bssp"
#ERROR : Can't open dsspfile "3dmpA.bssp"
#ERROR : Can't open dsspfile "3dahC.bssp"
#ERROR : Can't open dsspfile "1d6nA.bssp"
#ERROR : Can't open dsspfile "1dbrA.bssp"
#ERROR : Can't open dsspfile "1ao0A.bssp"
#ERROR : Can't open dsspfile "1dkrA.bssp"
#ERROR : Can't open dsspfile "3dahB.bssp"
#ERROR : Can't open dsspfile "1ecbD.bssp"
#ERROR : Can't open dsspfile "1dkrB.bssp"
#ERROR : Can't open dsspfile "2c4kA.bssp"
#ERROR : Can't open dsspfile "1bfdA.bssp"

## Summary of PDB Search
:187
    2e-20  21%  3dezB  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    7e-19  21%  3dezA  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    2e-16  14%  1cjbA  [c.61.1] PROTEIN (HYPOXANTHINE-GUANINE
    6e-16  22%  2aeeB  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    7e-16  22%  2dy0B  [x.x.x] ADENINE PHOSPHORIBOSYLTRANSFERASE
    7e-16  23%  2dy0A  [x.x.x] ADENINE PHOSPHORIBOSYLTRANSFERASE
    2e-15  13%  1a96D  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    3e-15  20%  2aeeA  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    6e-14  14%  1a97D  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    9e-14  13%  1a95D  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    2e-13  12%  1cjbC  [c.61.1] PROTEIN (HYPOXANTHINE-GUANINE
    2e-12  17%  1a97B  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    4e-12  13%  1a97A  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    4e-12  17%  1a4xA  [c.61.1] PYRIMIDINE OPERON REGULATORY PROTEIN PYRR
    5e-12  14%  1a95A  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    6e-12  15%  3efhA  [x.x.x] RIBOSE-PHOSPHATE PYROPHOSPHOKINASE 1
    9e-12  13%  1a3cA  [x.x.x] PYRIMIDINE OPERON REGULATORY PROTEIN PYRR
    1e-11  14%  1a95B  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    3e-11   9%  3dmpC  [x.x.x] URACIL PHOSPHORIBOSYLTRANSFERASE
    5e-11  12%  2e55A  [x.x.x] URACIL PHOSPHORIBOSYLTRANSFERASE
    6e-11  17%  1bzyA  [c.61.1] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    7e-11  15%  1dbrC  [c.61.1] HYPOXANTHINE GUANINE XANTHINE
    1e-10  15%  2ehjA  [x.x.x] URACIL PHOSPHORIBOSYLTRANSFERASE
    1e-10  14%  1a98A  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    1e-10  12%  1bd3D  [c.61.1] URACIL PHOSPHORIBOSYLTRANSFERASE
    2e-10  15%  1dbrB  [c.61.1] HYPOXANTHINE GUANINE XANTHINE
    9e-10  12%  1dqnA  [c.61.1] GUANINE PHOSPHORIBOSYLTRANSFERASE
    2e-09  13%  1a98B  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    4e-09  17%  1a4xB  [c.61.1] PYRIMIDINE OPERON REGULATORY PROTEIN PYRR
    1e-08  12%  3dmpA  [x.x.x] URACIL PHOSPHORIBOSYLTRANSFERASE
    5e-08  19%  3dahC  [x.x.x] RIBOSE-PHOSPHATE PYROPHOSPHOKINASE
    2e-07  19%  1d6nA  [c.61.1] PROTEIN (HYPOXANTHINE-GUANINE
    3e-07  14%  1dbrA  [c.61.1] HYPOXANTHINE GUANINE XANTHINE
    4e-07  23%  1ao0A  [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
    2e-05  23%  1dkrA  [c.61.1 - c.61.1] PHOSPHORIBOSYL PYROPHOSPHATE SYNTHETASE
    4e-05  19%  3dahB  [x.x.x] RIBOSE-PHOSPHATE PYROPHOSPHOKINASE
    4e-05  21%  1ecbD  [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
    1e-04  24%  1dkrB  [c.61.1 - c.61.1] PHOSPHORIBOSYL PYROPHOSPHATE SYNTHETASE
    2e-04  20%  2c4kA  [x.x.x] PHOSPHORIBOSYL PYROPHOSPHATE SYNTHETASE-
    8e-04  15%  1bfdA  [x.x.x] BENZOYLFORMATE DECARBOXYLASE
:187

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIKEILEKTGALMEGHFILSSGKHSSRYVQCARLFEFPEYGDVVGEELAKLLKKYDVETVVGPAMGGVIL
3dezB           ------------------EEPFTKSPIYTDNRITLSYPETRTLIENGFVETIKEAEVEVIAGTATAGIPH
3dezA           ---RDLLDIKAVYLKPEEPFTWIKSPIYTDNRITLSYPETRTLIENGFVETIKEAEVEVIAGTATAGIPH
1cjbA           ----------AFDPVFVNDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYDHILCLLKGSRGF
2aeeB           -----IKAVYLKPEDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIKAHFPEVIAGTATAGIPH
2dy0B           -----YLKNSIKSIQDYP----KPGILFRDVTSLLEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLF
2dy0A           ----------------------KPGILFRDVTSLLEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLF
1a96D           ---------------------------------IVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVP
2aeeA           -------------EDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIKAHFPEVIAGTATAGIPH
1a97D           ---------------------------------IVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVP
1a95D           -------------------------SEKY----IVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVP
1cjbC           IPNNPGAGENAFDPVFVNDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLEEFHILCLLKGSRGF
1a97B           --------------------------------KYIVTWDMLQIHARKLASRLPSEQWKGIIAVSRGGLVP
1a97A           ---------------------------------IVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVP
1a4xA           -----------------------------------AIRRALTRIAHEMIERNKGMNNCILVGIKTRGIYL
1a95A           ---------------------------------IVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVP
3efhA           ---------------NMLSVAGADHIITMDLDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKR
1a3cA           --------------------------------AVILDEQAIRRALTRIAHEMIERNKCILVGIKTRGIYL
1a95B           ---------------------------------IVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVP
3dmpC           --------TSTRTFRELLREITLLMGYEITRNLPITTKRVETPLVEIDAPVIA-GKKLAIVPVLRAGVGM
2e55A           --------------EKLRKTLKELGFMLVYEALKDILLEEKEVRTWIGNKRFNYLNEEVFVPILRAGLSF
1bzyA           -------------PGYDLDLFCIPNHYAEDLERVFIHGLIMDRTERLARDVMKEMGGHHALCVLKGGYKF
1dbrC           ---------------YNADDFLVPPHCKPYIDKILLPGGLVKDRVEKLAYDIHRTEELHIICILKGSRGF
2ehjA           --------ISTKRFRELASEVGSLLTYEATA-DLETEKVTIEGWNGPVEIDQIKGKKITVVPILRAGLGM
1a98A           ---------------------------------IVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVP
1bd3D           ---------------------------------LPFQKKEVTTPLDVSYHGVSFYSKICGVSIVRAGESM
1dbrB           --------------------------CKPYIDKILLPGGLVKDRVEKLAYDIHRTEELHIICILKGSRGF
1dqnA           PVKDVLSTFFKDR--NDVLESEVKKFHLLATFEECKALAADTAR-RMNEYYKDVAEPVTLVALLTGAYLY
1a98B           ---------------------------------IVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVP
1a4xB           -----------------------------------------TRIAHEMIERNKGMNNCILVGIKTRGIYL
3dmpA           -----------TRTFRELLREITLLMGYEITRNLPITTKRVETPLVEIDAPVIAGKKLAIVPVLRAGVGM
3dahC           ----------------------------------------------------------------------
1d6nA           ---------------------------------FIPHGLIMDRTERLARDVMKEMGGHHALCVLAGGYKF
1dbrA           -------------NTFYNADDFLVPPHCPYIDKILLPGGLVKDRVEKLAYDIHRGEELHIICILKGSRGF
1ao0A           ---------------------------------------DVVTGVPDSSISAAIGYAEATGIPYELGLIK
1dkrA           ----------------------------------FFDIPIDHLMGPILGEYFEGKNLEVIVSPDHGGVTR
3dahB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1dkrB           ---------------------------APQIQGFFDIPIDHLMGVPILGEYFEGKNLEVIVSPDHGGVT-
2c4kA           ---------------------------------------------QYIQEEIPNYRNAVIVAKSPDAAKR
1bfdA           -------------------------------------------VHGTTYELLRRQGIDTVFG-NPGSNEL


                         .         .         *         .         .         .         .:140
query           SYVVARYLKARSLFAERENGVMKLRRGFFVKPGEKVAVVEDVVTTGGSVKEVIELLKEYGANVVCVGSII
3dezB           GAIIADKMNLPLAYIRSQ-------IEGRVTKGQKMVIIEDLISTGGSVLDAVAAAQREGADVLGVVAIF
3dezA           GAIIADKMNLPLAYIRSKPKNQIEGR---VTKGQKMVIIEDLISTGGSVLDAVAAAQREGADVLGVVAIF
1cjbA           FTALLKHLSRIHNYSQSTGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLF
2aeeB           GAIIADKMTLPFAYIRS----KPNQIEGRVLKGQKMVIIEDLISTGGSVLDAAAAASREGADVLGVVAIF
2dy0B           GAPVALGLGVGFVPVEYGTDQLEIHVDAIK-PGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
2dy0A           GAPVALGLGVGFVPVEYGTDQLEIHVDAIK-PGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFII
1a96D           GALLARELGIRHVDTVCISSRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAG
2aeeA           GAIIADKMTLPFAYIRSKPKGNQIEGRVL--KGQKMVIIEDLISTGGSVLDAAAAASREGADVLGVVAIF
1a97D           GALLARELGIRHVDTVAISSYLKVLKRAEGD-GEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAG
1a95D           GALLARELGIRHVDTVCISYRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAG
1cjbC           FTALLKHLSRIHNYSQSTGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLF
1a97B           GALLARELGIISSYDHDNQRELKVLKRAEGD-GEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAG
1a97A           GALLARELGIRHVDTSSYDRELKVLKRAEGDG-EGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAG
1a4xA           AKRLAERIEQIEGNPLYREPLVKGADIPVDITDQKVILVDDVLYTGRTVRAGMDALVDVGRPSSIQLAVL
1a95A           GALLARELGIRHVDTVCISSYNQRELKVLKGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAG
3efhA           VTSIADRLNVDFALIHKERK----MVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTH
1a3cA           AKRLAERIEQIEGNPRNDEPLVKGADIPVDITDQKVILVDDVLYTGRTVRAGMDALVDVGRPSSIQLAVL
1a95B           GALLARELGIISSYDHDNQRELKVLKRAEGD-GEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAG
3dmpC           SDGLLELIPSARVGHRADDRPVEYLVRLPDLEDRIFILCDPMVATGYSAAHAIDVLKRRGVPGERLMFLA
2e55A           LEGALQVVPNAKVGFLGIKRNEETLESHIYLKGKIVVILDPMLATGGTLEVALREILKHSPLKVKSVHAI
1bzyA           FADLLDYIKALNRNSDRSIPMTVDFIRLKTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
1dbrC           FNLLIDYLATIQKYSGRVRLLTVLSDDLSIFRDKHVLIVEDIVDTGFTLTEFGERLKAVGPKSMRIATLV
2ehjA           MDGVLENVPSARISVETLEPVPYFQKLVSNIDERMALIVDPMLATGGSVIATIDLLKKAGCSSIKVLVLV
1a98A           GALLARELG------------IRHVDTVAIGDGEGFIVIDDLVDTAVAIREMYPKAHFVTIFAKPAGRPL
1bd3D           ESGLRAVCRGVRIGKTTAEPKLIYEKLPADIRERWVMLLDPMCATAGSVCKAIEVLLRLGVKEERIIFVN
1dbrB           FNLLIDYLATIQKYEHYVRLLTVLSDDLSIFRDKHVLIVEDIVDTGFTLTEFGERLKAVGPKSMRIATLV
1dqnA           ASLLTVHVKVSSYKGTRQESVFDEEDLKQLKEKREVVLIDEYVDSGHTIFSIQEQIKHAKICSCFVKDVD
1a98B           GALLARELGIRH-------------VDTVAISGEGFIVIDDLVDTTAVAIRE--MYPKAHFVTIFAKPAG
1a4xB           AKRLAERIEQIEGNPTLYDELVKGADIPVDITDQKVILVDDVLYTGRTVRAGMDALVDVGRPSSIQLAVL
3dmpA           SDGLLELIPSARVGHIGVYRADDHRPVEYDLEDRIFILCDPMVATGYSAAHAIDVLKRRGVPGERLMFLA
3dahC           ---------------------RRVMNIIGEVEGRTCVIMDDMVDTAGTLCKAAQVLKERGAKQVFAYATH
1d6nA           FADLLDYIKALNRFIRLGSYCNDQSTGDIKLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
1dbrA           FNLLIDYLATVRLQNDNSTGQTVLSDDLSIFRDKHVLIVEDIVDTGFTLTEFGERLKAVGPKSMRIATLV
1ao0A           NRYVGRTFIQPSQALREQGVRMKLSAVRGVVEGKRVVMVDDSIVRGTTSRRIVTMLREAGATEVHV----
1dkrA           ARKLADRLKAPIAIIDKR------MNIVGNIEGKTAILIDDIIDTAGTITLAANALVENGAKEVYA----
3dahB           ---------------------LNCDLAIGEVEGRTCVIMDDMVDTAGTLCKAAQVLKERGAKQVFAYATH
1ecbD           ---VKNRYVGRTFIMSVRRKLNANRAEFRDKN---VLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAA
1dkrB           --------RARKLADRLKAPIIIDKRMNIVGNGKTAILIDDIIDTAGTITLAANALVENGAKEVYA----
2c4kA           AQSYAERLR-------LGLAVIHPPITVVGDVGGRIAIVDDIIDDVESFVAAAEILKERGAYYVMATHGI
1bfdA           PFLKDFPEDFRYILALQEACVVGIADGYA-QASRKPAFI--NLHSAAGTGNAMGALSNWNSHSPLIVTAG


                         +         .         .         .         .         *         .:210
query           DRSGGKVDFGVPFESLLKLDLPVYDPEDCPLCKQGIxxxxxxxxxxx
3dezB           TYELPKEKASVKLVTLSNYS---------------------------
3dezA           T----------------------------------------------
1cjbA           I----------------------------------------------
2aeeB           TYELPK-----------------------------------------
2dy0B           NLFDLGEKQGITSYSLVPFP---------------------------
2dy0A           NLFDLGEKQGITSYSLVPFP---------------------------
1a96D           RPLVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR-------------
2aeeA           TYELPKKEAGIKLITLSNTELIAVAKLQGYITNDGL-----------
1a97D           RPLVDDYVVDIPQDTWIEQPWDMGVVFVPPI----------------
1a95D           RPLVDDYVVDIPQDTWIEQPWDMGVVFVPPI----------------
1cjbC           IKRTPL-----------------------------------------
1a97B           RPLVDDYVVDIP-----------------------------------
1a97A           RPLVDDYVVDIPQDTWIEQPWDMGVVFVPPI----------------
1a4xA           VDRGH------------------------------------------
1a95A           RPLVDDYVVDIP-----------------------------------
3efhA           GISGPAISR--------------------------------------
1a3cA           VDRGHRELPIRADYIGKNIPTSKSEKVMVQLDE--------------
1a95B           RPVDDYVVDIPQDTWIEQPWDMGV-----------------------
3dmpC           LVAAPEGVQVFQDAHPDVKLYVASLDSHLD-----------------
2e55A           AAPEG------------------------------------------
1bzyA           VKRTPR-----------------------------------------
1dbrC           EKRTD------------------------------------------
2ehjA           AAPEGIAALEKAHPDVELYTASIDQG---------------------
1a98A           VDDYVV-----------------------------------------
1bd3D           ILAAPQGIERVFKE---------------------------------
1dbrB           EKRTDRSNSLKG-----------------------------------
1dqnA           AIKKHSALADT------------------------------------
1a98B           RPLVDDYVVDIPQDTWI------------------------------
1a4xB           VDRGHRELPIRAD--YIGKNIPTSKSEK-------------------
3dmpA           LVAAPEGVQVFQDAHPDV--KLYVASLDSHLDDHA------------
3dahC           PVLSGGAADRIAAS---------------------------------
1d6nA           VKR--------------------------------------------
1dbrA           EKRTDRSNSLKGDFVGFSIE---------------------------
1ao0A           -----------------------------------------------
1dkrA           -----------------------------------------------
3dahB           PVLSGGAADRIAAS---------------------------------
1ecbD           PEIRFPNVYGIDMPSATELIAHGREVDE-------------------
1dkrB           -----------------------------------------------
2c4kA           LS---------------------------------------------
1bfdA           QQTRAMIGVEALLTNVDAANLEPASAAEVP-----------------