[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tmar0:AAD35545.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3drgA.bssp"
#ERROR : Can't open dsspfile "1dppA.bssp"
#ERROR : Can't open dsspfile "1dpeA.bssp"
#ERROR : Can't open dsspfile "3e3kB.bssp"
#ERROR : Can't open dsspfile "3drhA.bssp"
#ERROR : Can't open dsspfile "3dp8A.bssp"
#ERROR : Can't open dsspfile "3dp8C.bssp"
#ERROR : Can't open dsspfile "3dp8B.bssp"
#ERROR : Can't open dsspfile "3drjA.bssp"
#ERROR : Can't open dsspfile "3drfA.bssp"
#ERROR : Can't open dsspfile "1b0hA.bssp"
#ERROR : Can't open dsspfile "1b52A.bssp"
#ERROR : Can't open dsspfile "2d5wA.bssp"
#ERROR : Can't open dsspfile "1al0F.bssp"
#ERROR : Can't open dsspfile "3c18B.bssp"
#ERROR : Can't open dsspfile "3c18A.bssp"
#ERROR : Can't open dsspfile "2cyzA.bssp"
#ERROR : Can't open dsspfile "2cz1A.bssp"
#ERROR : Can't open dsspfile "2ahjC.bssp"
#ERROR : Can't open dsspfile "2ahjA.bssp"
#ERROR : Can't open dsspfile "3btpA.bssp"
#ERROR : Can't open dsspfile "2cz0A.bssp"
#ERROR : Can't open dsspfile "2bpa1.bssp"
#ERROR : Can't open dsspfile "2d05A.bssp"

## Summary of PDB Search
:614
    7e-72  13%  3drgA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
    2e-71  23%  1dppA  [c.94.1] DIPEPTIDE BINDING PROTEIN
    2e-71  23%  1dpeA  [x.x.x] DIPEPTIDE-BINDING PROTEIN
    8e-71  22%  3e3kB  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    5e-70  13%  3drhA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
    1e-69  22%  3dp8A  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    5e-69  22%  3dp8C  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    5e-69  22%  3dp8B  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    4e-68  13%  3drjA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
    4e-68  14%  3drfA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
    3e-67  21%  1b0hA  [c.94.1] PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
    3e-66  21%  1b52A  [c.94.1] PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
    2e-57  15%  2d5wA  [x.x.x] PEPTIDE ABC TRANSPORTER, PEPTIDE-BINDING PROTEIN
    8e-20   8%  1al0F  [b.121.5] CAPSID PROTEIN GPF
    8e-17  13%  3c18B  [x.x.x] NUCLEOTIDYLTRANSFERASE-LIKE PROTEIN
    2e-16  14%  3c18A  [x.x.x] NUCLEOTIDYLTRANSFERASE-LIKE PROTEIN
    7e-14  10%  2cyzA  [x.x.x] NITRILE HYDRATASE SUBUNIT ALPHA
    9e-12   9%  2cz1A  [x.x.x] NITRILE HYDRATASE SUBUNIT ALPHA
    1e-10   9%  2ahjC  [d.149.1] NITRILE HYDRATASE
    4e-10   9%  2ahjA  [d.149.1] NITRILE HYDRATASE
    5e-10   7%  3btpA  [x.x.x] SINGLE-STRAND DNA-BINDING PROTEIN
    4e-07  11%  2cz0A  [x.x.x] NITRILE HYDRATASE SUBUNIT ALPHA
    8e-07   7%  2bpa1  [b.121.5] PROTEIN (SUBUNIT OF BACTERIOPHAGE PHIX174)
    8e-05  11%  2d05A  [x.x.x] CHITOSANASE
:614

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxEVKNPDTIIDATIGEPDTLDPHFAYDTASGEVIYNVYENLIAYKGESLTEFE
3drgA           ------------------KAIKGGNLKVAYQSDSPMKAQWLDATFATMSGPGGGQDGLFFT--DSGFKFI
1dppA           ------------------------TLVYCSEGSPEGFNPQLFTSGTTYDASVPLYNRLVEFKIGTTE-VI
1dpeA           ------------------------TLVYCSEGSPEGFNPQLFISGTTYDASVPLYNRLVEFKIGTTE-VI
3e3kB           ----------------------PDEITTAWPVNVGPLNPHLYTPNQM-FAQSMVYEPLVKYQAD--GSVI
3drhA           ------------------KAIKGGNLKVAYQSDSPMKAQWLSATFATMSGPGGGQDGLFFTDSG--FKFI
3dp8A           ----------------------PDEITTAWPVNVGPLNPHLYTPN-QMFAQSMVYEPLVKYQAD--GSVI
3dp8C           -----------------------DEITTAWPVNVGPLNPHLYTPNQM-FAQSMVYEPLVKYQAD--GSVI
3dp8B           ----------------------PDEITTAWPVNVGPLNPHLYTPNQM-FAQSMVYEPLVKYQAD--GSVI
3drjA           ------------------KAIKGGNLKVAYQSDSPMKAQWLDATFATMSGPGGGQDGLFFTDSG--FKFI
3drfA           ------------------------NLKVAYQSDSPMKAQSNDATFATMSGPGGGQDGLFFT--DSGFKFI
1b0hA           --------------------ADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVE--GHPS
1b52A           --------------------ADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVE--GHPS
2d5wA           -----------------------NSLVIGASQEPRVLAGDFLRQAIKSEIEQYLFAPFIGFTEVPTLENG
1al0F           ----------------------------------------------------------------------
3c18B           ----------------------------------------------------------------------
3c18A           ----------------------------------------------------------------------
2cyzA           ----------------------------------------------------------------------
2cz1A           ----------------------------------------------------------------------
2ahjC           ----------------------------------------------------------------------
2ahjA           ----------------------------------------------------------------------
3btpA           ----------------------------------------------------------------------
2cz0A           ----------------------------------------------------------------------
2bpa1           ----------------------------------------------------------------------
2d05A           ------------------RKAMWETFYNVYIRYSVEQARQRGFTSAVTIGSFVDTALNQGATGGSDTLQG


                         .         .         *         .         .         .         .:140
query           PRLAERWEILDDGKTYKFYIRKGVKFHEGGDLTPEDVEYSFERGLIFDPTAGPMWMLWEALFGVDSLETF
3drgA           KGGAADVALDKESKTATITLRKDLKWSDGSEVTAKDYEFTYETIANPAYGSDRWTDSLANIVGLSDYHTG
1dppA           PGLAEKWEVSEDGKTYTFHLRKGVKWHDNKEFKPTRELNADDV--------------------VFSFDRQ
1dpeA           PGLAEKWEVSEDGKTYTFHLRKGVKWHDNKEFKPTRELNADDV--------------------VFSFDRQ
3e3kB           PWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENFRA--------------------------V
3drhA           KGGAADVALDKESKTATITLRKDLKWSDGSEVTAKDYEFTYETIANPAYGSDRWTDSLANIVG-------
3dp8A           PWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENFRA--------------------------V
3dp8C           PWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENFRA--VLDNRQRHAWLE-------------
3dp8B           PWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENFRA--VLDNRQRHAW---------------
3drjA           KGGAADVALDKESKTATITLRKDLKWSDGSEVTAKDYEFTYETIANPAYGSDRWTDSLANIVG-------
3drfA           KGGAADVALDKESKTATITLRKDLKWSDGSEVTAKDYEFTYETIANPAYGSDRWTDSLANIVGL------
1b0hA           PGVAEKWEN-KDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQR--LADPNTASPYASYLQYGHIANIDDI
1b52A           PGVAEKWEN-KDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQR--LADPNTASPYASYLQYGHIANIDDI
2d5wA           RLRVTDIGGGKKRLEMDITIRPDAKWSDGRPITTEDVAFYFEV--GKAKGMPVLNPDFWERVNVRIKARN
1al0F           ----------------------------------------------------------------------
3c18B           ----------------------------------------------------------------------
3c18A           ----------------------------------------------------------------------
2cyzA           ----------------------------------------------------------------------
2cz1A           ----------------------------------------------------------------------
2ahjC           ----------------------------------------------------------------------
2ahjA           ----------------------------------------------------------------------
3btpA           ----------------------------------------------------------------------
2cz0A           ----------------------------------------------------------------------
2bpa1           ----------------------------------------------------------------------
2d05A           L-LARSGSSSNEKTFMKNFHAKRTLVVDTKPPNGKNRVKQWDT---------------------------


                         +         .         .         .         .         *         .:210
query           VEEKIGKPYSELFDENGEPLPEYRDALIKIYTDYIDPAIEVEGDAVVFHLVRPFAPFMYILAQSASWSAV
3drgA           -----KAKTISGITF------------PDGENGK----------VIKVQFKEMKPGMTQSGNG--YFLET
1dppA           KNAQNPYHKVSGG--------SYEYFEGMGLPELISEVKKVDDNTVQFVLTRPEAPFLADLAM--DFASI
1dpeA           KNAQNPYHKVSGGS--------YEYFEGMGLPELISEVKKVDDNTVQFVLTRPEAPFLADLAMD--FASI
3e3kB           LDNRQRHAWLELAN-------------------QIVDVKALSKTELQITLKSAYYPFLQELA--LPRPFR
3drhA           --------------------LSDYHTGKAKTISGITFPDGENGKVIKVQFKEMKPGMTQSGNG--YFLET
3dp8A           LDNRQRHAWLELAN-------------------QIVDVKALSKTELQITLKSAYYPFLQELALP--RPFR
3dp8C           ------------------------------LANQIVDVKALSKTELQITLKSAYYPFLQELALP--RPFR
3dp8B           ----------------------------LELANQIVDVKALSKTELQITLKSAYYPFLQELA--LPRPFR
3drjA           --------------------LSDYHTGKAKTISGITFPDGENGKVIKVQFKEMKPGMTQSGNGY-FLETV
3drfA           --SDYHTGKAKTI-------------------SGITFPDGENGKVIKVQFKEMKPGMTQSGNGYFLETVA
1b0hA           IAGKKPAT--------------------------DLGVKALDDHTFEVTLSEPVPYFYKLLVHP--SVSP
1b52A           IAGKKPAT---------------------------DLGVKALDDHFEVTLSEPVPYFYKLLVHP--SVSP
2d5wA           FTLIFEPAYYYDTYGPINTYA------PKHIMGP----------EWERVKAAARGLDPDKDAEKLN----
1al0F           ----------------------------------------------------------------------
3c18B           ------------------------QATRTIYSEYETQGIIAVEKRPRDSLTDQFDVLLLVITRDP-SVEW
3c18A           ------------------------QATRTIYSEYETQGIIAVEKRPRDSLTDQFDVLLLVITRDP-SVEW
2cyzA           ----------------------------------------------------------------------
2cz1A           ----------------------------------------------------------------------
2ahjC           ----------------------------------------------------------------------
2ahjA           ----------------------------------------------------------------------
3btpA           ----------------------------------------------------------------------
2cz0A           ----------------------------------------------------------------------
2bpa1           ----------------------------------------------------------------------
2d05A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LDKEWCIEIGCWDGRADTWWKYHDIRKEDSPLYARMNGTGPFKFVEWDRAQQKVILERNDNYWREPAKIK
3drgA           VAPYQYLKDVAPKDLASSPK-----------TTTKPLVTGPFKPENVVA-GESIKYVPNPYYWGEKPKLN
1dppA           LSKEYADAMMKAGTPEKLDLN--------------PIGTGPFQLQQYQK-DSRIRYKAFDGYWGTKPQID
1dpeA           LSKEY--------------ADAMMKAGTPEKLDLNPIGTGPFQLQQYQK-DSRIRYKAFDGYWGTKPQID
3e3kB           FIAPSQFKNH-----------------ETMNGIKAPIGTGPWILQESKL-NQYDVFVRNENYWGEKPAIK
3drhA           VAPYQYLKDVAPKDLASSPKTTTK-----------PLVTGPFKPENVVA-GESIKYVPNPYYWGEKPKLN
3dp8A           FIAPS----------QFKNHETMNGIKA-------PIGTGPWILQESKL-NQYDVFVRNENYWGEKPAIK
3dp8C           FIAPS----------QFKNHETMNGIKA-------PIGTGPWILQESKL-NQYDVFVRNENYWGEKPAIK
3dp8B           FIAPS----------QFKNHETMNGIKA-------PIGTGPWILQESKL-NQYDVFVRNENYWGEKPAIK
3drjA           APYQYLKDV--APKDLASSPKTTT----------KPLVTGPFKPENVVA-GESIKYVPNPYYWGEKPKLN
3drfA           PYQ---YLKDVAPKDLASSPKTTT----------KPLVTGPFKPENVVA-GESIKYVPNPYYWGEKPKLN
1b0hA           VPKSA------VEKFGDKWT-----------QPANIVTNGAYKLKNWVV-NERIVLERNPQYWNAKTVIN
1b52A           VPKSA------VEKFGDKWT-----------QPANIVTNGAYKLKNWVV-NERIVLERNPQYWNAKTVIN
2d5wA           ---------------ELYRNFFLKFATPQALNRGAMVYSGPFKLKRWVP-GNSIEMERNPNFPGESKYVQ
1al0F           --------------------------------AERMPDLSHLGFLAGQIGRL-ITISTTPVIAGDSFEMD
3c18B           TVKHYRLNTLRVSLHLVHEQVLSR----------WLILNANRRAVHWVS-EGTIIFERNDYLTDLKKQLR
3c18A           TVKHYRLNTLRVSLHLVHEQV----------LSRWLILNANRRAVHWV-SEGTIIFERNDYLTDLKKQLR
2cyzA           ----------------------------------------------------------------------
2cz1A           ----------------------------------------------------------------------
2ahjC           ----------------------------------------------------------------------
2ahjA           ----------------------------------------------------------------------
3btpA           ----------------------------------------------------------------------
2cz0A           ----------------------------------------------------------------------
2bpa1           -----------------------------------------------GQIGRLITISTTPVIAGDSFEMD
2d05A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RVIIWGIDEWSTRRAMFLQGDADICAVPTQYLEQVEGKPGVTVVKGLPELAVTSLHFAWNVPEDSKYIGS
3drgA           SITYEVVSTAKSVAALSSSKYDIINGMVSSQYKQVKNLKGYKVLGQ-QAMYISLMYYNLGHYDAKNSINV
1dppA           TLVFSITPDASVRYAKLQKNECQVPYPNPADIARMKQDKSINLMEM-PGLNVGYLSYNVQK---------
1dpeA           TLVFSITPDASVRYAKLQKNECQVMPYPNADIARMKQDKSINLMEM-PGLNVGYLSYNVQKK--------
3e3kB           KITFNVIPDPTTRAVAFETGDIDLGLLPLDTFARFSQNPAYHTQLS-QPIETVMLALNTAKA--------
3drhA           SITYEVVSTAKSVAALSSSKYDIINGMVSSQYKQVKNLKGYKVLGQ-QAMYISLMYYNLGHYDAKNSIN-
3dp8A           KITFNVIPDPTTRAVAFETGDIDLLYGNEGLFARFSQNPAYHTQLS-QPIETVMLALNTA----------
3dp8C           KITFNVIPDPTTRAVAFETGDIDLGLLPLDTFARFSQNPAYHTQLS-QPIETVMLALNTAKA--------
3dp8B           KITFNVIPDPTTRAVAFETGDIDLLYGNEGTFARFSQNPAYHTQLS-QPIETVMLALNTAKA--------
3drjA           SITYEVVSTAKSVAALSSSKYDIINGMVSSQYKQVKNLKGYKVLGQ-QAMYISLMYYNLGHYDAKNSINV
3drfA           SITYEVVSTAKSVAALSSSKYDIINGMVSSQYKQVKNLKGYKVLGQ-QAMYISLMYYNLGHYDAKNSINV
1b0hA           QVTYLPISSEVTDVNRYRSGEIDMTYNNIELFQKLKKEIPNEVRVD-PYLCTYYYEINNQKA--------
1b52A           QVTYLPISSEVTDVNRYRSGEIDMTYNPIELFQKLKKEIPNEVRVD-PYLCTYYYEINNQKA--------
2d5wA           KVVYRFIQNTNSLLVAVIGGSIDATSSVSLTFDQGRSPQLVRRAPGRFDIWFVPGAIWEHIDINKFENC-
1al0F           AVGALRLSPLRRGLAIDSTVDIFTFYVPHRH------VYGEQWIK--FMKDGVNATPLPTVN--------
3c18B           NFPELQSLSFAKLLRRFQDGRNLFSRYYDAY---------------------------------------
3c18A           NFPELQSLSFAKLLRRFQDGRNLFSRYYDAY---------------------------------------
2cyzA           ----------------------------------------------------------------------
2cz1A           ----------------------------------------------------------------------
2ahjC           ----------------------------------------------------------------------
2ahjA           ----------------------------------------------------------------------
3btpA           ----------------------------------------------------------------------
2cz0A           ----------------------------------------------------------------------
2bpa1           AVGALRLSPLRRGLAIDSTVDIFTFYVPHR--------------------------HVYGEQWIKFMKDG
2d05A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GKLDGNGIPPDFFSDENVRKAFIYAFDYDTFINEVLKGLGRKIPTDXXXXXXXXXXXXXXDPDAPHFDIV
3drgA           QDRKT------PLQDQNVRQAIGYARNVAEVDNKFSNGLS--TPANSLIPPIFKQFTSSSVKGYEKQDLD
1dppA           ----------KPLDDVKVRQALTYAVNKDAIIKAVYQGAGVSAKN----LIPPTMWGYNDDVQDYTYDPE
1dpeA           -----------PLDDVKVRQALTYAVNKDAIIKAVYQGAGVSAKN----LIPPTMWGYNDDVQDYTYDPE
3e3kB           -----------PTNELAVREALNYAVNKKSLIDNALYGTQQVADT----LFAPSVPYANLGLKPSQYDPQ
3drhA           ---VQDRKTP--LQDQNVRQAIGYARNVAEVDNKFSNGLS--TPANSLIPPIFKQFTSSSVKGYEKQDLD
3dp8A           ---------KAPTNELAVREALNYAVNKKSLIDNALYGTQQVADT----LFAPSVPYANLGLKPSQYDPQ
3dp8C           -----------PTNELAVREALNYAVNKKSLIDNALYGTQQVADT----LFAPSVPYANLGLKPSQYDPQ
3dp8B           -----------PTNELAVREALNYAVNKKSLIDNALYGTQQVADT-----LFAPSVPYANLGLKPQYDPQ
3drjA           QDRKT------PLQDQNVRQAIGYARNVAEVDNKFSNGLS--TPANSLIPPIFKQFTSSSVKGYEKQDLD
3drfA           QDRKT------PLQDQNVRQAIGYARNVAEVDNKFSNGLS--TPANSLIPPIFKQFTSSSVKGYEKQDLD
1b0hA           -----------PFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEFKWSQQKRNE
1b52A           -----------PFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEFKWSQQKRNE
2d5wA           ---QVVKDLG--LNDKRTRQAILHALNREGLVKAFFDGLQPVAHT----WIAPVNPLFNPNVKKYEFDLK
1al0F           -----------TTGYIDHAAFLGTNPDTNKIPKHLFQGYLNIYNN----YFKAPWMPDRTEANPNELNQD
3c18B           ----------------------------------------------------------------------
3c18A           ----------------------------------------------------------------------
2cyzA           ------------APVSDRAWALFRALDGKGLVPDGYVEGWKKTFEEDFSPRRGAELVARAWTDPEFRQLL
2cz1A           ------------APVSDRAWALFRALDGKGLVPDGYVEGWKKTEDFSPRRGAELVARAWTDPEFRQLLLT
2ahjC           -----DHAPA--QAPVSDRWALFRALDGKGLVPDGYVEGWKKTEDFSPRRGAELVARAWTDPEFRQLLLT
2ahjA           ------------PVSDRAW-ALFRALDGKGLVPDGYVEGWKKTEDFSPRRGAELVARAWTDPEFRQLLLT
3btpA           ------------------RRTDEYILVRQTGQDKFAGTTKCFNASCRLYRDGVGNYYPPPLAFERIDLPE
2cz0A           ------------APVSDRAWALFRALDGKGLVPDGYVEGWKKTEDFSPRRGAELVARAWTDPEFRQLLLT
2bpa1           VNATPLPTVNTTGYIDHAAFLGTINPDTNKIPKHLFQGYL----NIYNNYFKAPWMPDRTEANPNELNQD
2d05A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KATEYFKKAWNGEVWKKGFKITLLYNTGNEVRRQAAEMLKAYIEMINPKFKVEVRGVQWPTYLDATKRGE
3drgA           KANKLLDEDGYREKDGKELSLVYAARVGDANAETIAQNYIQQWKKIG--VKVSLYNGKLMEFNSWVDHMT
1dppA           KAKALLKEAGLEKGFSIDLWAMPVQRPYNPNARRMAEMIQADWAKVG--VQAKIVTYEWGEYLKRAKDGE
1dpeA           KAKALLKEAGLEKGFSIDLWAMPVQRPYNPNARRMAEMIQADWAKVGVQ--AKIVTYEWGEYLKRAKDGE
3e3kB           KAKALLEKAGWTLPAGKDLRIELSFIGTDALSKSMAEIIQADMRQIGAD--VSLIGEEESSIYARQRDGR
3drhA           KANKLLDEDGWKLNKSKELSLVYAARVGDANAETIAQNYIQQWKKIG--VKVSLYNGKLMEFNSWVDHMT
3dp8A           KAKALLEKAGWTLPAGQPLRIELSFIGTDALSKSMAEIIQADMRQIGAD--VSLIGEEESSIYARQRDGR
3dp8C           KAKALLEKAGWTLPAGKDLRIELSFIGTDALSKSMAEIIQADMRQIGAD--VSLIGEEESSIYARQRDGR
3dp8B           KAKALLEKAGWTLPAGKDLRIELSFIGTDALSKSMAEIIQADMRQIGAD--VSLIGEEESSIYARQRDGR
3drjA           KANKLLDEDGYREKDGKELSLVYAARVGDANAETIAQNYIQQWKKIG--VKVSLYNGKLMEFNSWVDHMT
3drfA           KANKLLDEDGYREKDGKELSLVYAARVGDANAETIAQNYIQQWKKIG--VKVSLYNGKLMEFNSWVDHMT
1b0hA           EAKKLLAEA--GFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVN--VNLENQEWKTFLDTRHQGT
1b52A           EAKKLLAEAG----FTAPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVN--VNLENQEWKTFLDTRHQGT
2d5wA           KAEALLAEMRTVNGRTVRFEIEYVTTAGNVVRERTQQFFAEDLKKIG--IAVKINNAPSAVVFADEFIQR
1al0F           DARYGFRCC--HLKNIWTAPLPPETELSRQMTTSTTSIDIMGLQAA--YANLHTDQERDYFMQRYRDVIS
3c18B           ----------------------------------------------------------------------
3c18A           ----------------------------------------------------------------------
2cyzA           LTDGTAAVAQYGYLGPQGEYIVAVEDTPTLKNVIVCSLSTAWPI--LGLPPTWYKSFEYRARVVREPRKV
2cz1A           DGTAAVAQY--GYLGPQG-EYIVAVEDTPTLKNVIVCSLSTAWPIL--GLPPTWYKSFEYRRVVREPRKV
2ahjC           DGTAAVAQYGYLG---PQGEYIVAVEDTPTLKNVIVCSLSTAWPILGLP-PTWYKSFEYRARVVREPRKV
2ahjA           DGTAAVAQY--GYLGPQGEYIVAVEDT-PTLKNVIVCSLSTAWPILGLP-PTWYKSFEYRARVVREPRK-
3btpA           QLAAQLLEPREQSKQCFQYKLEVWNRAHAEMGITGTDIFYQTDKNIK--LDRNYKLRPEDRYIQTEKYG-
2cz0A           DGTAAVAQY--GYLGPQGEYIVAVEDT-PTLKNVIVCSLSTAWPIL-GLPPTWYKSFEYRARVVREPRKV
2bpa1           DARYGFRCCHLKNIWTAPLPPETERQMTTSTTSIDIMGLQAAYANLHTDQEMQRYRDVISSFGGKTSYDA
2d05A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           VPAFIIGWLADYPDPHNFIFTYYHSAGVYSGRQGENFRKFVSTPHPDLGGRSLDELIEEAIAKTDPAERQ
3drgA           TPPGANDWDITDGSWSLASEPSQQDLFSA---AAPYNFGHFNDSE-------ITKDLNDIDSAENPTYRK
1dppA           HQTVMMGWTGDNGDPDNFFATLFSCAA---SEQGSNYSKWCYK--------PFEDLIQPARATDDHNKRV
1dpeA           HQTVMMGWTGDNGDPDNFFATEFSCAASEQGSNYSKWCYK-----------PFEDLIQPARATDDHNKRV
3e3kB           FGMIFHRTWGAPYDPHAFLSSMRVPSHADFQAQQGLADKPL-----------IDKEIGEVLATHDETQRQ
3drhA           TPPGANDWDITDGSWSLASEPSQQDLFSA---AAPYNFGHFNDSE-------ITKDLNDIDSAENPTYRK
3dp8A           FGMIFHRTWGAPYDPHAFLSSMRVPSHADFQAQQGLADKPL-----------IDKEIGEVLATHDETQRQ
3dp8C           FGMIFHRTWGAPYDPHAFLSSMRVPSHADFQAQQGLADKPL-----------IDKEIGEVLATHDETQRQ
3dp8B           FGMIFHRTWGAPYDPHAFLSSMRVPSHADFQAQQGLADKP-----------LIDKEIGEVLATHDETQRQ
3drjA           TPPGANDWDITDGSWSLASEPSQQDL---FSAAAPYNFGHFNDSE-------ITKDLNDIDSAENPTYRK
3drfA           TPPGANDWDITDGSWSLASEPSQQDL--FSAAAPYNFGHFNDSE--------ITKDLNDIDSAENPTYRK
1b0hA           FDVARAGWCADYNEPTSFLNTMLSDSS--------NNTAHYKSPA-------FDKLIADTLKVADDTQRS
1b52A           FDVARAGWCADYNEPTSFLNTMLSDSS--------NNTAHYKSPA-------FDKLIADTLKVADDTQRS
2d5wA           ASEFEFAWVSNLQEDGSLFQYKNLNTGAIMVPTKENNYQGQNIGGWRND--EFDRLTSQAVLEFDPERRK
1al0F           SFGGKTSY-----DADNRPLLVMRSNLWASGYDVDGT----------------DQTSLGQFSGRVQQTYK
3c18B           ----------------------------------------------------------------------
3c18A           ----------------------------------------------------------------------
2cyzA           LSEMGTEIASD-IEIRVYDTTAETRYMVLPQR-PAGTEGWSQ---EQ-----LQEIVTKDCLIGVAIPQV
2cz1A           LSEMGTEIASDI-EIRVYDTTAETRYMVLPQR-PAGTEGWSQE--------QLQEIVTKDLIGVAIPQ--
2ahjC           LSEMGTIEIRVYDTTAETRYMVLPQR-------PAGTEGWSQE--------QLQEIVTKDIGVAIP----
2ahjA           ---VLSEMGTEIASDIEI----------------------------------------------------
3btpA           -RREIQKRYEHQFQAGSLLPDILIKTPQNDIHFSYRFAGDAYANKRF--------EEFERAIKTKYGSDT
2cz0A           LSEMGTEI-ASDIEIRVYDTTAETRYMVLPQR-PAGTEGW-SQEQ-------LQEIVTKDLIGVAIPQVP
2bpa1           DNRPLLNLWASGYDVDGTDQTSL-----------------------------------------------
2d05A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           ALYEEIQRFAMKHALGMPLYQPLGVRVQRSWVKGWYHNPMRPGDDYYVLWKAEE
3drgA           AAFVKYQEDMNKKAYVIPTNFMLNYTPVNKRVVGMTLDYGAMNTWSEIGVSSAK
1dppA           ELYKQAQVVMHDQAPALIIAHSTVFEPVRKEVKGYVVDPLGKHHFENVSIE---
1dpeA           ELYKQAQVVMHDQAPALIIAHSTVFEPVRKEVKGYVVDPLGKHHFENVSIE---
3e3kB           ALYRDILTRLHDEAVYLPISYISMMVVSKPELGNIPYAPIATEIPFEQIKPVK-
3drhA           AAFVKYQEDMNKKAYVIPTNFMLNYTPVNKRVVGMTLDYGAMNTWSEIGVSS--
3dp8A           ALYRDILTRLHDEAVYLPISYISMMVVSKPELGNIPYAPIATEIPF--------
3dp8C           ALYRDILTRLHDEAVYLPISYISMMVVSKPELGNIPYAPIATEIPF--------
3dp8B           ALYRDILTRLHDEAVYLPISYISMMVVSKPELGNIPYAPIATEIPFEQIKP---
3drjA           AAFVKYQEDMNKKAYVIPTNFMLNYTPVNKRVVGMTLDYGAMNTWSEIGVSS--
3drfA           AAFVKYQEDMNKKAYVIPTNFMLNYTPVNKRVVGMTLDYG-AMNTWSEIG----
1b0hA           ELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIK-
1b52A           ELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIK-
2d5wA           QLFWRAQEIWAEELPALPLYFRANPYVVRKGLVNYVASAYSGGYGYP-------
1al0F           HSVPRFFVPEHGTMFTLALRFPPTATKEIQYLNAKGALTYTDIAGDPVLYGN--
3c18B           ------------------------------------------------------
3c18A           ------------------------------------------------------
2cyzA           ------------------------------------------------------
2cz1A           ------------------------------------------------------
2ahjC           ------------------------------------------------------
2ahjA           ------------------------------------------------------
3btpA           EIKLKSKSGIMHDSKYLESWERGSADIRFAEFAGENRAQFPAATVNMGRQP---
2cz0A           T-----------------------------------------------------
2bpa1           ------------------------------------------------------
2d05A           ------------------------------------------------------