[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tmar0:AAD35678.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3delB.bssp"
#ERROR : Can't open dsspfile "2a5sA.bssp"
#ERROR : Can't open dsspfile "2a5tA.bssp"
#ERROR : Can't open dsspfile "3bbrA.bssp"
#ERROR : Can't open dsspfile "3dlnA.bssp"
#ERROR : Can't open dsspfile "3bfuC.bssp"
#ERROR : Can't open dsspfile "3b6wA.bssp"
#ERROR : Can't open dsspfile "2anjA.bssp"
#ERROR : Can't open dsspfile "3e78A.bssp"
#ERROR : Can't open dsspfile "2a5tB.bssp"
#ERROR : Can't open dsspfile "3b6qA.bssp"
#ERROR : Can't open dsspfile "3bfuB.bssp"
#ERROR : Can't open dsspfile "3c31A.bssp"
#ERROR : Can't open dsspfile "2ceyA.bssp"
#ERROR : Can't open dsspfile "2cexB.bssp"
#ERROR : Can't open dsspfile "2de3A.bssp"
#ERROR : Can't open dsspfile "2cexA.bssp"
#ERROR : Can't open dsspfile "2cexC.bssp"
#ERROR : Can't open dsspfile "2cexD.bssp"
#ERROR : Can't open dsspfile "3b50A.bssp"
#ERROR : Can't open dsspfile "1dtzA.bssp"
#ERROR : Can't open dsspfile "2czlA.bssp"
#ERROR : Can't open dsspfile "1ce2A.bssp"
#ERROR : Can't open dsspfile "1b1xA.bssp"
#ERROR : Can't open dsspfile "2dbpA.bssp"
#ERROR : Can't open dsspfile "1bkaA.bssp"
#ERROR : Can't open dsspfile "1blfA.bssp"
#ERROR : Can't open dsspfile "1d4nA.bssp"
#ERROR : Can't open dsspfile "1biyA.bssp"
#ERROR : Can't open dsspfile "2de3B.bssp"
#ERROR : Can't open dsspfile "2b65A.bssp"
#ERROR : Can't open dsspfile "2de2A.bssp"
#ERROR : Can't open dsspfile "3chgA.bssp"
#ERROR : Can't open dsspfile "2b4lA.bssp"
#ERROR : Can't open dsspfile "2b4mA.bssp"
#ERROR : Can't open dsspfile "3chgD.bssp"
#ERROR : Can't open dsspfile "2dvzA.bssp"
#ERROR : Can't open dsspfile "2bjjX.bssp"
#ERROR : Can't open dsspfile "2d3iA.bssp"
#ERROR : Can't open dsspfile "1dotA.bssp"

## Summary of PDB Search
:246
    2e-48  30%  3delB  [x.x.x] ARGININE BINDING PROTEIN
    1e-47  16%  2a5sA  [x.x.x] N-METHYL-D-ASPARTATE RECEPTOR NMDAR2A SUBUNIT
    5e-44  20%  2a5tA  [x.x.x] N-METHYL-D-ASPARTATE RECEPTOR NMDAR1-4A SUBUNIT
    2e-41  23%  3bbrA  [x.x.x] GLUTAMATE RECEPTOR 2
    2e-41  20%  3dlnA  [x.x.x] GLUTAMATE RECEPTOR 3
    4e-41  22%  3bfuC  [x.x.x] GLUTAMATE RECEPTOR 2
    2e-40  22%  3b6wA  [x.x.x] GLUTAMATE RECEPTOR 2
    6e-40  23%  2anjA  [x.x.x] GLUTAMATE RECEPTOR 2
    1e-39   8%  3e78A  [x.x.x] HIGH AFFINITY TRANSPORT SYSTEM PROTEIN P37
    4e-39  18%  2a5tB  [x.x.x] N-METHYL-D-ASPARTATE RECEPTOR NMDAR2A SUBUNIT
    2e-37  22%  3b6qA  [x.x.x] GLUTAMATE RECEPTOR 2
    1e-36  23%  3bfuB  [x.x.x] GLUTAMATE RECEPTOR 2
    1e-34  19%  3c31A  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    2e-32  10%  2ceyA  [x.x.x] PROTEIN HI0146
    8e-32  11%  2cexB  [x.x.x] PROTEIN HI0146
    5e-31  10%  2de3A  [x.x.x] DIBENZOTHIOPHENE DESULFURIZATION ENZYME B
    5e-30  10%  2cexA  [x.x.x] PROTEIN HI0146
    5e-29   9%  2cexC  [x.x.x] PROTEIN HI0146
    5e-29  11%  2cexD  [x.x.x] PROTEIN HI0146
    4e-28  11%  3b50A  [x.x.x] SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
    4e-27   9%  1dtzA  [c.94.1 - c.94.1] APO LACTOFERRIN
    1e-25  14%  2czlA  [x.x.x] HYPOTHETICAL PROTEIN TTHA1568
    4e-23  11%  1ce2A  [c.94.1 - c.94.1] PROTEIN (LACTOFERRIN)
    5e-23   9%  1b1xA  [c.94.1 - c.94.1] LACTOFERRIN
    4e-22  13%  2dbpA  [x.x.x] TTHA1568
    2e-21  12%  1bkaA  [x.x.x] LACTOFERRIN
    2e-21   9%  1blfA  [x.x.x] LACTOFERRIN
    5e-20   8%  1d4nA  [c.94.1] TRANSFERRIN
    6e-20  10%  1biyA  [x.x.x] LACTOFERRIN
    1e-17  10%  2de3B  [x.x.x] DIBENZOTHIOPHENE DESULFURIZATION ENZYME B
    2e-17   9%  2b65A  [x.x.x] LACTOTRANSFERRIN
    2e-15  10%  2de2A  [x.x.x] DIBENZOTHIOPHENE DESULFURIZATION ENZYME B
    5e-15  12%  3chgA  [x.x.x] GLYCINE BETAINE-BINDING PROTEIN
    1e-13  10%  2b4lA  [x.x.x] GLYCINE BETAINE-BINDING PROTEIN
    4e-13  12%  2b4mA  [x.x.x] GLYCINE BETAINE-BINDING PROTEIN
    9e-13  12%  3chgD  [x.x.x] GLYCINE BETAINE-BINDING PROTEIN
    6e-10  15%  2dvzA  [x.x.x] PUTATIVE EXPORTED PROTEIN
    4e-09  13%  2bjjX  [x.x.x] LACTOTRANSFERRIN
    1e-04  20%  2d3iA  [x.x.x] OVOTRANSFERRIN
    7e-04  15%  1dotA  [x.x.x] DUCK OVOTRANSFERRIN
:246

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxGAIDEIKSRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKEIARRLGVELK
3delB           -----------------------------FIVGTNATYPPFEFVDKRGEVVGFDIDLAREISNKLGKTLD
2a5sA           ---------------------TCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYD
2a5tA           ------------------VYVKPTMSDGTCKEEFTVNGDPVKPNTVPQCCYGFCIDLLIKLARTMNFTYE
3bbrA           ---------------------------KTVVVTTILESPNHEMLEGNERYEGYCVDLAAEIAKHCGFKYK
3dlnA           -----------------------------IVVTTILESPYVMYKEGNERYEGYCVDLAYEIAKHVRIKYK
3bfuC           -------------------------ANKTVVVTTILESPNHEMLEGNERYEGYCVDLAAEIAKHCGFKYK
3b6wA           -------------------------------------KKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYK
2anjA           -------------------------ANKTVVVTTILESPNHEMLEGNERYEGYCVDLAAEIAKHCGFKYK
3e78A           -------------------LNNLSTDNPELDFGINASGKLVEFLKNNPGIITPALETTTNSFVFDKEKDK
2a5tB           ---------------------TCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYD
3b6qA           -----------------------------VVVTTILESPNHEMLEGNERYEGYCVDLAAEIAKHCGFKYK
3bfuB           -------------------------------------KKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYK
3c31A           -----------------------------------ILEEPYVMYRKNDRFEGYCLDLLKELSNILGFLYD
2ceyA           ------------------AKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYP
2cexB           ------------------AKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYP
2de3A           ----------------------------------------------SPVPNALLTASESGFLDAAGIELD
2cexA           ------------------AKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYP
2cexC           ------------------AEMFAKEVKEKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYP
2cexD           ----------------------KEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYP
3b50A           ----------------------KEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYP
1dtzA           ----------------------------------------------SPAESKKCAQWQRRMKKVRGPSVT
2czlA           -----------------------------------------------GFSPPNDTFIFYALVHESPVPLE
1ce2A           ------------------------------------EVQARRARVVWCAVGPEEQKKCQQWSQQSGQIVT
1b1xA           ----------------------------------------------SPAEAAKCAKFQRNMKKVRGPSVS
2dbpA           ----------------------------------------------CPNDTFIFYALVHGRVE-SPVPLE
1bkaA           ----------------------------------------------WCAVGEQELRKCNQWSGLSEGSVT
1blfA           -----------------------------------------------QPEWFKCRRWQWRMKKLGAPSIT
1d4nA           --------------------------------------------EHEATKCQSFRDHMKSVIPSDGPSVA
1biyA           ----------------------------------------------SQPEWLKCHRWQWRMKKLGAPSIT
2de3B           ----------------------------------------------SPVPNALLTASESGFLDAAGIELD
2b65A           -----------------------------------------------CAVGPEEQKKCQQWSQQSGQNVT
2de2A           ----------------------------------------------CPVPNALLTASESGFLDAAGIELD
3chgA           ------------------------------------KGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVT
2b4lA           ----------------------------------------------------------------------
2b4mA           -------------------------------------GDKINLAYVAWDSEIASTNVIGKVLEDLGYEVT
3chgD           -------------------------------------GDKINLAYVAWDSEIASTNVIGKVLEDLGYEVT
2dvzA           ----------------------------------------------------------------------
2bjjX           ------------------------------------------------------FQWQRNMRRVRGPPVS
2d3iA           -------------------------------------------------------------SVVSNGDVE
1dotA           -----------------------------------------------------------RWSVVSNGEVE


                         .         .         *         .         .         .         .:140
query           IVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGQVIVVRKDSDFRPKTYEDLVGKTVA
3delB           VREFSFDALILNLKQHRIDAVITGMSITPSRLKEILMIPYYGEEIKHLVLVFK-GENKHPLPLTQYRSVA
2a5sA           LVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRGTKKFQRPHDYSPPFRFG
2a5tA           VVKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDK
3bbrA           LDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIESAEDLGSTKEFFR
3dlnA           LSIKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPESAEDLAKQTEIAYG
3bfuC           LDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTIESAEDLSKQTEIAYG
3b6wA           LTIKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIESAEDLGSTKEFFR
2anjA           LTIKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIESAEDLSKQTEIAR
3e78A           FYVDGTDSDPWTDENHKWNGNVYQSVYDPTVQANFYRGMIWIKGNDETLAKIKKAWNDKDWNTFRNFGIL
2a5tB           LVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSLSDKKFQRPHDYSPPFRFG
3b6qA           LDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTIESAEDLSKQTEIAYG
3bfuB           LDTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIESAEDLGSTKEFFR
3c31A           VDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGT--PIDSADDLAKQTKI
2ceyA           EAAVFALPYVISNYNVAQKALFFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAI--NSIADMKGLKLR
2cexB           EAALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTS--NRAINSIADMKGLKLR
2de3A           VLSGQGTVHFTYDQPAYTRFGGEIPPLLRAPGRTRLLGITPLLGRQGFFVRDD--SPITAAADLAGRRIG
2cexA           EAAVFALPYVISNYNVAQKALEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAI--NSIADMKGLKLR
2cexC           EAAVFALPYVISNYNVAQKALFDGKDLIKKMDKDLGVTLLSQAYNGTRQTTS--NRAINSIADMKGLKLR
2cexD           EAAVFALPYVISNYNVAQKALFFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAI--NSIADMKGLKLR
3b50A           VFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAI--NSIADMKGLKLR
1dtzA           CVKKTRFECIQAISTEKADAVTLDGGLVYDAGLVYGTENQPQTHYYAVAIAKKGTN--FQLNQLQGLKSC
2czlA           PVLEDVETLNRWALEGRLPLTKLSYAAYAQVRDRYVALRSGGALGRGVGPLVVAR---GPLQALEGLRVA
1ce2A           CATSTTDDCIALVLKGEADALSLDGGYSSKHSSLDCVLRPTEGYLAVAVVKKANEG--LTWNSLKGKKSC
1b1xA           CIRKTSFECIQAIAANKADAVTLDGGLVYEAGLVYQTRGKPQTRYYAVAVVKKGSG--FQLNQLQGVKSC
2dbpA           PVLEDVETLNRWALEGRLPLTKLSYAAYRDRYVALRSGGALGRGVGPLV------VARGPLQALEGLRVA
1bkaA           CSSSTTEDCIALVLKGEADAMSLDGGYVSSDPDPNCVDRPVEGYLAVAVVRRSDTS--LTWNSVKGKKSC
1blfA           CVRRAALECIRAIAEKKADAVTLDGGMVFEAGRIYGTKESPQTHYYAVAVVKKGSN--FQLDQLQGRKSC
1d4nA           CVKKAYLDCIRAIAANEADAVTLDAGLVYDAYEFYGSKEDPQTFYYAVAVVKKDSG--FQMNQLRGKKSC
1biyA           CVRRAVLECIRAITEKKADAVTLDGGMVFEAGLIYGTKESPQTHYYAVAVVKKGSN--FQLDQLQGRNSC
2de3B           VLSGQGTVHFTYDQPAYTRFGGEIPPLLRAPGRTRLLGITPLLGRQGFFVRDDSPI--TAAADLAGRRIG
2b65A           CATASTDDCIVLVLKGEADALLAENRKSSKHSSLDCVLRPTEGYLAVAVVKKANEG--LTWNSLKDKKSC
2de2A           VLSGQGTVHFTYDQPAYTRFGGEIPPLLRAPGRTRLLGITPLLGRQGFFVRDDSPI--TAAADLAGRRIG
3chgA           LTQVEAGPMWTAIATGSADASLSAWLPNTHKAKYDDIGTSMTGVKMGLVVPQYMK-NVNSIEDL------
2b4lA           ----------------------------------------------------------SAAEQVNKTIIG
2b4mA           LTQVEAGPMWTAIATGSADASLSAWLPNTHKAKYDDIGTSMTGVKMGLVVPQYMK-NVNSIEDL------
3chgD           LTQVEAGPMWTAIATGSADASLSAWLPNTHKAKYDDIGTSMTGVKMGLVVPQYMK-NVNSIEDL------
2dvzA           ----------------------------------------FANTANVVAVNPKFPAKKGFLEELKKNPGK
2bjjX           CIKRDPIQCIQAIAENRADAVTLDGGFIYEAGLVYGTERQPRTHYYAVAVVKKGG--SFQLNELQGLKSC
2d3iA           CTVVDTKDCIIKIMKGEADAVAGLVYTAGVCGLVPVMAERYDDESQVAVARKDSNV---NWNNLKGKKSC
1dotA           CTILDNKDCIVKITKGEADAISLDGGFVYTAGVCSKDEEQPAYYFAVAVVKKSS---AITWNNLQGKKSC


                         +         .         .         .         .         *         .:210
query           VQIGTTGDIEVSKYDGIKVVRFDKFTDAFLELKRGRADAVVLDSATARAFVAKNPDLVISSGVLSSEQYG
3delB           VQTGTYQEAYLQSLSEVHIRSFDSTLEVLMEVMHGKSPVAVLEPSIAQVVLKDFPALIDLPEDQWVLGYG
2a5sA           TVPNGSTERNIRNNQYMTRFNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCTIGSGYIFATTGY
2a5tA           FIYATVKQSSVTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFG
3bbrA           RSKIAVFDKMWTYRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKDTMKVGGNLDSKGYG
3dlnA           TLDSGSTKEFFYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKDTMKVGGNLDSKGYG
3bfuC           TLDSGSTKEFFRRSKIEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKDTMKVGGNLDSKGYG
3b6wA           RSKIAVFDKMWTYRSAEPSVFVRTSAEGVARVRKSKGKYAYLLESTMNEYIEQRKDTMKVGGNLDSKGYG
2anjA           SKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKDTMKVGGNLDSKGYG
3e78A           HGKDNSSSKFKLEENEDRSAHPNAYKQKSADTLGTLDDFHIAFSEEGSFAWTHNKSATKPIVTNPIPYDV
2a5tB           TVPNGSTERNIRNNQYMTRFNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEKLVTIGYIFATTGYG
3b6qA           TLDSGSTKEFFRRSSAEPSVFVRTAAEGVARVRKSKGKYAYLLESTMNEYIEQRKDTMKVGGNLDSKGYG
3bfuB           RSKIAVFDKMWTYRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKDTMKVGGNLDSKGYG
3c31A           EYGAVRDGSTMKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESNLTQIGGLIDSKGYG
2ceyA           VPNAATNLAYAKYVGASPT--PMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKLAMTNHILNDQLY
2cexB           VPNAATNLAYAKY--VGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKLAMTNHILNDQLY
2de3A           VSASAIRILRGQLGDPWRQTLVALGSWEARALLHTLEHGELGVDDVELVPISSPGVDVPAEQLDVARGQA
2cexA           VPNAATNLAYAKY--VGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQL
2cexC           VPNAATNLAYAKYVG--ASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLATNHILNDQLY
2cexD           VPNAATNLAYAKYVG--ASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKLAMTNHILNDQLY
3b50A           VPNAATNLAYAKYVG--ASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVKFLAMTNHILNDQLY
1dtzA           HTGLGRSPMGLLRPFLDWTGPPEPLQKAVAKFFSASCVPCVDGKEYPNLCQLCAGTKCACSSQEPYFGYS
2czlA           VPGRHTTAYFLLSLYAGFVPVEVRYDRILPMVAQGEVEAGLIIHESRFTYPRYGLVQVVDLGAWWEERTG
1ce2A           HTAVDRTAGWNIPMGLIACAPGADPKSRLCALCAGDDQGLDKCVPNSKEKYYGYTGAF------------
1b1xA           HTGLGRSAIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYS
2dbpA           VPGRHTTAYFLLSLYAGFVPVEVRYDRILPMVAQGEVEAGLIIHESRFTYPRYGLVQVVDLGAWWEERTG
1bkaA           HTAVDRGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNSNERYYGYTGAFR---CLAENAGD
1blfA           HTGLGRSAGWIIPMGLSWTESLEPLQGAVAKFFSASCVPCIDRQAYPNLCQLCKGEQCACSSREPYFGYS
1d4nA           HTGLGRSAGWNIPIGCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLQYFGYSGAF
1biyA           HTLGRSAGWNIPMGYLSWTESLEPLQGAVAKFFSASCVPCVDRQAYPNLCQLCKGEGENQCACSPREPYS
2de3B           VSASAIRILRGQLGDPWRQTLVALGSWEARALLHTLEHGELGVDD-------------------------
2b65A           HTAVDRTAGAFDEFFSQSCAPGADPKSRLCALCAGDDQGLDKCVPNSKEKYYGYTGAFRCLAEDVGDVAF
2de2A           VSASAIRILRGQLGDYLELDPWRQTLVALGSWEARALLHTLEH---------------------------
3chgA           ----------------------------------------------------------------------
2b4lA           IDPGSGIMSDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLKYLDDPKQSGSAEEIH
2b4mA           ----------------------------------------------------------------------
3chgD           ----------------------------------------------------------------------
2dvzA           YSYGSSGTGESFKATGTDIVPYKGSGPAVADAVGGQIELIFDNLPSSPQIQAGKLRAAIAWVLNQPVWYG
2bjjX           HTGRTAGPIEAAVARSCVPGADKGQFPNLCRLCAGTGENKCAFSSQEKCLRDGAGDVAFIRESTVFEDLS
2d3iA           ----------------------------------------------------------------------
1dotA           HTVGRTAGWNINKTGSCDFDDYFSEGSRLCKLCQGSGENLL-----------------------------


                         .         .         .         +         .         .         .:280
query           IAVRKEDTDLLEFINSVLRELKKSPYDVLIEKWFSE
3delB           IGVASDRPALALKIEAAVQEIRKEGLAELEQKWG--
2a5sA           GIALQKGSPWKRQIDLALLQFVGDGMEELETLWLTG
2a5tA           IGMRK-DSPWKQNVSLSILKSHENGMEDLDKTWV--
3bbrA           IATPKGS-SLGNAVNLAVLKLSEQGLDKLKNKWWYE
3dlnA           VATPKGSALGTPVNLAVLKLSEQGILDKLKNKWWYD
3bfuC           IATPKGSSLGNAVNLAVLKLNEQGLLDKLKNKWWYD
3b6wA           IATPKGSSLGNAVNLAVLKLNEQGLLDKLKNKWWYD
2anjA           IATPK-GSSLGNAVNLAVLKLNEQGLDKLKNKWWYD
3e78A           GVFRKSNQLEQNLIVQTFINLAKNK-QDTYGPLL--
2a5tB           IALQK-GSPWKRQIDLALLQFVGDGMEELETLWL--
3b6qA           IATPKGSSLGNAVNLAVLKLNEQGLLDKLKNKWWYD
3bfuB           IATPK-GSSLGNAVNLAVLKLNEQGLDKLKNKWWYD
3c31A           VGTPI-GSPYRDKITIAILQLQEEGLHMMKEKWW--
2ceyA           LVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDG
2cexB           LVSNETYKELPEDLQKVVKDAAENAKYHTKLFVDGE
2de3A           AVLASGDVDALYSWLPWAGELQATGRPVVDLGLD--
2cexA           YLVSNETYKELPEDLQKVVKDAAENAKYHTKLFV--
2cexC           LVSKELPEDLQKVVKDAAENAAKYHGEKDLVTFF--
2cexD           LVSNETYKELPEDLQKVVKDAAENAAKYHTKLFV--
3b50A           LVSNETYKELPEDLQKVVKDAAENAAKYHTKLFV--
1dtzA           GAFKCLQDGAGDVAFVKDSTVFESLPA---------
2czlA           LARRDLGEGLIRALDEAVRRSVA-------------
1ce2A           ------------------------------------
1b1xA           GAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYEL
2dbpA           LPLPLGAILARRDLGEGLIR----------------
1bkaA           VAFVK-DVTVLQNTDGNNNE----------------
1blfA           GAFKC-------------------------------
1d4nA           KCLKDGAGDVAFVKESTIFENLA---NKADRDQY--
1biyA           GAFKCLQDGAGDVA----------------------
2de3B           ------------------------------------
2b65A           VKNDTVWENTNGESTADWAKNLKREDFRLCLDGT--
2de2A           ------------------------------------
3chgA           ------------------------------------
2b4lA           TITRKGFSKEQNAAKLLSQFKWTQDEMGEIMIKVEE
2b4mA           ------------------------------------
3chgD           ------------------------------------
2dvzA           LLAPKGTPDVVNKLRDAAVVALKDPVIKALDDQGSA
2bjjX           DEAERDEYELL-------------------------
2d3iA           ------------------------------------
1dotA           ------------------------------------