[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tmar0:AAD35750.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bn1A.bssp"
#ERROR : Can't open dsspfile "3dr4C.bssp"
#ERROR : Can't open dsspfile "2ctzA.bssp"
#ERROR : Can't open dsspfile "3bn1C.bssp"
#ERROR : Can't open dsspfile "1b9iA.bssp"
#ERROR : Can't open dsspfile "3bcxB.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "3bb8A.bssp"
#ERROR : Can't open dsspfile "3bcxA.bssp"
#ERROR : Can't open dsspfile "3b8xB.bssp"
#ERROR : Can't open dsspfile "2cb1A.bssp"
#ERROR : Can't open dsspfile "3b8xA.bssp"
#ERROR : Can't open dsspfile "1dy2A.bssp"
#ERROR : Can't open dsspfile "2c81A.bssp"
#ERROR : Can't open dsspfile "3dr4B.bssp"
#ERROR : Can't open dsspfile "2c7tA.bssp"
#ERROR : Can't open dsspfile "3bn1D.bssp"
#ERROR : Can't open dsspfile "3dr7B.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "2btwB.bssp"
#ERROR : Can't open dsspfile "1cl1B.bssp"
#ERROR : Can't open dsspfile "3dr4A.bssp"
#ERROR : Can't open dsspfile "3dr4D.bssp"
#ERROR : Can't open dsspfile "1e5eB.bssp"
#ERROR : Can't open dsspfile "1cj0B.bssp"
#ERROR : Can't open dsspfile "2btwA.bssp"
#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "2a7vA.bssp"
#ERROR : Can't open dsspfile "3ecdC.bssp"
#ERROR : Can't open dsspfile "2aeuA.bssp"
#ERROR : Can't open dsspfile "1c4kA.bssp"
#ERROR : Can't open dsspfile "3bh1C.bssp"
#ERROR : Can't open dsspfile "1dfoA.bssp"
#ERROR : Can't open dsspfile "3bcaA.bssp"
#ERROR : Can't open dsspfile "3e77B.bssp"
#ERROR : Can't open dsspfile "3d19E.bssp"
#ERROR : Can't open dsspfile "1cj0A.bssp"
#ERROR : Can't open dsspfile "1e5eA.bssp"
#ERROR : Can't open dsspfile "3ecdD.bssp"
#ERROR : Can't open dsspfile "1dfoB.bssp"
#ERROR : Can't open dsspfile "3d19A.bssp"
#ERROR : Can't open dsspfile "2dkjA.bssp"
#ERROR : Can't open dsspfile "1c8nA.bssp"
#ERROR : Can't open dsspfile "3ecdB.bssp"
#ERROR : Can't open dsspfile "2dgmE.bssp"
#ERROR : Can't open dsspfile "2dgmC.bssp"
#ERROR : Can't open dsspfile "3e6gB.bssp"
#ERROR : Can't open dsspfile "3ei9A.bssp"
#ERROR : Can't open dsspfile "1bw9A.bssp"
#ERROR : Can't open dsspfile "3dzzB.bssp"
#ERROR : Can't open dsspfile "3e6gD.bssp"
#ERROR : Can't open dsspfile "3dzzA.bssp"
#ERROR : Can't open dsspfile "3ecdA.bssp"
#ERROR : Can't open dsspfile "2douB.bssp"
#ERROR : Can't open dsspfile "1c8eA.bssp"
#ERROR : Can't open dsspfile "2e7jA.bssp"
#ERROR : Can't open dsspfile "2bwoD.bssp"
#ERROR : Can't open dsspfile "3eiaA.bssp"
#ERROR : Can't open dsspfile "1djeA.bssp"
#ERROR : Can't open dsspfile "2c44B.bssp"
#ERROR : Can't open dsspfile "3dydB.bssp"
#ERROR : Can't open dsspfile "2c44A.bssp"
#ERROR : Can't open dsspfile "1ay4B.bssp"
#ERROR : Can't open dsspfile "2bwpB.bssp"
#ERROR : Can't open dsspfile "1bs0A.bssp"
#ERROR : Can't open dsspfile "1bj4A.bssp"
#ERROR : Can't open dsspfile "2dgkA.bssp"
#ERROR : Can't open dsspfile "1ax4A.bssp"
#ERROR : Can't open dsspfile "2bwpA.bssp"
#ERROR : Can't open dsspfile "2ch2A.bssp"
#ERROR : Can't open dsspfile "2cstA.bssp"
#ERROR : Can't open dsspfile "1ay4A.bssp"
#ERROR : Can't open dsspfile "3bh1A.bssp"
#ERROR : Can't open dsspfile "2dgmA.bssp"
#ERROR : Can't open dsspfile "1bjwA.bssp"
#ERROR : Can't open dsspfile "1eghA.bssp"
#ERROR : Can't open dsspfile "3bs8A.bssp"
#ERROR : Can't open dsspfile "2ch1A.bssp"
#ERROR : Can't open dsspfile "3e9kA.bssp"
#ERROR : Can't open dsspfile "1bqaA.bssp"
#ERROR : Can't open dsspfile "1eg5B.bssp"
#ERROR : Can't open dsspfile "3caiA.bssp"
#ERROR : Can't open dsspfile "1djuA.bssp"
#ERROR : Can't open dsspfile "1ecxB.bssp"
#ERROR : Can't open dsspfile "2cfbA.bssp"
#ERROR : Can't open dsspfile "3bh1D.bssp"
#ERROR : Can't open dsspfile "1ay5B.bssp"
#ERROR : Can't open dsspfile "3d6kD.bssp"
#ERROR : Can't open dsspfile "1c8fA.bssp"
#ERROR : Can't open dsspfile "2dr1B.bssp"
#ERROR : Can't open dsspfile "1ejiA.bssp"
#ERROR : Can't open dsspfile "3ei7B.bssp"
#ERROR : Can't open dsspfile "1bkgA.bssp"
#ERROR : Can't open dsspfile "3bc8A.bssp"
#ERROR : Can't open dsspfile "2aatA.bssp"
#ERROR : Can't open dsspfile "2bwnB.bssp"
#ERROR : Can't open dsspfile "2aevA.bssp"
#ERROR : Can't open dsspfile "2eh6A.bssp"
#ERROR : Can't open dsspfile "2d61A.bssp"
#ERROR : Can't open dsspfile "3bcbA.bssp"
#ERROR : Can't open dsspfile "3ei6B.bssp"
#ERROR : Can't open dsspfile "2c44C.bssp"
#ERROR : Can't open dsspfile "1aiaA.bssp"
#ERROR : Can't open dsspfile "1ariA.bssp"
#ERROR : Can't open dsspfile "1c1dB.bssp"
#ERROR : Can't open dsspfile "3cogD.bssp"
#ERROR : Can't open dsspfile "1b5pA.bssp"
#ERROR : Can't open dsspfile "1b4xA.bssp"
#ERROR : Can't open dsspfile "3eiaB.bssp"
#ERROR : Can't open dsspfile "3e6gA.bssp"
#ERROR : Can't open dsspfile "1eg5A.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "5bj4A.bssp"
#ERROR : Can't open dsspfile "2bwoB.bssp"
#ERROR : Can't open dsspfile "1c1dA.bssp"
#ERROR : Can't open dsspfile "7aatA.bssp"
#ERROR : Can't open dsspfile "3e2yA.bssp"
#ERROR : Can't open dsspfile "1djuB.bssp"
#ERROR : Can't open dsspfile "1bw0B.bssp"
#ERROR : Can't open dsspfile "2dr1A.bssp"
#ERROR : Can't open dsspfile "1c1xA.bssp"
#ERROR : Can't open dsspfile "3cq4A.bssp"
#ERROR : Can't open dsspfile "3b46A.bssp"
#ERROR : Can't open dsspfile "3a2bA.bssp"
#ERROR : Can't open dsspfile "3bwnC.bssp"
#ERROR : Can't open dsspfile "1arhA.bssp"
#ERROR : Can't open dsspfile "2d5yA.bssp"
#ERROR : Can't open dsspfile "3d6kA.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "3cogB.bssp"
#ERROR : Can't open dsspfile "2egyC.bssp"
#ERROR : Can't open dsspfile "2douA.bssp"
#ERROR : Can't open dsspfile "3bwnB.bssp"
#ERROR : Can't open dsspfile "3cq5A.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "3c01F.bssp"
#ERROR : Can't open dsspfile "3bwnE.bssp"
#ERROR : Can't open dsspfile "3c01E.bssp"
#ERROR : Can't open dsspfile "3caeA.bssp"
#ERROR : Can't open dsspfile "3d6kC.bssp"
#ERROR : Can't open dsspfile "2bhxB.bssp"
#ERROR : Can't open dsspfile "3d6kB.bssp"
#ERROR : Can't open dsspfile "5bj3A.bssp"
#ERROR : Can't open dsspfile "2d3jA.bssp"
#ERROR : Can't open dsspfile "2b34A.bssp"
#ERROR : Can't open dsspfile "1bxgA.bssp"
#ERROR : Can't open dsspfile "1asbA.bssp"
#ERROR : Can't open dsspfile "1b93B.bssp"
#ERROR : Can't open dsspfile "3d19C.bssp"
#ERROR : Can't open dsspfile "1ei7A.bssp"
#ERROR : Can't open dsspfile "2eaaA.bssp"
#ERROR : Can't open dsspfile "2e7uA.bssp"
#ERROR : Can't open dsspfile "3d19B.bssp"
#ERROR : Can't open dsspfile "3d19D.bssp"
#ERROR : Can't open dsspfile "2bylA.bssp"
#ERROR : Can't open dsspfile "3bwoC.bssp"
#ERROR : Can't open dsspfile "3bwnD.bssp"
#ERROR : Can't open dsspfile "1asfA.bssp"
#ERROR : Can't open dsspfile "3bwnA.bssp"
#ERROR : Can't open dsspfile "3bwnF.bssp"
#ERROR : Can't open dsspfile "3bk2A.bssp"

## Summary of PDB Search
:377
    4e-51  29%  3bn1A  [x.x.x] PEROSAMINE SYNTHETASE
    6e-50  29%  3dr4C  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    7e-36  17%  2ctzA  [x.x.x] O-ACETYL-L-HOMOSERINE SULFHYDRYLASE
    2e-35  29%  3bn1C  [x.x.x] PEROSAMINE SYNTHETASE
    6e-35  23%  1b9iA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    9e-35  23%  3bcxB  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    4e-34  23%  1b9hA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    1e-32  23%  3bb8A  [x.x.x] CDP-4-KETO-6-DEOXY-D-GLUCOSE-3-DEHYDRASE
    1e-31  23%  3bcxA  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    3e-31  25%  3b8xB  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    6e-31  13%  2cb1A  [x.x.x] O-ACETYL HOMOSERINE SULFHYDRYLASE
    5e-29  25%  3b8xA  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    4e-27  16%  1dy2A  [d.169.1] COLLAGEN ALPHA1(XV) CHAIN
    5e-27  25%  2c81A  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    2e-26  29%  3dr4B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    3e-26  26%  2c7tA  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    3e-26  25%  3bn1D  [x.x.x] PEROSAMINE SYNTHETASE
    8e-26  26%  3dr7B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    1e-24  12%  1cl1A  [c.67.1] CYSTATHIONINE BETA-LYASE
    8e-24  15%  2btwB  [x.x.x] ALR0975 PROTEIN
    8e-23  10%  1cl1B  [c.67.1] CYSTATHIONINE BETA-LYASE
    1e-22  27%  3dr4A  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    1e-21  29%  3dr4D  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    2e-21  11%  1e5eB  [c.67.1] METHIONINE GAMMA-LYASE
    4e-21  13%  1cj0B  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    4e-21  15%  2btwA  [x.x.x] ALR0975 PROTEIN
    2e-20  11%  1cs1A  [c.67.1] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    1e-19  12%  2a7vA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
    1e-19  14%  3ecdC  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    3e-19   8%  2aeuA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    6e-19  10%  1c4kA  [c.23.1 - c.67.1 - d.125.1] PROTEIN (ORNITHINE DECARBOXYLASE)
    1e-18  12%  3bh1C  [x.x.x] UPF0371 PROTEIN DIP2346
    1e-18  15%  1dfoA  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    1e-18   9%  3bcaA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    2e-18  11%  3e77B  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    2e-18   9%  3d19E  [x.x.x] CONSERVED METALLOPROTEIN
    2e-18  12%  1cj0A  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    3e-18  10%  1e5eA  [c.67.1] METHIONINE GAMMA-LYASE
    6e-18  14%  3ecdD  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    2e-17  14%  1dfoB  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    2e-17  10%  3d19A  [x.x.x] CONSERVED METALLOPROTEIN
    8e-17  11%  2dkjA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
    1e-16  11%  1c8nA  [b.121.4] COAT PROTEIN
    1e-16  14%  3ecdB  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    2e-16   9%  2dgmE  [c.67.1 (1pmmA)] GLUTAMATE DECARBOXYLASE BETA
    2e-16  10%  2dgmC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    4e-16  20%  3e6gB  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    4e-16  12%  3ei9A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-16  14%  1bw9A  [c.58.1 - c.2.1] PHENYLALANINE DEHYDROGENASE
    5e-16  13%  3dzzB  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    1e-15  20%  3e6gD  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    2e-15  12%  3dzzA  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    2e-15  13%  3ecdA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    2e-15  13%  2douB  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    4e-15   7%  1c8eA  [b.121.5] FELINE PANLEUKOPENIA VIRUS CAPSID
    8e-15  11%  2e7jA  [x.x.x] SEP-TRNA:CYS-TRNA SYNTHASE
    8e-15  13%  2bwoD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    1e-14  11%  3eiaA  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-14  18%  1djeA  [c.67.1] 8-AMINO-7-OXONANOATE SYNTHASE
    2e-14  14%  2c44B  [x.x.x] TRYPTOPHANASE
    2e-14  10%  3dydB  [x.x.x] TYROSINE AMINOTRANSFERASE
    4e-14  13%  2c44A  [x.x.x] TRYPTOPHANASE
    4e-14  14%  1ay4B  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    4e-14  17%  2bwpB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    5e-14  15%  1bs0A  [c.67.1] PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)
    6e-14   9%  1bj4A  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    8e-14   9%  2dgkA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    8e-14   9%  1ax4A  [c.67.1] TRYPTOPHANASE
    9e-14  13%  2bwpA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    9e-14  10%  2ch2A  [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE
    2e-13  13%  2cstA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-13  13%  1ay4A  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    2e-13  16%  3bh1A  [x.x.x] UPF0371 PROTEIN DIP2346
    3e-13  10%  2dgmA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    3e-13  16%  1bjwA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-13  14%  1eghA  [c.24.1] METHYLGLYOXAL SYNTHASE
    4e-13  12%  3bs8A  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    4e-13  11%  2ch1A  [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE
    7e-13  12%  3e9kA  [x.x.x] KYNURENINASE
    1e-12  11%  1bqaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-12  14%  1eg5B  [c.67.1] AMINOTRANSFERASE
    1e-12  15%  3caiA  [x.x.x] POSSIBLE AMINOTRANSFERASE
    2e-12  16%  1djuA  [c.67.1] AROMATIC AMINOTRANSFERASE
    2e-12  15%  1ecxB  [c.67.1] AMINOTRANSFERASE
    2e-12  13%  2cfbA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    2e-12  14%  3bh1D  [x.x.x] UPF0371 PROTEIN DIP2346
    4e-12  15%  1ay5B  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    5e-12  10%  3d6kD  [x.x.x] PUTATIVE AMINOTRANSFERASE
    5e-12   8%  1c8fA  [b.121.5] FELINE PANLEUKOPENIA VIRUS CAPSID
    6e-12  10%  2dr1B  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    8e-12  14%  1ejiA  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    8e-12  11%  3ei7B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    8e-12  14%  1bkgA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-11   9%  3bc8A  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    1e-11  12%  2aatA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    1e-11  13%  2bwnB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    1e-11   9%  2aevA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    1e-11  13%  2eh6A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    1e-11  15%  2d61A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    1e-11  10%  3bcbA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    1e-11  12%  3ei6B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-11  14%  2c44C  [x.x.x] TRYPTOPHANASE
    2e-11  14%  1aiaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    3e-11  11%  1ariA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    3e-11  10%  1c1dB  [c.58.1 - c.2.1] L-PHENYLALANINE DEHYDROGENASE
    3e-11  14%  3cogD  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    4e-11  14%  1b5pA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    5e-11  13%  1b4xA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    5e-11   9%  3eiaB  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    6e-11  24%  3e6gA  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    7e-11  14%  1eg5A  [c.67.1] AMINOTRANSFERASE
    8e-11  12%  1c7nA  [c.67.1] CYSTALYSIN
    1e-10  14%  5bj4A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    1e-10  13%  2bwoB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-10  15%  1c1dA  [c.58.1 - c.2.1] L-PHENYLALANINE DEHYDROGENASE
    2e-10  14%  7aatA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    3e-10  17%  3e2yA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    3e-10  16%  1djuB  [c.67.1] AROMATIC AMINOTRANSFERASE
    3e-10  12%  1bw0B  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    3e-10  12%  2dr1A  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    4e-10  16%  1c1xA  [c.58.1 - c.2.1] L-PHENYLALANINE DEHYDROGENASE
    5e-10  12%  3cq4A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    6e-10  15%  3b46A  [x.x.x] AMINOTRANSFERASE BNA3
    7e-10  20%  3a2bA  [x.x.x] SERINE PALMITOYLTRANSFERASE
    8e-10  14%  3bwnC  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    9e-10  14%  1arhA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-09  13%  2d5yA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    1e-09  10%  3d6kA  [x.x.x] PUTATIVE AMINOTRANSFERASE
    2e-09  12%  1b8gA  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    2e-09  15%  1agxA  [x.x.x] GLUTAMINASE-ASPARAGINASE
    2e-09  17%  3cogB  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    4e-09  14%  2egyC  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    4e-09  13%  2douA  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    5e-09  12%  3bwnB  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    5e-09  14%  3cq5A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    6e-09  12%  1bw0A  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    7e-09  11%  3c01F  [x.x.x] SURFACE PRESENTATION OF ANTIGENS PROTEIN SPAS
    8e-09  12%  3bwnE  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    2e-08  11%  3c01E  [x.x.x] SURFACE PRESENTATION OF ANTIGENS PROTEIN SPAS
    2e-08  10%  3caeA  [x.x.x] ENDODEOXYRIBONUCLEASE 1
    2e-08  10%  3d6kC  [x.x.x] PUTATIVE AMINOTRANSFERASE
    3e-08   8%  2bhxB  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    5e-08  13%  3d6kB  [x.x.x] PUTATIVE AMINOTRANSFERASE
    1e-07  17%  5bj3A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    1e-07  10%  2d3jA  [x.x.x] WNT INHIBITORY FACTOR-1
    1e-07   8%  2b34A  [x.x.x] MAR1 RIBONUCLEASE
    2e-07  16%  1bxgA  [c.58.1 - c.2.1] PHENYLALANINE DEHYDROGENASE
    6e-07  12%  1asbA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    7e-07  12%  1b93B  [c.24.1] PROTEIN (METHYLGLYOXAL SYNTHASE)
    3e-06   7%  3d19C  [x.x.x] CONSERVED METALLOPROTEIN
    4e-06   7%  1ei7A  [a.24.5] COAT PROTEIN
    7e-06  12%  2eaaA  [x.x.x] 7S GLOBULIN-3
    9e-06  18%  2e7uA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    2e-05   8%  3d19B  [x.x.x] CONSERVED METALLOPROTEIN
    3e-05   8%  3d19D  [x.x.x] CONSERVED METALLOPROTEIN
    4e-05  19%  2bylA  [x.x.x] ORNITHINE AMINOTRANSFERASE
    4e-05  11%  3bwoC  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    5e-05  14%  3bwnD  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    9e-05  15%  1asfA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-04  14%  3bwnA  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    6e-04  14%  3bwnF  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    8e-04  17%  3bk2A  [x.x.x] METAL DEPENDENT HYDROLASE
:377

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIPLFDLTRQYERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAM
3bn1A           ----------------NERDYVLECMDTTWISVGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM
3dr4C           LPRI-SVAAPRGNERDYVLECMDTTWISSV---GRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM
2ctzA           ----------------------------------PTVDVLEKRLAALEGGKAALATASGHAAQFLALTTL
3bn1C           ------------RLDGNERDYVLECMDTTWISSVRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM
1b9iA           -----------PQYDDAERNGLVRALEQGQWWRMGGVNSFEREFAAHHGAAHALAVTNGTHALELALQVM
3bcxB           ---------SGKVIGTKELQLMVEASLDGWLTTGRFNDAFEKKLGEYLGVPYVLTTTSGSSANLLALTAL
1b9hA           -----------PQYDDAERNGLVRALEQGQWWRMGGVNSFEREFAAHHGAAHALAVTNGTHALELALQVM
3bb8A           ----------GTKELQLMVEASLDGWLTTG----RFNDAFEKKLGEYLGVPYVLTTTSGSSANLLALTAL
3bcxA           ----------------KELQLMVEASLDGWLTTGRFNDAFEKKLGEYLGVPYVLTTTSGSSANLLALTAL
3b8xB           ----------------LEYKAIQSVLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAAL
2cb1A           -IYAVAAYGFKTLEEGQERFATGEGYVYARQK-DPTAKALEERLKALEGALEAVVLASGQAATFAALLAL
3b8xA           ------------TWDDLEYKAIQSVLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAAL
1dy2A           ----------------------------------------------------------------------
2c81A           -----------DRTRRKIEEVFQSNRWAISGGEESMERKFAKAFADFNGVPYCVPTTSGSTALMLALEAL
3dr4B           ------------RLDGNERDYVLECMDTTWISSVRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM
2c7tA           -----------DRTRRKIEEVFQSNRWAISGYEESMERKFAKAFADFNGVPYCVPTTSGSTALMLALEAL
3bn1D           -----------PRLDGNERDYVLECMDTTWISSVRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM
3dr7B           -----RISVAAPRLDGNERDYVLECMDTTWISSVRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM
1cl1A           ------------------------------------HFSLQQAMCELEGGAGCVLFPCGAAAVANSILAF
2btwB           --------------------------------------------------PNLIGFNSNEGEKLLL----
1cl1B           ------------------------------------HFSLQQAMCELEGGAGCV-LFPCGAAAVANSILA
3dr4A           -----------PRLDGNERDYVLECMDTTWISSVRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM
3dr4D           ------------RLDGNERDYVLECMDTTWISSVRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM
1e5eB           ----------------------------------PTVSNLEGKIAFLEKTEACVATSSGMGAIAATVLTI
1cj0B           -------------------------------------RALQAYGLDPQCWGVNVQPYSGSPANFAVYTAL
2btwA           -----------------------------------------------------LIGFNSNEGEKLLLTS-
1cs1A           ---------------------------------NPTRDVVQRALAELEGGAGAVLTNTGMSAIHLVTTVF
2a7vA           ------LSDSDPEMWELLQREKDRQCRGLELIASEN--FCSRAALEALGSCLNNVDEIELLCQRRALEAF
3ecdC           ------LIASENIVSRAVLDAQGSVLTNKYAEGYEVEALAIERVKRLFNAGHANVQPHSGAQANGAVMLA
2aeuA           -LYDLSGLSGGFLIDEKDKALLNTYIGSSYFA----EKVNEYGLKHLGGDENDKCVGFNRTSSAILATIL
1c4kA           ----------------------------------GPAVAAEKHAARVYNADKTYFVLGGSSNANNTVTSA
3bh1C           --------------------------------TQSDRAAVVMAKAGIKASQRVVVEPARQVEERTSLPGC
1dfoA           ------QGSQLTNKYAEGYPGKRYY--GGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTA
3bcaA           ------------------------------------TNSLVLNVIKLAGVHSCFVVPMATGMSLTLCFLH
3e77B           ------------------------------------ENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNL
3d19E           --------------------------------------------------------IMKEHSFFLRLGFR
1cj0A           -------------------------------------RALQAYGLDPQCWGVNVQPYSGSPANFAVYTAL
1e5eA           ----------------------------------PTVSNLEGKIAFLEKTEACVATSSGMGAIAATVLTI
3ecdD           -----------NIVSRAVLDAQGSVLTNKYA--DEVEALAIERVKRLFNAGHANVQPHSGAQANGAVMLA
1dfoB           --------------------------YGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTA
3d19A           -------------------------------VMFVERSLNEIRFWSR---------IMKEHSFFLRLGFR
2dkjA           --------------------------YGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMA
1c8nA           -----------------------------------------------------TPIALAYTVQSLPLIAT
3ecdB           ------LAERDASVRGAILKELERQQSQVELIASENIVSRAVLDAQGSVLTNKYAEGYADEVEALAIERV
2dgmE           ----------------------------------------QAVGTNTIGSSEACMLGGMAMKWRWRKRME
2dgmC           ------------NVHKLMDLSINKNWIDKEEYSAAIDLRCVNMVADLWHAPAPKNGQASSEACMLGGMAA
3e6gB           -----------------------------------TRFAYERCVAALEGGTRAFAFASGMAATSTVMELL
3ei9A           ----------------------------------PLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQV
1bw9A           --------------------------------------------DGLTVLVQGLGAVGGSLASLAA-EAG
3dzzB           --------------------------ESVPAEYYKAVADWEEIEHRARPKEDWCVFASGVVPAISAVRQF
3e6gD           -----------------------------------TRFAYERCVAALEGGTRAFAFASGMAATSTVMELL
3dzzA           ---------------------------SVPAEYYKAVADWEEIEHRARPKEDWCVFASGVVPAISAVRQF
3ecdA           ---------------------------------------AIERVKRLFNAGHANVQPHSGAQANGAVMLA
2douB           -------------------------------------RWYEGRYGVGLDPRREALALIGSQEGLAHLLLA
1c8eA           ----------------------------------------------------GVGISTGTFNNQTEFKFL
2e7jA           ----------------KLTEEARQALLEWP----PIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSL
2bwoD           ----------------------------------AYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTL
3eiaA           ----------------------------------PLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQV
1djeA           ---------HHPQIIRAWQQGAEQFIGSGGSVSGYSVQALEEELAEWLGYSRALLFISGFAANQAVIAAM
2c44B           ----------------------------------RSYYALAESVKNIFGYQYTIPTHQIPVLIKKREQEK
3dydB           ----------------------------------EEIASYYHCPEAPLEAKDVILTSGCSQAIDLCLA-V
2c44A           -----------GAVTQSMQAAMMRGDEAYSGSRS--YYALAESVKNIFGYQYTAEQIYIPVLIKKREQEK
1ay4B           ----------------------------------------QKAMGELILGDGLKSETTGALRQALELARM
2bwpB           ---------QHPVVLAAMHEALEAVGSGGTRNISGTHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTL
1bs0A           ---------HHPQIIRAWQQGAEQFIGSGGSVSGYSVQALEEELAEWLGYSRALLFISGFAANQAVIAAM
1bj4A           ----------------------------------------QAYKLDPQCWGVNVQPYSGSPANFAVYTAL
2dgkA           ----------------------------------------QAVGTNTIGSSEACMLGGMAMKWRWRMEAA
1ax4A           ----------TDSGTNAMSDHQWAAMITGDEAYAGSYYDLKDKAKELFNYDYIIPAHQGRGAENILFPVL
2bwpA           ----------------------------------AYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTL
2ch2A           -----------KRVLTAMTNTVLSNFHAELFRTMDEVKDGLRYIFQTENRATMCVSGSAHAGMEAMLSNL
2cstA           ---------------------------------------------------GGTGALRIGAEFLRRWYNG
1ay4A           ----------------AVHAAEQRMLETETTKTLSGEPEFQKAMGELILGDGLKSETTGALRQALELARM
3bh1A           ---------------------------------------------------------------------C
2dgmA           ----------------NVHKLMDLSINKNWIQSAAIDLRCVNMVADLWHAPAPTNTIGSSEACMLGGMAM
1bjwA           ------------------------------------AEKFRRENGLSVTPEETIVTVGGKQALFNLFQAI
1eghA           --------------------------------------------TTRTLPARKHIALVAHDHCKQMLMSW
3bs8A           ------------------------------------NELAKLVIDRVPSVEIVRMVSSGTEATMSALRLA
2ch1A           -----------KRVLTAMTNTVLSNFHAELF---RTMDEVKDGLRYIFQTENRMCVSGSAHAGMEAMLSN
3e9kA           ----------------------------------TGDESIVGLMKDIVGANEKMNALTVNLHLLMLSFFK
1bqaA           -------------------------------------GKGSALINDKRARTAQTPGGTGALRVAADFLA-
1eg5B           -----------DRVLEEIVFYREKYGNPNSAHGGIEANKAREKVAKVLGVSPSFFTSCATESINWILKTV
3caiA           -----------------------------------------EAVADLVNADPGGVVLGADRAVLLSLLAE
1djuA           --------------------------------LREAIAEKLKKQNGIEADPEIMVLLGANQAFLMGLSAF
1ecxB           ----------------------------------LHMEKAREKVAKVLGVSPSEIFFTSCNWILKTVAET
2cfbA           ----------------------------------LENILAEMVIAAVPSVEMVRFVNSGTEACMAVLRLM
3bh1D           ----------------------------------------------------------------------
1ay5B           --------------------------------------EFQKAMGELILGDGLKATVGGTGALRQALELA
3d6kD           -KPSAEQLDLSNDLLSLPGGDFRTKDGVDCRNYGGLIADIRELWAEALGLPADLISWSYTWGNNDSSRPW
1c8fA           ----------------------------------------------------GVGISTGTFNNQTEFKFL
2dr1B           -----------PEVLEIMKVQMFSHRSKEYRKVHMDTVERLREFLEVEKGEVLLVPSSGTGIMEASIRNG
1ejiA           ------------------------------------KRALQAYHLDPQCWGVNVQPYSGSPANFAVYTAL
3ei7B           ----------------------------------PLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQV
1bkgA           -----------EHVKEAARRALAQGKTKYAPPAGIPAEKFRRENGLSVTPEETIVTVGGKQALFNLFQAI
3bc8A           -REGRVASALVARRHYRFIHGIGRQPKAAGSLLNKITNSLVLNVIKLAGVHSCFVVPMATGMSLTLCFLH
2aatA           ----------------------------------------FGKGSALINDKRARTAQTPGALRVAADFLA
2bwnB           ----------------------------------AYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTL
2aevA           ----------------LIDEKDKALLNTYIGSSYFAEKVNEYGLKHLGGDENDKCVGFNRTSSAILATIL
2eh6A           -----------PKLTEALKEQVEKLLHVSNLYENPWQEELAHKLKHFWTEGKVFFANSGTESVEAAIKLA
2d61A           ----------------------------------CTQELLFGKGSALINDKRARTAQTPGGALRVAADLA
3bcbA           ----------------------------------KITNSLVLNVIKLAGVHSCFVVPMATGMSLTLCFLT
3ei6B           ----------------------------------PLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQV
2c44C           ---------------------------------SRSYYALAESVKNIFGYQYTIPTHQGRGAEQIYEQEK
1aiaA           ------------------------------------QELLFGKGSALINDKRARTAGTGALRVAADFLAK
1ariA           -----------TSVKKAEQYLLENETTKNYLGIDG-IPEFGRCTQELLFGKGSALINDKRARTVAADFLA
1c1dB           ----------------------------------------------------------------------
3cogD           ---------------------------------------TRNCLEKAVAALDGYCLAFASGLAATVTITH
1b5pA           -----------EHVKEAARRALAQGKTKYAPPAGIPAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAI
1b4xA           ----------------------------------CTQELLFGKGSALINDKRARTAGTGALRVAADFLAK
3eiaB           ----------------------------------PLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQV
3e6gA           -----------------------------------TRFAYERCVAALEGGTRAFAFASGMAATSTVMELL
1eg5A           ----------------------------------NLHEKAREKVAKVLGVSPSFFTSCATESINWILKET
1c7nA           -------------------------------------KWMKDRHQWDIQTDWIINTAGVVPAVFNAVREF
5bj4A           -----------EHVKEAARRALAQGKTKYAPPAGIPAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAI
2bwoB           ----------------------------------AYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTL
1c1dA           -------------------------------------------LDGLTVLVQGLGAVGGSLASLAA-EAG
7aatA           -------------------------------------GENSEAFKSGRYVTVQGISGTGSLRVGANFLQR
3e2yA           --------------------------GFGHPALVKALSCLYGKIYQRQIDPEEILVAVGAYGSLFNSIQG
1djuB           -----------QHIKEYAKEALDKGLTHYGPNIGLLIAEKLKKQNGIEADKTEIMVLLGANQAFLMGLSA
1bw0B           -----------------------------------------------------VVLCSGGSHGILMAITA
2dr1A           -----------PEVLEIMKVQMFSHRSKEYRKVHMDTVERLREFLEVEKGEVLLVPSSGTGIMEASIRNG
1c1xA           ----------------------------------------------------------------------
3cq4A           -------------------------------------AYITKQTGVAVTRDNLWAANGSNEILQQLLQAF
3b46A           --------------------------------------LYSPIYNTELKAENVTVTTGANEGILSCLMGL
3a2bA           -----------TRIIKAAQDALEKCAGSRFLNGTLDIVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCL
3bwnC           ------------------------------------EPELEDAIKDLHGVVGNAAVGTGSTQLCQAAVHA
1arhA           -----------------------------------------------------TAQTPGGTGALAADFLA
2d5yA           ---------------------------------------LFGKGSALINDKRARTAQTPGGTGALRVALA
3d6kA           -KPSAEQLDLSNDLLSLPGGDFRTKDGVDCRNYGLGIADIRELWAEALGLPADLISWSYTWGNNDSSRPW
1b8gA           -----------AAAFKKNGESIFAELALFQDYHGLPVDFMAEIRGNKVTFDPNVLTAGATSANETFIFCL
1agxA           ---------------------------------------------------NIHTHAFVSQWGALGTLVE
3cogB           ----------------------------------PTRNCLEKAVAALDGAK--YCLAFASGLAATVTITH
2egyC           ----------------------------------------RAFVAEWIGVRPELITTGSQQALDLVGKVF
2douA           -------------------------------------RWYEGRYGVGLDPRREALALIGSQEGLAHLLLA
3bwnB           ---------------------------------------LEDAIKDLHGVVGNAATTGSTQLCQAAVHAL
3cq5A           -----------EALVADLVATVDKIATELNRYPERDAVELRDELAAYITKQTGVAVTNGSNEILQQLLQA
1bw0A           -------------------------------------NSFVHKEELKSTIVKDVVLCSGGSHGILMAITA
3c01F           ----------------------------------------------------------------------
3bwnE           ---------------------------------------LEDAIKDLHGVVGNAATTGSTQLCQAAVHAL
3c01E           ----------------------------------------------------------------------
3caeA           -------------------------------------------------------ESKGIKFEYEEWKVP
3d6kC           -KPSAEQLDLSNDLLSLPGGDFRTKDGVDCRNYGGLIADIRELWAEALGLPADLISWSYTWGNNDSSRPW
2bhxB           -----------KPALERAQKELLNFNDTQMSVRSQSYEEVHEQAQNLLRELLQIPNGGASLQFTMLPMNL
3d6kB           -KPSAEQLDLSNDLLSLPGGDFRTKDGVDCRNYGGLIADIRELWAEALGLPADLISWSYTWGNNDSSRPW
5bj3A           -------------------------------------EKFRRENGLSVTPEETIVTVGGSQALFNLFQAI
2d3jA           ---------------------------------------YFYEFLSLRSLDKGIMALGTVPHKASVVQVG
2b34A           ----------------------------------KGLGHTVPTLKEGLAENTPIFDKTKFSMCIPPTEDT
1bxgA           ----------------------------------------------------------------------
1asbA           -------------------------------------ELLFGKGSALINDKRARTAQTPGGTGALRVAAD
1b93B           --------------------------------------------TTRTLPARKHIALVAHDHCKQMLMSW
3d19C           ------------------------------------------------------------EHSFFLRLGF
1ei7A           ----------------------------------------------------------------------
2eaaA           --------EKNPQLKDLDVFISSVDMKEGALLLPHYNSKAIVIMVINEGEAKIELVGLSDESLEVQRYRA
2e7uA           ---------------------------------------LAKKVKRAYPFVDLVGTEATMSALRLAKFRG
3d19B           ---------------------------------------------------------MKEHSFFLRL-GF
3d19D           ---------------------------------------------------------MKEHSFFLRL-GF
2bylA           -----------------LKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLA
3bwoC           ---------------------------------------LEDAIKDLHGVVGNAATTGSTQLCQAAVHAL
3bwnD           ------------------------------------EPELEDAIKDLHGVVGNAATTGSTQLCQAAVHAL
1asfA           ------------------------------------QELLFGKGSALINDKRARTAPGGTGALRVAADLA
3bwnA           ---------------------------------------LEDAIKDLHGVVGNAATSTQLCQAAVALSSL
3bwnF           ---------------------------------------LEDAIKDLHGVVGNAATTGSTQLCQAAVHAL
3bk2A           ------------------------------------------------------------------GHAK


                         .         .         *         .         .         .         .:140
query           GVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDL
3bn1A           GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEALI-TPRTKAIMPVHLYGQICDM
3dr4C           GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEALI-TPRTKAIMPVHLYGQICDM
2ctzA           A-QAGDNIVSTPNLYGGTFNQFKVTLKRLGIE-VRFTSREERPEEFLALTD-EKTRAWWVESIGLNIPDL
3bn1C           GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEALI-TPRTKAIMPVHLYGQICDM
1b9iA           GVGPGTEVIVPAFTFISSSQAAQRLGAVTVPVDVDAATYNLDPEAVAAAV-TPRTKVIMPVHMAGLMADM
3bcxB           ALKPGDEVITVAAGFPTTVNPTIQNGLIPVFVDVDIPTYNVNASLIEAAVSD-KTKAIMIAHTLGNLFDL
1b9hA           GVGPGTEVIVPAFTFISSSQAAQRLGAVTVPVDVDAATYNLDPEAVAAAV-TPRTKVIMPVHMAGLMADM
3bb8A           ALKPGDEVITVAAGFPTTVNPTIQNGLIPVFVDVDIPTYNVNASLIEAA-VSDKTKAIMIAHTLGNLFDL
3bcxA           ALKPGDEVITVAAGFPTTVNPTIQNGLIPVFVDVDIPTYNVNASLIEA-AVSDKTKAIMIAHTLGNLFDL
3b8xB           RLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAV-TDSTKAILTVNLLGNPNNF
2cb1A           -LRPGDEVVAAKGLFGQTIGLFGQVLSLM---GVTVRYVDPEPEAVREALSAKTRAVFVVANPALLVPDL
3b8xA           RLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAVTDS-TKAILTVNLLGNPNNF
1dy2A           -------------------------LNTPVAGDIRADFQCFQQARAAGL--LSTFRAFLSSHLQ----DL
2c81A           GIGEGDEVIVPSLTWIATATAVLNVNALPVFVDVEADTYCIDPQLIKSAITDK-TKAIIPVHLFGSMANM
3dr4B           GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEA-LITPRTKAIMPVHLYGQICDM
2c7tA           GIGEGDEVIVPSLTWIATATAVLNVNALPVFVDVEADTYCIDPQLIKSAITDK-TKAIIPVHLFGSMANM
3bn1D           GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEA-LITPRTKAIMPVHLYGQICDM
3dr7B           GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEA-LITPRTKAIMPVHLYGQICDM
1cl1A           -IEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWF--DPLIGADIVKHLQPNTKIVFLEGSITMEVHDV
2btwB           --TSRSREDFFPLSQFVTQVNQAYCGVASIIVNAPETAQYSPYRVFTQDNFNEKTKAVIAPEVVAKQGTL
1cl1B           FIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWF--DPLIGADIVKHLQPNTKIVFLESPITMEVHDV
3dr4A           GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEALITP-RTKAIMPVHLYGQICDM
3dr4D           GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEALITPR-TKAIMPVHLYGQICDM
1e5eB           L-KAGDHLISDECLYGCTHALFEHALTKFGIQVDFI--NTAIPGEVKKHMK-PNTKIVYFETPTLKIIDM
1cj0B           V-EPHGRIMGLDLPDGGHLTHGFMTDKKKIAYKVNPDTGYIDYDRLEENARLFHPKLIIGTSCYSRNLDY
2btwA           ----RSREDFFPLSQFVTQVNQAYCGVASIIVNAPETAQYSPYRVFTQDNFFSNTKAVIAPEVVARQGTL
1cs1A           -LKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLFVDQGDEQALRAALAEKPKLVLVESPSNPLLRVVDI
2a7vA           DLDPAQWGVNGSPANLAVYTALLQPHDRIMGYKLNPKTGLIDYNQLALTALFRPRLIIAGTSAYARLIDY
3ecdC           LAKPGDTVLGMSLFNAL-------------QYGVSRDTMLIDYDQVEALAQQHKPSLIIGFSAYPRKLDF
2aeuA           ALKPKKVIHYLPELPGHPSIERSCKIVNAKYFESD------KVGEILNKIDKDTLVIITGSTMDLKVENF
1c4kA           LVSNGDLVLFDRNNHKSVYNSALAMAGGRPVYLQTNRNPYGELAAKVDPERWKRPFRLAVIQLGGTIYNA
3bh1C           AIELVDGSIIGATSDLLGCSSSMLLNALKHLAGIDDAIHLLSPESIEPIQTLKTVHLGSPRLHTDEVLIA
1dfoA           LLEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNIVPATGHIDYADLEKQAKEHKPKMIIGFSAYSGVVDW
3bcaA           KRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGLRTDLKAVEAKIQELGILCLHSTTACFAPDRL
3e77B           ILKAGRCADYVVTGAWAKAAEEAKKFGTINIVHPKLGSYTKIP-DPSTWNLNPDASYVYYCA--NETVHG
3d19E           C--EDTQLIEEANQFYRLEHIEQIAHSYTNETDPE------QIKRFNAEVQ-QAATNIWGFK--RKILGL
1cj0A           -VEPHGRIMGLDLPDGGHLTHGFMTDKKSMAYKVNPDTGYIDYDRLEENARLFHPKLIIGTSCYSRNLDY
1e5eA           L-KAGDHLISDECLYGCTHALFEHALTKF--GIQVDFINTAIPGEVKKHMK-PNTKIVYFETPANPTLKI
3ecdD           LAKPGDTVLGMSLFNA-------------LQYGVSRDTMLIDYDQVEALAQQHKPSLIIGFSAYPRKLDF
1dfoB           LLEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNIIDATGHIDYADLEKQAKEHKPKMIIGFSAYSGVVDW
3d19A           C--EDTQLIEEANQFYRLEHIEQIAHSYTNETDPE---------QIKRFNAEVQQAATNIWGFKRKILGL
2dkjA           LMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVRPDTELIDLEEVRRLALEHRPKVIVGASAYPRFWDF
1c8nA           Q---PAWLGTIADNYSKWRWVSLRIIYSPKCPTTTSGTVAMCLSYDRNDVAPGSRVQLSINFPPYAGYDG
3ecdB           AGHANVQPHSGAQANGAVMLALAKPGDTVLQYGVSRDTMLIDYDQVEALAQQHKSLIIAGFSAYPRKLDF
2dgmE           AAPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEAC-DENTIGVVPTFGVTYTHDA
2dgmC           GKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPGVTYTGNYEFP
3e6gB           D--AGSHVVAMDDLYGGTFRLFERVRRRTAGLDFSF-VDLTDPAAFKAAI-RADTKMVWPTNPMLKLVDI
3ei9A           MFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNITPENGFFPDLSTVIFFCSPNNPTGAAATR
1bw9A           AQLLVADTDTERVAHAVALGHTAVALEDVLSTPCDVFAPCAMGGVITTEVAR-TLDCSVVAGAANNVIAD
3dzzB           TSPGDQILVQEPVYNFYSVIEGNGRRVISSDLIYENSKYSVNWADLEEKLATPSVRVFCPHNPIGYAWSE
3e6gD           D--AGSHVVAMDDLYGGTFRLFERVRRRTAGLDFSF-VDLTDPAAFKAAI-RADTKMVWPTNPMLKLVDI
3dzzA           TSPGDQILVQEPVYNFYSVIEGNGRRVISSDLIYENSKYSVNWADLEEKL-ATPSVRVFCNPHNPIGYEV
3ecdA           LAKPGDTVLGMSLFN-------------ALQYGVSRDTMLIDYDQVALAQQHKPSLIIAGFSAYPRKLDF
2douB           LTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPLRE-DGLADLKAVPEGV-WREAKVLLLNYPNNPTGYF
1c8eA           NSSRLVHLNMPESENYKRVVVNNMDKTAVKGNMALD-DIHVEIVTPWSLVDANAWGVWFNPGDWQLIVNM
2e7jA           AKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTDYPDYAITPENFAQTIEETKKRGEVVLGNYGNLPDV
2bwoD           R-VLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDP-AAPKLIAFESVYGDFGPI
3eiaA           MFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNITPENGFFPDLSGRTDIIFFCSPAATREQL
1djeA           -MAKEDRIAADRLSHASLLEAASLSPSQLRRFA------HNDVTHLARLLACPGQQMVVTEGVFSMDAPL
2c44B           GLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFGNFDLEGLERGIEENNVPYIVATITSNSLANL
3dydB           LANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGHL
2c44A           GLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFGNFDLEGLERGIEENNVPYIVITSNSAGGQNL
1ay4B           ANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLAAKGDMVLLPTGANLTLDQW
2bwpB           RLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFR------HNDVAHLRELIAAPAAPKLIAFSMDGDFGPI
1bs0A           -MAKEDRIAADRLSHASLLEAASLSPSQLRRFA------HNDVTHLARLLACPGQQMVVTEGVFSMDAPL
1bj4A           V-EPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFNPDTGYINYDQLEENLFHPKLIITSCYSRNLEY
2dgkA           GKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTVVPTFGVTYTGNYEFP
1ax4A           LGKAKNPVFISNFHFDTTAAHVELNGCKAINIVTEKWKGDFDIKKLKENIAQHGADNIVAIVSPVSMSNL
2bwpA           R-VLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDP-AAPKLIAFESVDGDFGPI
2ch2A           -LEEGDRVLIAVNGIWAERAVEMSERYGADVRTIEPPDRPFSLETLARAIELHQPKCLFLTHGDSSSQPL
2cstA           NNNTATPVYVSSPTWENHNSVFMDAGFKDIRTYRYWDAAKRDLQGLLDDMEKEFSIFILHACAHNPTGTD
1ay4A           A-NPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYDAETRGVDFEGMKADLAAAKKGDMVLLHNLTLDQWA
3bh1A           AIELVDGSIITGATSDLLGCSSMLLNALKHLAGIDDAIHLLSPESIEP-IQTLKTVHLGPRLHTDEVLIA
2dgmA           GKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPGVTYTGNYEFP
1bjwA           -LDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLEEGFVPDPERVRRAI-TPRTKALVVNSPNNPTEVL
1eghA           -VERHQPLLEQHYATGTTGNLISRATGMNVNAMLSG-PMGGDQQVGALIS-EGKIDVLIFFWDVPHDPDV
3bs8A           RGDSLLIKAGSGVATLGLPDSPGVPEGIAKNTITVPYNDLESVKLAFQQF-GEDIAGVIVEPVAVVPPQE
2ch1A           LLEEGDRVLIAVNGIWAERAVEMSERYDVRTIEGPPDRP-FSLETLARAIELHQPKCLFLTHGDSSSQPL
3e9kA           PTPKRYKILLEAKAFPSDHYAIESQLQLHRMIKPREGEETLRIEDILEVIEKDSIAVILFSGVHFYTFNI
1bqaA           KNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDANHTLDFDALINSLNEAQAGDFHGCCHNATGIQW
1eg5B           EKRKRTIITTPIEHKAVLETKYLSKGFKVKYVPVDSRGV-VKLEELEKLVDEDTFLVSIAANEVGTIQPV
3caiA           AAGLGYEVIVSRLDDEANIAPWLRAGAKVKWAEVDIETGELPTWQWESLIS-KSTRLVAVNSASGTLGDL
1djuA           LKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNVDELKKYVT-DKTRALIINSPCNPTGDL
1ecxB           FEKRKRTIITTPIEHKAVLETMKYLSMKGFKVKYVPVDSRVKLEELEKLVD-EDTFLVSIMAAVGTIQPV
2cfbA           RAYTQREKVIKFEGC----------YHGHAATLTAPYNDLEAVSRLFEQYP-NDIAGVILEPVVGNAGFL
3bh1D           -------------------------NALKHLAGIDDAIHLLSPESIEPIQTVHLGSSNPRLHTDEV-LIA
1ay5B           MANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDATRGVDFEGMKADLAAAKKGDMVCHNPTGANLTL
3d6kD           SAEEKVKWLCPVPGYDRHFTITEHFGFEINVPTDEGPDGVVRELVKDP-----QVKGWTVPVFGNPTGVC
1c8fA           NSSRLVHLNMPESENYKRVVVNNMDKTAVKGNMAL-DDIHVEIVTPW-----------------------
2dr1B           VSKGGKVLVTIIGAFGKRYKEVVESNGRKAVVLEYEPGKAVKPEDLDDALRKNPDVEAVNETSTGVLNPL
1ejiA           VEPHGRIGLDLPHLTHGFTDKKKISATSIFFYKVYPETGYINYDQLEENASLFHPKLIIGTSCYSRNLDY
3ei7B           MFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNITPENGFFPDLSTVGRTDIIFGAAATREQL
1bkgA           -LDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEGFVPDPERVRRAIT-PRTKALVVNSPNNPTGVL
3bc8A           KRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIVLEGDELRTDLKAVEAKIQELGPEHILACFAPRVPDRL
2aatA           KNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAEHTLDFDALINSLNEAGDVVLFHGCCHNPTGIW
2bwnB           RVLFPGLIIYSDSLNHASMIEGIK-RNAGPKRIFRHNDVAHLRELIAADDP-AAPKLIAVYSMDGDFGPI
2aevA           ALKPKKVIHYLPELPGHPSIERSCKIVNAKYFESD------KVGEILNKIDKDTLVIITGSTMDLKVIEF
2eh6A           KGKNKWKFISFENSFHGRTYGSLSATGQPKFHKGFEPLVPGDIDSVYKLLDEETAGIIIEVINEASEDFL
2d61A           KNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHLDFDALINSLNEAGDVVLFHGCCHNPTGQW
3bcbA           LRHKRPKYIIWPRIDQKSCFKSMVTGFEPVVIENVLDELRTDLKAVEAKIQELGPEHILCLHSPRVPDRL
3ei6B           MFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNITPENGFFPDLSGRTDIIFFCSPNNPTGQL
2c44C           GLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKDFKGNFDLEGLERGIEEVGPNNVPYIGQPVSLANL
1aiaA           NTSVKRVWVSNP-SWPNHKSVFNSAGLEVREYAYDAENHTLDFDALINSLNEAGDVVLFHGCCHNPTGQW
1ariA           KNTSVKRVWVSNPSHPNHKSVFNSAGLEVREYAYYDENHTLDFDALINSLNEAQAGDVVPTGIDPTLEQW
1c1dB           ----------------VALGHTAVALEDVLSTPCDVFAPCAMGGVITTEVAR-TLDCSVVAGAANNVIAD
3cogD           LLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDI
1b5pA           L-DPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGVL
1b4xA           -NTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHLDFDALINSLNEAGDVVLFHGSCHNPTGQW
3eiaB           MFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNINGFFPDLSTVGRTDIIFFCSPNNPTGAAA
3e6gA           --DAGSHVVAMDDLYLFERVRRRTAGLDFSFVDLT------DPAAFKAAIR-ADTKMVWPTNPMLKLVDI
1eg5A           FEKRKRTIITTPIEHKAVLETKYLSKGFKVKYVPVDSRGVVKLEELEKLVDEDTFLVSIAANEVGTIQPV
1c7nA           TKPGDGVIIITPVYYPFFAIKNQERKIIECELLEKDGYYTIDFQKLEKLS-KDKNNKALLFCSPHKKDEL
5bj4A           -LDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGVL
2bwoB           RVLFPGLIIYSDS-LNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADD-PAAPKLIAFESVYSMDGPI
1c1dA           AQLLVADTDTERVAHAVALGHTAVALEDVLSTPCDVFAPCAMGGVITTEVAR-TLDCSVVAGAANNVIAD
7aatA           FFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPTCSLDFTGAMEDISKIPEKSIILLGVDPRQEQW
3e2yA           LVDPGDEVIIMVPFYDCYEPMVRMAGAVPVGMKWTSSDWTFDPRELESKFS-SKTKAIILNTPHNPLGEL
1djuB           FLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEDEFRLNVDELKKYVT-DKTRALIINSPVLTKKDL
1bw0B           ICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSHV
2dr1A           VSKGGKVLVTIIGAFGKRYKEVVESNGRKAVVLEYEPGKAVKPEDLDDALRKNPDVEAVNETSTGVLNPL
1c1xA           -----------------------ALGHTAVALEDVLST-PCDVFAPCAMGGARTLDCSVVAGAANNVIAD
3cq4A           -GGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMDVALEEIRAKQPDIVFVPNNPTGDVTSL
3b46A           -LNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPEWTIDFEQFEKAI-TSKTKAVIINTPHNPIGEL
3a2bA           -MGRNDYILLDERDHASIIDGSRLSFSKVIKYG------HNNMEDLRAKLSRDSAKLICTDGIFGDIVNL
3bwnC           ARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDAWGFDKKGPYIELV-----TSPNNPDGTIRETVVA
1arhA           KNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDANHTLDFDALINSLNEAGDVVLFHGCCHNPTEQW
2d5yA           KNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDANHTLDFDALINSLNEAGDVVLFHGCCHNPTGQW
3d6kA           SAEEKVKWLCPVPGYDRHFTITEHFGFEINVPTDEGPDGVVR-----ELVKDPQVKGWTVPVFGNPTGVC
1b8gA           -ADPGEAVLIPTPYYPGFDRDLKWRTGVEIVPIHCTSSNGFALEEAYQEAEKLRVKGVLVTNPSNPLNEL
1agxA           GKPYWFRSSVKKHTNNSEFNIEKIQGDALPGVQIVYGSDNMMPDAYQAFAK-AGVKAIIHAGTSMANYLV
3cogB           LLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFV--DCSKIKLLEAAITPETKLVWIPTNPTQKVIDI
2egyC           LDEGSPVLLEAPS-YMGAIQAFRLQGPRFLTVPAGEEGPDLDALEEVL-KRERPRFLYLIPSFQNPTGAR
2douA           LTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPLR-EDGLADLKAVPEGV-WREAKVLLLNYPNNPTGYF
3bwnB           ARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDAWGF-----------DKKGPYIELVTSPNNPDTIR
3cq5A           FGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMDVALEEIRA-KQPDIVFVTTPNNPTGSL
1bw0A           ICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPEDWEADLDEIRRLKD-DKTKLLIVTNPSNPCGHV
3c01F           --------------------------------------------HITIGIYFPELMPIPMISVYETNQRA
3bwnE           SRSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDAWFDK------------KGPYIELVTSPNNPD---
3c01E           --------------------------------------------HITIGIYFPELMPIPMISVYETNQRA
3caeA           YSNNQQNYSSHTYTPDFLLPN----GIFVETKGLWESDDRKKHLLIREQHPELDIRIVFSSRTKLYKGSP
3d6kC           SAEEKVKWLCPVPGYDRHFTITEHFGFEINVPT-----DEGPDGVVRELVKDPQVKGWTVPVFGNPTGTC
2bhxB           LTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLN--ENDAYLHITSNNTIYG
3d6kB           SAEEKVKWLCPVPGYDRHFTITEHFGFEINVPTDEG--PDGVVRELVKDPQVKGWTVPVFGNPTGVTFSE
5bj3A           -LDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEGFVPDPERVRRA-ITPRTKALVVNSPNNPTGVL
2d3jA           CLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCLQAE----------------------------
2b34A           LKKVQNVILVGIEAHVCTTYDLLERGLNVHVV-VDA-VSSRSHTDRHFAFKQMEGAILTTSEATILGLVG
1bxgA           -----------------------ALGHTAVALEDVLST-PCDVFAPCAMGGVITLDCSVVAGAANNVIAD
1asbA           FLTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDENHTLDFDALINSLNEAGDVVLFHGCCHNPTGQW
1b93B           VERHQPLLEQHVYATGTTGNLISRATGMNVNAMLSG-PMGGDQQVGAL-ISEGKIDVLIFFWDPPHDPDV
3d19C           RCEDTQLIEEANQFYRLFEHIEQIAHSYTNETDPE------QIKRFNAEVQ-QAATNIWGFKR--KILGL
1ei7A           --QQARTVVQRQFSEVPSPQVTVRFPDSDFKVYRYNAVLDPLVTALLGAFDTRNRIIEVETAETLDATRR
2eaaA           ELSEDDVFVIPAAYPVENNQRNFLAGGKDNVMEVLEVSFPASGKKVEK-LIKKQSESHF-----------
2e7uA           NYHGHADGLLVEAGSGALTLGVPSSAGVPEEYAKLLVLEYNDPEGLREVLKGEEIAAIIFEPVVGNAGDF
3d19B           RCEDTQLIEEANQFYRLFEHIEQIAHSYTNETDPE------QIKRFNAEVQ-QAATNIWGFKR--KILGL
3d19D           RCEDTQLIEEANQFYRLFEHIEQIAHSYTNETDPE------QIKRFNAEVQ-QAATNIWGFKR--KILGL
2bylA           GIQKYKAKIRTLSAISSSTDPTSYDGFGPFMPGFD-IIPYNDLPALERALQDPNVAAFMVEPIQGEAPDP
3bwoC           ARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGD-----------AWGFDKKGPYIELVTSPNNPDGTI
3bwnD           ARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGD-----------AWGFDKKGPYIELVTSPNNPDGT-
1asfA           KNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYDAENHTLDFDALINSLNEAGDVVLFHGCCHNPTEQW
3bwnA           ARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGD-----------AWGFDKKGPYIELVTSPNNPDGTI
3bwnF           ARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDAWG-----------FDKKGPYIELVTSPNNPD---
3bk2A           AIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTSQEELKLILNLTTPRFFLPWH--GEVRHQ


                         +         .         .         .         .         *         .:210
query           EALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIA
3bn1A           DPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSF--FGNIITTGEGGMITTNDDDLA
3dr4C           DPILEVARRHNLLVIEDAAEAVGATYR-----GKKSGSLGDCATFSFFGNA-IITTGEGGMITTNDDDLA
2ctzA           EALAQAAREKGVALIVDNTFGMGG------YLLRPLAWGAALVTHSLTKWGNFPWEGGRYPLLTEPQPGY
3bn1C           DPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSF--FGNIITTGEGGMITTNDDDLA
1b9iA           DALAKISADTGVPLLQDAAHAHGARWQG-----KRVGELDSIATFSFQNGKLMTAGEGGAVVFPD-GETE
3bcxB           AEVRRVADKYNLWLIEDCCDALGSTYDG-----KMAGTFGDIGTVSFYPAHHITMGE-GGAVFTQSAELK
1b9hA           DALAKISADTGVPLLQDAAHAHGARWQ-----GKRVGELDSIATFSFQNGKLMTAGEGGA-VVFPDGETE
3bb8A           AEVRRVADKYNLWLIEDCCDALGSTYDG-----KMAGTFGDIGTVSFYPAKHIT-MGEGGAVFTQSAELK
3bcxA           AEVRRVADKYNLWLIEDCCDALGSTYDG-----KMAGTFGDIGTVSFYPAHHITM-GEGGAVFTQSAELK
3b8xB           DEINKIIGGRDIILLEDNCESMGATFNN-----KCAGTFGLMGTFSSFYSNHIATME-GGCIVTDDEEIY
2cb1A           EALATLAEEAGVALVVDNTFGAAGA------LCRPLAWGAHVVVESLTWASG-HGSVLGGAVLSRETELW
3b8xA           DEINKIIGGRDIILLEDNCESMG-----ATFNNKCAGTFGLMGTFSSFYSNHIATME-GGCIVTDDEEIY
1dy2A           STVVRKAERFGLPIVNLKGQVLFNNWDIFSGDGGQFNT--HIPIYSFDGRDVMTDPSWPQKVVWHGSNPH
2c81A           DEINEIAQEHNLFVIEDCAQSHGSVWNN-----QRAGTIGDIGAFSCQQGKVLTAGEGGIIVTKN-PRLF
3dr4B           DPILEVARRHNLLVIEDAAEAVGATYR-----GKKSGSLGDCATFSFFGNA-IITTGEGGMITTNDDDLA
2c7tA           DEINEIAQEHNLFVIEDCAQSHGSVWNN-----QRAGTIGDIGAFSCQQGKVLTAGE-GGIIVTKNPRLF
3bn1D           DPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSF--FGNIITTGEGGMITTDDLAAK
3dr7B           DPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSF--FGNIITTGEGGMITTNDDDLA
1cl1A           PAIVAAVRSVVPDAIIMIDNTWAAGVLFKALD-----FGIDVSIQAATYLVGHSD-AMIGTAVCNARCWE
2btwB           DELGRLIASYGVVKVNHASDTNIEDFR---KQVAENLKQDGNFVIVNYLRKEIGQER-GGHISPLAAYNE
1cl1B           PAIVAAVRSVVPDAIIMIDNTWAAGVLFKALDFG-----IDVSIQAATYLVGHSDAMIGTAVCNARCWEQ
3dr4A           DPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSFFGNA-IITTGEGGMITTNDDDLA
3dr4D           DPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSFFGNAIITT-GEGGMITTNDDDLA
1e5eB           ERVCKDAHSQEGVLVIADNTFCSPMI------TNPVDFGVDVVVHSATKYINGHTDVVAGLICGK-ADLL
1cj0B           GRLRKIADENGAYLMADMAHISGLVV-----AGVVPSPFEHCHVVTTTTHKTLRG-CRAGMIFYRRGVRS
2btwA           DELGRLIASYGVKVKVNHASDTN----IEDFRKQVAENLKQNFVIVNYLRKEIGQER-GGHISPLAAYNE
1cs1A           AKICHLAREVGAVSVVDNTFLSPALQN---------PLALGADLVLHSCTYLNGHSDVVGVVIAKDPDVV
2a7vA           ARMREVCDEVKAHLLADMAHISGLVAAK-----VIPSPFKHADIVTTTTHKTLRGARSG-LIFYRKGVKA
3ecdC           ARFRAIADSVGAKLMVDMAHIAGVIAA-----GRHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDEEIAK
2aeuA           KKVINTAKNKEAIVFVDDASGAR----VRLLFNQPPALKLGADLVVTSTDKLMEGPR-GGLLAGKKELVD
1c4kA           HEVVKRIGHLCDYIEFDSAWVGYEMRNSSPLLIDDLGPEDPGIIVVQSVHKQQAGFSQTSQIHKKDSHIK
3bh1C           LSVSAATDSNAQKALDQLKNLRGCDV-------------HTTTILGS--VD-EGIFRNLGVLVTSDPKFQ
1dfoA           AKMREIADSIGAYLFVDMAHVAGLVAAG-----VYPNPVPHAHVVTTTTHKTLAGPR-GGLILAKGGSE-
3bcaA           EELAVICANYDIPHVVNNAYGLQSSKCMHLIQQG--ARVGRIDAFVQSLDNFMVPVGGAIIAGFNEPFI-
3e77B           VEFDFIPDVKGAVLVCDMSSNFLSKP----------VDVSKFGVIFAGAQKNVGSAG-VTVVIVRDDLLG
3d19E           ILTCKLPGQNNFPLLVDHTSREADYFRKRLIQLNEGKLDALPDAIIKENVFFLRIMADHALLDPSERKLV
1cj0A           GRLRKIADENGAYLMADMAHISGLV-----VAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFY--RRGVR
1e5eA           IDMERVCKSQEGVLVIADNTFCSPMI------TNPVDFGVDVVVHSATKYIN-GHTDVVAGLICGKADLL
3ecdD           ARFRAIADSVGAKLMVDMAHIAGVIAA-----GRHANPVEHAHVVTSTTHKTLRGPRGGFVLTND-----
1dfoB           AKMREIADSIGAYLFVDMAHVAGLVAA-----GVYPNPVPHAHVVT--TTTHKTLAGPRGGLILAKGGSE
3d19A           ILTCKLPGQNNFPLLVDHTSREADYFRKRLIQLNEGKLDALPDAIIKENVFFLRIMADGHLLDPSERKLV
2dkjA           KAFREIADEVGAYLVVDMAHFAGLVAAG-----LHPNPLPYAHVVTSTTHKTLRGPRGGLILSNDPE---
1c8nA           AAILNTDVTPTSAIYVDVDVTRFDKAWYSTIGTAAFAALTAFDQNQFCPCTVHIGSDGGPAVAVPPGDIF
3ecdB           ARFRAIADSVGAKLMVDMAHIAGVIAAG-----RHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDEEIAK
2dgmE           LDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFR-LPRVKSISASGHKFGLAPLGCGWVIWRDEEAL
2dgmC           QPLHDALDGIDIDMHIDAAS-GGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGGWVIWRDEEALP
3e6gB           AAIAVIARKHGLLTVVDNTFASP---------MLQRPLSLGADLVVHSATKYLNGHSDGIAVVGDNAELA
3ei9A           EQLTQLVEKNGSIIVYDSAY-AMYMSDDNPRSIFEIPGAEEVAMETASFSNYAGFTGVRLGWTVIPKKLL
1bw9A           EAASDILHARGILYAPDFVANAG-GAIHLVGRESVVHERAVAIGDTLNQVFEISD-NDGVTPDEAARTLA
3dzzB           EEVKRIAEKHQVLLISDEIHGDLVLTDITPAFTVDWDAKNWVVSLISPSTFN-LAALHAACAIIPNPDLR
3e6gD           AAIAVIARKHGLLTVVDNTFASP---------MLQRPLSLGADLVVHSATKYLNGHSDGIAVVGDNAELA
3dzzA           KRIAELCAKHQVLLISDEIHGDLVLTDEDITPAFTVDWDAKNWVVSLISPSTFNLAALHAACAIIPNPDL
3ecdA           ARFRAIADSVGAKLMVDMAHIAGVIAAG-----RHANPVEHAHVVTSTTHKTLRGPRGGF-VLTNDEEIA
2douB           EEALGLARKHGLWLIHDNPYVDQV-YEGEAPSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEA-
1c8eA           SELHLVSFEQEIFNVVLKTVSESATQ--------------------------------------------
2e7jA           KKIAKVCSEYDVPLLVNGAYAIGR--------MPVSLKEIGADFIVGSGHKSMAASGPIGVMGMKEEWAE
2bwoD           KEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAKAYGVFGGYIAASARMVD--
3eiaA           TQLVEFAKKNGSIIVYDSAYAMYMSDDNPRS-IFEIPGAEEVAMETASFSQYAGFTGVRLGWTVIPKKLL
1djeA           AEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKVKPELLVVTF-----GKGFGVSGAAVLCSSTVA
2c44B           KAMYSIAKKYDIPVVMDSARFAFIKQREAEYKDWTIEQIKYADMLAMSAKKDAM-VPMGGLLCMKDDSFF
3dydB           QKILAVAARQCVPILADEIYGDMVFSDCKYEPLATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDI
2c44A           KAMYSIAKKYDIPVVMDSARFAEAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
1ay4B           AEIASILEKTGALPLIDLAYQFGDGLEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADA
2bwpB           KEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAKAYGVF--GGYIAASARMV-
1bs0A           AEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQK--VKPELLVVTFGKGFGVSGAAVLC----SSTV
1bj4A           ARLRKIADENGAYLMADMAHISGLVA------AGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVKS
2dgkA           QPLHDALDKFQADTGIDIDMHIDGGFLAPFVAPDIVWDFRRVKSISASGHKFGLAPLGCGWVIWRDEEAL
1ax4A           KEVYEIAKQHGIFVVMDSARFENAYFIKARDPKYKNATIKEVIFDMYKYADALTMSAKDPLLNIGGLVAI
2bwpA           KEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAKAYGVFGGYI--------AA
2ch2A           EGVGQICHQHDCLLIVDAVASLCG--------VPFYMDKWEIDAVYTGAQVLGAPPGITPISISKVFYWD
2cstA           PTPDEWKQRRCLFPFFDSAYQGFASGDKDAWAVRYFVSEGFELFCAQSFSKNFGLYNERVGNLSVVGKDE
1ay4A           EIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADA
3bh1A           LSVSAATDSNAQKALDQLKNLRGCDVH-----TTTILGSVDEGIFRN-----------LGVLVTSDPK--
2dgmA           QPLHDALDGIDIDMHIDAASGGFLAPFVAPDIVWDFR-LPRVKSISASGHKFGLAPLGCGWVIWRDEEAL
1bjwA           EALARLAVEHDFYLVSDEIYEHL----LYEGEHFSPGRVAPEHTLTVNGAAAFAMTGWRIGYACGPKEVI
1eghA           KALLRLATVWNIPVATNVATADFIIQ-----SPHFNDAV-DILIPDY--QRYLA----------------
3bs8A           GFLQGLRDQYGSLLIFDEVMTGFRV------DYNCAQGYFGVTPDLTCLGKVIGGGLPVGAYGGKAEIME
2ch1A           EGVGQICHQHDCLLIVDAVASLCGVP--------FYMDKWEIDAVYTGAQVLGAPPGITPIISPKALDVI
3e9kA           PAITKAGQAKGCYVGFDLAHAVGNVE------LYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEELSTR
1bqaA           QTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSNFGLYNERVGACTLVAADS
1eg5B           EDVTRIVKKKNKETLVHVDAVQTIGKIPFSLEKL------EVDYASFSAHKFHGPKGVGITYIRKGVPIR
3caiA           RAMTKLVHDVGALVVVDHSAAAPYRL------LDIRETDADVVTVNA--HAWGGPPI-GAMVFRDPSVMN
1djuA           EEIADFVVEHDLIVISDEVYEHFIYDDARHYSIASLDGMFERTITVNGFSKTFAMTGWRLGFVAAPSWII
1ecxB           EDVTRIVKKKNKETLVHVDAVQT------IGKIPFSLEKLEVDYASFSAHKFHGPKGVGITYIRKGVPIR
2cfbA           EGLRELTKQYGALLVFDEVMTGFRIAYG------GAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRAE---
3bh1D           LSVSAATDSNAQKALDQLKNLRGCDVH-----TTTILGSVDEGIFRN-----------LGVLVTSDPK--
1ay5B           DQWAEIASKTGALPLIDLAYQGFGGLEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADA
3d6kD           RELAESTAAPDFRIVWDNAYASDEFPIVHNVIEFAQAAGNPNRFWFSSTSKITHA-GSGVSFFASSKENI
1c8fA           ----------------------------------------------------------------------
2dr1B           PELAKVAKEHDKLVFVDAVSAMGG--------ADIKFDKWGLDVVFSSSQKAFGVPPGLAIGAFSERFLE
1ejiA           ARLRKIADDNGAYLADAHIS----------GLVAAGVVPSPFEHCHVVTTTTHKTLCRAGIFYRKGVRSV
3ei7B           TQLVEFAKKNGSIIVYDSAY-AMYMSDDNPRSIFEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKLL
1bkgA           EALARLAVEHDFYLVSD---EIYEHLLYEGEHFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVI
3bc8A           EELAVICANYDIPHVVNNAYGLQSSKCMHLIQQG--ARVGRIDAFVQSLDNFMV-PVGGAIIAGFNEPFI
2aatA           QTLAQLSVEKGWLPLFDFAYQGFARGEEDAEGLRAFAAMHKELIVASSYSANFGLYNERVGACTLVAADS
2bwnB           KEICDIAEEFGALTYIDEVHAYGPRGAGVAERD-------GLMHRIDIFNGTLAAYGVFGGYIAASARMV
2aevA           KKVINTAKNKEAIVFVDDASGARVRLLF-----NQPPALKLGADLVVTSTDLM-EGPRGGLLAGKKELVD
2eh6A           SKLQEICKEKDVLLIIDEVQTGIGRTGE-----FYAYQHFNLKPDVIALAKGLGGGVPIGAILAREEV--
2d61A           QTLAQLSVEKGWLPLFDFAYQGFAGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADS
3bcbA           EELAVICANYDIPHVVNNAYGLQSSK--CMHLIQQGARVGRIDAFVQSLDNFMVPVG-GAIIAGFNEPFI
3ei6B           TQLVEFAKKNGSIIVYDAYAMYMSDDNPRSIFEIPGAEEVAMETASF--SKYAGFTGVRLGWTVIPKKLL
2c44C           KAMYSIAKKYDIPVVMDSARFAEEAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFF
1aiaA           QTLAQLSVEKGWLPLFDFAYQGFARGEEDAEGLRAFAAMHKELIVASSYSHNFGLYNERVGACTLVAADS
1ariA           QTLAQLSVEKGWLPLFDFAYQGFARGEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADS
1c1dB           EAASDILHARGILYAPDFVANAGGAI--------------------------------------------
3cogD           EGCAHIVHKHGDIILVVDNTFMSPYF------QRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLH
1b5pA           EALARLAVEHDFYLVSDEIYEHLL---YEGEHFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVI
1b4xA           QTLAQLSVEKGWLPLFDFAYQFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADS
3eiaB           QLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVAMETASF--SQYAGFTGVRLGWTVIPKKLL
3e6gA           AAIAVIARKHGLLTVVDNT--------FASPMLQRPLSLG-ADLVVHSATKYLNGHSDGGIAVVGDNELA
1eg5A           EDVTRIVKKKNKETLVHVDAVQT----IGKIPFSLEKLEVDYASFSA--HKFHGPKGVGITYIRKGVPIR
1c7nA           QKIKDIVLKSDLMLWSDEIHFLIMPGYEHTVFQSIDEQLADKTITFTAPSKTFNIAGMGMSNIIIKNP--
5bj4A           EALARLAVEHDFYLVSDEIY---EHLLYEGEHFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVI
2bwoB           KEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAKAYGVFGGYIAASARMVD--
1c1dA           EAASDILHARGILYAPDFVANAG-----------------------------------------------
7aatA           KELASVVKKRNLLAYFDMAYQGFGDINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGERAGAFTVICRDA
3e2yA           QVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLI
1djuB           EEIADFVVEHDLIVISDEVYEHFIYDDARHYSIASLDGMFERTITVNGFSKTFAMTGWRLGFVAAPSWII
1bw0B           EDIVRLAEELRLPLFSDEIYAGMKGKDPNATFTSVADFETTVPRVILGGTANLVVPGWRLGWLLYVDPHG
2dr1A           PELAKVAKEHDKLVFVDAVSAMGG--------ADIKFDKWGLDVVFSSSQKAFGVPPGLAIGAFSERFLE
1c1xA           EAASDILHARGILYAPDFVANAG-----------------------------------------------
3cq4A           DDVERIINVAPGIVIVDEAYAEF---SPSPSATTLLEKYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFI
3b46A           TTLGNICVKHNVVIISDEVY-EHLYFTDSFTRIATLSPEIGQLTLTVGSAGSFAATGWRGWVLSLNAELL
3a2bA           PELTSIANEFDAAVMVDDAHSLGVIGHKGAGTASHFGLNDDVDLIMGTFSKSLA--SLGGFVAGDADVI-
3bwnC           KVIHDFAYYWPHYTPITRRQ--------------------DHDIMLFTFSITGHAGSRIGWALVKDKEVA
1arhA           QTLAQLSVEKGWLPLFDFARQGFAGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADS
2d5yA           QTLAQLSVEKGWLPLFDFAYQGFRGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADS
3d6kA           RELAESTAAPDFRIVWDNAYALDEFPIVHNVIEFAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIE
1b8gA           YLLLSFVEDKGIHLISDEIYSGT---AFSSPSFISVMEVLKDRNCDENS----EVWQRVHVVYSLSKDLG
1agxA           PEVRKLHDEQGLQIVRSSRVAQGF---VLRNAEQPDDKYGWIAAHDLNPQKARLLMALALTKTNDAKEIQ
3cogB           EGCAHIVHKHGDIILVVDNTFMSPYF------QRPLALGADISMYSATKYMNGHSDVVMGLVSVN-----
2egyC           KRLLQMVMERGLVVVEDDAYRELGEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQ
2douA           EEALGLARKHGLWLIHDNPY-VDQVYEGEAPSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEA-
3bwnB           ETVVNRPDDDEAKVIHDFAYYWPHY------TPITRRQDHDIMLFTF--SKITGHAGSRGWALVKDKEVA
3cq5A           DDVERIINVAPGIVIVDEAYAEFS---PSPSATTLLEKYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFI
1bw0A           EDIVRLAEELRLPLFSDEIYAGMKGKDPNATFTSVADFETTVPRVILGGTANLVVPGWRLGWLLYVDPHG
3c01F           LAVRAYAEKVGVPVIVDIKLARSLFKT------HRRYDLVSLEEI-------------------------
3bwnE           ----------GTIRETVVEAKVIHDFAYYWPHYTPITRRQDHDIMLFTFSKITGAGSRIGWALVKDKEVA
3c01E           LAVRAYAEKVGVPVIVDIKLARSLFKT------HRRYDLVSLEEI-------------------------
3caeA           TSYGEFCEKHGIKFADKLIPA-------------------------------------------------
3d6kC           RELAESTAAPDFRIVWDNAYLSDEFPIVHNVIEFAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIE
2bhxB           TQYQNFPEINHAPLIADMSSDIL----------SRPLKVNQFGMIYAGAQKNLGPSGVTVVIKKDLLVEQ
3d6kB           QTCRELAEAPDFRIVWDNAYALSDEFPIVHNVIEFAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENI
5bj3A           EALARLAVEHDFYLVSDEIYEHLEGEHFSPGRVAPEHTL----TVNGAAKAFAMTGWRIGYACGPKEVIK
2d3jA           ----------------------------------------------------------------------
2b34A           GSDH-PKFKEVQKLILTSAPDTG-----------------------------------------------
1bxgA           EAASDILHARGILYAPDFVANAG-----------------------------------------------
1asbA           QTLAQLSVEKGWLPLFAFAYQFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADS
1b93B           KALLRLATVWNIPVATNVAT--------------------------------------------------
3d19C           ILTCKLPGQNNFPLLVDHTSREADYFRKRLIQLNEGKLDALPDAIIKENVFFLRIMADGHLLDPSERKLV
1ei7A           VDDTVAIRSAINNLIVE-----------------------------------------------------
2eaaA           ----------------------------------------------------------------------
2e7uA           LKALHEAKAYGVLLIADEVMTGF-----------------------------------------------
3d19B           ILTCKLPGQNNFPLLVDHTSREADYFRKRLIQLNEGKLDALPDAIIKENVFFLRIMADGHLLDPSERKLV
3d19D           ILTCKLPGQNNFPLLVDHTSREADYFRKRLIQLNEGKLDALPDAIIKENVFFLRIMADGHLLDPSERKLV
2bylA           GYLMGVRERHQVLFIADEIQ-TGLARTGRWLAVDYENVRPDIVLLG----KALSGGLYPVSAVLCDDDIM
3bwoC           RETVVAKV-----IHDFA---------YYWPHYTPITRRQDHDIMLFTFSITGHAGSRIGWALVKDKEVA
3bwnD           ----IRETVVNAKVIHDFAYYWPHYT------PITRRQDHDIMLFTF--SKITGHAGSRGWALVKDKEVA
1asfA           QTLAQLSVEKGWLPLFDFAFQFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNEVGACTLVAADSE
3bwnA           ----RETVVDEAKVIHDFAYYWPH--------YTPITRRQDHDIMLFTFSKITGHAGSIGWALVKDKEVA
3bwnF           --GTIRETVVAKVIHDFA---------YYWPHYTPITRRQDHDIMLFTFSKITGHAGSRGWALVKDKEVA
3bk2A           NFKWLAESSRPTLIGEN-----GAVYRLTRETFEKVGEVPHGVLY-------------------------


                         .         .         .         +         .         .         .:280
query           EESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPR
3bn1A           AKMRLLRGQGMDPRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPH
3dr4C           AKMRLLRGQGMDPRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPH
2ctzA           HGLRLTEAFGIVKARVDGLRDQGQALGPFEAWVVLLGMETLSLRAERHVENTLHLAHWLQPQVAWVNYPG
3bn1C           AKMRLLRGQGMDPRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPH
1b9iA           KYETAFLRHSDDRRYFHKIAGSNMRLNEFSASVLRAQLARLDEQIAVRDERWTLLSRLLGADGVVPQGGD
3bcxB           SIIESFRDWGYDHKYTYSHLGYNLKITDMQAACGLAQLERIEEFVEKRKANFKYLKDALQSCADFIELPE
1b9hA           KYETAFLRHSDDRRYFHKIAGSNMRLNEFSASVLRAQLARLDEQIAVRDERWTLLSRLLGDGVVPQGGDV
3bb8A           SIIESFRDWGYDHKYTYSHLGYNLKITDMQAACGLAQLERIEEFVEKRKANFKYLKDALQSCADFIELPE
3bcxA           SIIESFRDWGYDHKYTYSHLGYNLKITDMQAACGLAQLERIEEFVEKRKANFKYLKDALQSCADFIELPE
3b8xB           HILLCIRAHGFEESFKFVLPGYNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKDHPYLDVQQE
2cb1A           RNYPQFLQPWPERVRTLGLSLCGMALSPFNAYLLFQGLETVALRVARMSETARFLAERLQGHPKVKALRY
3b8xA           HILLCIRAHGFEESFKFVLPGYNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKDHPYLDV---
1dy2A           GVRLVDKYCEAWRTTDMAVTGFASPLS-------------------------------------------
2c81A           ELIQQLRADSMQLVKKGDIQGSNYCLSEFQSAILLDQLQELDDKNAIREKNAMFLNDALSKIDKVMKRPP
3dr4B           AKMRLLRGQGPNRRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLAGNRVTKPHVA
2c7tA           ELIQQLRADSMQLVKKGDIQGSNYCLSEFQSAILLDQLQELDDKNAIREKNAMFLNDALSDGIKVMKRPP
3bn1D           MRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARNRVTKPHVA
3dr7B           AKMRLLQGMDPNRRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARNRVTKPHVA
1cl1A           QLRENAYLMGQMDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFWKR
2btwB           QTDRFLIDVSYPPVWVKTTDLWKANTVDSVSQKTRGFV--------------------------------
1cl1B           LRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFWKR
3dr4A           AKMRLLRGQGPNRRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARNRVTKPHVA
3dr4D           AKMRLLRGQGPNRRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPH
1e5eB           QQIRMVGIKDITGPHDAWLITRGLSTLNIRMKAESENAMKVAEYLKSHPAVEKVYYPGFEDHEGHDIAKK
1cj0B           VDKEILYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTPEFKEYQRQVVANCRALSAALVELGYKI
2btwA           QTDRFLIDVSYPPVWVKTTDLWKANTVDSVSQKTRGFV--------------------------------
1cs1A           TELAWWANNIGVTGFDSYLLLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPENQGHEIAAR
2a7vA           VDPKTGREIPFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGG
3ecdC           -------------KINSAVGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKA--GGVDLVT
2aeuA           KIYIEGTKFGLEAQPPLLAGI----YRALKNFNLERIRKAFERAKNFDLSKIEKLNKELKAID-DNINIV
1c4kA           GQLRYCDHFNNSFNLFMSTSPFYPMYAALDVNAAMQEGEAGRKLWHDLLITTIEARKKLIKAGSMFR---
3bh1C           K---------------------------------------------------------------------
1dfoA           ---ELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVVSGG
3bcaA           ----------QDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKEAHNERLLQ
3e77B           FALRECPSVLAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPV
3d19E           DTARNFSND-FDELMYQAIDLESMKPQSQTAPLLDQFLDQNRVSVASLRDFKKTARDLIEQCKIKSII--
1cj0A           SVDILYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTPEFKEYQRQVVANCRALSAALVELGYKIV
1e5eA           QQIRMVGIKDITGPHDAWLITRGLSTLNIRMKAESENAMKVAEYLKSHPAVEKVYYPGFEDHEGHDIAKK
3ecdD           --------EEIAKKINSAVGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKA--GGVDLV-
1dfoB           E---LYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVVSGG
3d19A           DTARNFSNDFD-ELMYQAIDLESMKPQSQTAPLLDQFLDQNRVSVASLRDFKKTARDLIEQCKIK-----
2dkjA           ----LGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEY---SRLVVENAKRLAEELARRGYRIV
1c8nA           FK--------------------------------------------------------------------
3ecdB           KINSAVFPG-----------PLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTG-
2dgmE           PQELVFNVDGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEI--AKLGPYEFI
2dgmC           QELVFNVLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICT
3e6gB           EQMAFLQ---------------------------------------------------------------
3ei9A           YSGFPVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGG-
1bw9A           GR--------------------------------------------------------------------
3dzzB           ARAEESFFLA---------GIGEPNLLAIPAAIYEEGHDWLRELKQVLRDNFAYAREFLAKEVPEVKVLD
3e6gD           EQMAFLQ---------------------------------------------------------------
3dzzA           RA--------RAEESFFLAGIGEPNLLAIPAAI-AAYEEGHDWLRELKQVLRDNFAYAREFAKEVPEVKV
3ecdA           KKINSAVFGP-----------LMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDLKAGGVDLVTGGT
2douB           -------LARLERVKGVIDFNQYAGVLRMGVEALKTPKEVVRGYARVYRERALGMAEALKG-VLSLLPP-
1c8eA           ----------------------------------------------------------------------
2e7jA           IVLRRS--EKYKNKEVELLGCTARGATIITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQL---
2bwoD           ------AVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHG
3eiaA           YSDGFPVAKDFNRIITCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGG-
1djeA           DYLLQ-FARHLI---------YSTSMPPAQAQALRASLAVIDEGDARREKLAALITRFRAG---------
2c44B           D--VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQA-
3dydB           FGNEIRDGLVKLSQRIL--GPCTIVQGALKSILCRTPGEFYHNTLSFLKSNADLCYGALAAIPGLRP---
2c44A           VYTECRTLCVVQ---EGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQAG
1ay4B           A--TRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQ---------
2bwpB           ----------------------------------------------------------------------
1bs0A           ADYLLQFARH----LIYSTSMPPAQAQALRASL---AVIRSDEGDARREKLAALITRFR-----------
1bj4A           VDPATGKEILSLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKI
2dgkA           PQELVFNVGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICT
1ax4A           RDNEEILARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEGTEEEYLHYRIGQVKYLGDRLREAGIPIQYPT
2bwpA           SARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHG
2ch2A           LLLLGNYWGCYDEPKRYHHTVASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFVKD
2cstA           DN---VQRVLSQMEKIVRTTWSNPPSQGARIVATTLTSQLFAEWKDNVKTMAD-----------------
1ay4A           A--TRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQ---------
3bh1A           ----------------------------------------------------------------------
2dgmA           PQELVFNVDGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAK--LGPYEFI
1bjwA           K------------AMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRR------------
1eghA           ----------------------------------------------------------------------
3bs8A           QIAPSGPIY-----QAGTLSGNPLAMTAGLETLKQLTPDSYKNFIKKGDRLEEGISKAAEAHGIPHT---
2ch1A           RNRRTKSKVFYWDLLLLGNYVASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFV--
3e9kA           FKMDNKLQLIPGVCGFRISNPPILLVCSLHASLEIFKQATMKALRKKSVLLTGYLEYLIKHNYGVVNIIT
1bqaA           ETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMR--------------------
1eg5B           PLIHGGGQERGLRSGTQ----------NVPGIVGAARAEIAVEELSEAAKHEKLRSKLVSGNLGAHIITP
3caiA           SFGSVSTNPYLLAGVVASIEYLAALDESARGSRRERLAVSMQSADAYLNRVFDYLMVSLRS---------
1djuA           ERMVKFQMYNATCPVTFIQYAAAKALKDERSW------KAVEEMRKEYDRRRKLVWKRLNEMGLPTVKP-
1ecxB           PLIHGGGQE-----RGLRSGTQNVPGIVGAARAMEIAVEELSEAAKHMEKLRSKLVSGLMN---------
2cfbA           ------IMKMVAPAGPTLSGNPLAMTAGIKTLEILSRPGSYEHLDRITGKLVQGLLDAAREFGHEVCGG-
3bh1D           ----------------------------------------------------------------------
1ay5B           A--TRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLRE--QLAGELRD
3d6kD           EWYASHANVR------------------------------------------------------------
1c8fA           ----------------------------------------------------------------------
2dr1B           IAEKMPERGWVKYLKEKESTPSTPPMPQVFGINVALRIIEKMGGKEKWLEMYEKRAKMVREREIGLDILA
1ejiA           DPKTGKETYYELESLINSAVLQGGPHNHAIAGVAVALKQATTEFKIYQLQVLANCRALSD--ALTELGYK
3ei7B           YSGFPVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGG-
1bkgA           KAMASVSSQ------------STTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRR------------
3bc8A           QDISKMYPGR----------ASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKEAHNERLLQ
2aatA           ETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDAL--RAIWEQELTDMRQRIQRM------------
2bwnB           D-----AVRSYAPGFIFSTSLPPAIAAGAQASIAFLK---TAEGQKLRDAQQMHAKVLKMRLKALGMPII
2aevA           KIYIEGTKFG------------------------------------------------------------
2eh6A           -----------AQSFTPGSHGSTFGGNPLACRAGTVVVDEVEKLLPHVREVGNYFKEKLKE---------
2d61A           E--TVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQ----------
3bcbA           Q----------DISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKEAHNERLLQ
3ei6B           YSGFPVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGK
2c44C           DVYTECRTLCVVQEGFPTYGGLEGGAMERLAVGL--YDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQAG
1aiaA           ETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDAL--RAIWEQELTDMRQRIQRMRQ----------
1ariA           ETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMR--QRIQRMRQ----------
1c1dB           ----------------------------------------------------------------------
3cogD           NRLRFLQNS------------LGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLEPWVEKVIYPG
1b5pA           K------------AMASVSRQSTTSPDTIAQWATLEALTNQE-ASRAFVEMAREAYRRRRD---------
1b4xA           ETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMR--------------------
3eiaB           YSGFPVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGG-
3e6gA           EQMAFLQ---------------------------------------------------------------
1eg5A           PLIHGGGQER----------GLRSGTQNVPGIVGAARAEIAVEELSEAAKHEKLRSKLVSGNLGAHIITP
1c7nA           ----DIRERFTKSRDATSGMPFTTLGYKACEICYKECGKWLDGCIKVIDKNQRIVKDFFEVNHPEIKAPL
5bj4A           ---------KAMASVSR---QSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRD----------
2bwoB           ------AVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHG
1c1dA           ----------------------------------------------------------------------
7aatA           EEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMA--------------------
3e2yA           K---------------------------------------------------------------------
1djuB           E-------RMVKFQMYNATCPVTFIQYAAAKALKDERWKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKP-
1bw0B           N--GPSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHLDQI---VAKIEESAMYLYNHIGECIGLAP
2dr1A           IAEKMPERGWYFDIPLYVKYLKPQVFGINVALRIIEKMGGKEKWLEMYEKRAKMVREGVREIGLDIL---
1c1xA           ----------------------------------------------------------------------
3cq4A           DAVMLVRLP-----------YHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSE
3b46A           SYAAKAHTRICFASPSPLQEAC------ANSINDALKIGYFEKMRQEYINKFKIFTSIFDELGLPYTAPE
3a2bA           ----------------------------------------------------------------------
3bwnC           KKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESENFFKYGREMMKNRWEKLREVVKE-SDAFTLPK
1arhA           ETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDAL--RAIWEQELTDMRQRIQRMRQ----------
2d5yA           ETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDAL--RAIWEQELTDMRQRIQRMRQ----------
3d6kA           WYASHANVRG------------------------------------------------------------
1b8gA           LPGFRVGAIYSNDDMVVAAFGLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVS-GLQKSGIS
1agxA           N---------------------------------------------------------------------
3cogB           ----------------------------------------------------------------------
2egyC           KLVQAKQGADLHTPMLNQMLVHELLKEGFSERLERVRRVYREKAQAMLHALDREVPKEVRY---------
2douA           -----------LARLERVKGVIDFNQYAGVLRMGVEALKTPKEVVRGARVYRERALGMAEKGVLSLLPP-
3bwnB           KKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESENFFKYGREMMKNRWEKLREVVKESDAFTLPKY
3cq5A           D--------------AVMLVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAAREELGYAVVP
1bw0A           N--GPSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGECIGLAP---
3c01F           ----------------------------------------------------------------------
3bwnE           KKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSES-ESENFFKYGREMMKNRWEKLREVKESDAFTLP
3c01E           ----------------------------------------------------------------------
3caeA           ----------------------------------------------------------------------
3d6kC           WYASHANVRG------------------------------------------------------------
2bhxB           VPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGH-
3d6kB           EWYASHANVR------------------------------------------------------------
5bj3A           AMASVSR-------------QSTTSPDTIAQWATLEALTNQE-ASRAFVEMAREAYRRRRD---------
2d3jA           ----------------------------------------------------------------------
2b34A           ----------------------------------------------------------------------
1bxgA           ----------------------------------------------------------------------
1asbA           ETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMR--------------------
1b93B           ----------------------------------------------------------------------
3d19C           DTARNFSND-------------------------------------------------------------
1ei7A           ----------------------------------------------------------------------
2eaaA           ----------------------------------------------------------------------
2e7uA           ----------------------------------------------------------------------
3d19B           DTARNFSND-------------------------------------------------------------
3d19D           DTARNFSND-------------------------------------------------------------
2bylA           L---------------------------------------------------------------------
3bwoC           KKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESE-SENFFKYGREMMKNRWEKLREVKESDAFTLP
3bwnD           KKMVEYI---------------------------------------------------------------
1asfA           TVDRAFSQMKAAIRANYSNPPAHGAS-VVATILSNDALRAIWEQELTDMR--------------------
3bwnA           KKMVEYI---------------------------------------------------------------
3bwnF           KKMVEY----------------------------------------------------------------
3bk2A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSK
3bn1A           VALTGRHVFWMYTVRLGEGLSTTRDQVIKDLDALGIESRPVFH-PMHIMPPYAHLAT--DDLKIAEACGV
3dr4C           VALTGRHVFWMYTVRLGEGLSTTRDQVIKDLDALGIESRPVFH-PMHIMPPYAHLAT--DDLKIAEACGV
2ctzA           LPHHPHHDRAQKYTFGLKGGYEAAKRFISRLKLISHLANVGDTRTLAIHPASTTHSQLSPEEQAQAGVSP
3bn1C           VALTGRHVFWMYTVRLGEGLSTTRDQVIKDLDALGIESRPVFH-PMHIMPPYA--HLATDDLKIAEACGV
1b9iA           VRADRNSHYMAMFRIPGLTEERRNALVDRLVEAGLPAFAAFRAIYRTDAFWELSVDAIARRCPNTDAISS
3bcxB           ATENSDPSWFGFPITLKEDSGVSRIDLVKFLDEAKVGTRLLFAGNLTRQPYFHDKYRVVGELTNTDRIMN
1b9hA           RADRNSHYMAMFRIPGLTEERRNALVDRLVEAGLPAFAAFRAIYRTDAFWELGAPDESARRCPNTDAISS
3bb8A           ATENSDPSWFGFPITLKEDSGVSRIDLVKFLDEAKVGTRLLFAGNLTRQPYFHDVKRVVGELTNTDRIMN
3bcxA           ATENSDPSWFGFPITLKEDSGVSRIDLVKFLDEAKVGTRLLFAGNLTRQPYFHDVKRVVGELTNTDRIMN
3b8xB           ---TGESSWFGFSFIIKKDSGVIRKQLVENLNSAGIECRPIVTGNFLKNTDVLKYFDVHNNVDNAEYLDK
2cb1A           PGLPEDPAHRNARILTLDLGDLERASRFLGAIRLLKAANLGDARTLLVHPWTTTHSRLKEEARLQAGVTP
3b8xA           QQETGESSWFGFSFIIKKDSGVIRKQLVENLNSAGIECRPIVTGNFLKNTDVLKYFDVHNNVDNAEYLDK
1dy2A           ----------------------------------------------------------------------
2c81A           QVSRQTYYGYVFRDPVKFGGLNADQFCEILREKLNMGTFYLHPPPVHKNPLFTEAYWRGLHYPVSERASG
3dr4B           LTGRHVFWMYTVR--LGEGLSTTRDQVIKDLDALGIESRPVFH-PMHIMPPYAHLAT--DDLKIAEACGV
2c7tA           QVSRQTYYGYVFRFDPVKFGGLNADQFCEILREKLNMGTFPPYLPVHKNPLFTEAYWRGLHYPVSERASG
3bn1D           LTGRHVFWMYTVRLGEGLSTTRDQVIKDLDALGIESRPVFHPMHIMPPYAHLA-----TDDLKIAEACGV
3dr7B           LTGRHVFWMYTVRLGEGLSTTRDQVIKDLDALGIESRPVFHPMHIMPPYAHLA-----TDDLKIAEACGV
1cl1A           DFTGSSGLFSF--VLKKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEH--IAAIRPQGEIDFSG
2btwB           ----------------------------------------------------------------------
1cl1B           DFTGSSGLFSF--VLKKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEH--IAAIRPQGEIDFSG
3dr4A           LTGRHVFWMYTVRLGEGLSTTRDQVIKDLDALGIESRPVFHPMHIMPPYAHLA-----TDDLKIAEACGV
3dr4D           VALTGRHVFWMYTVRLGEGLSTTRDQVIKDLDALGIESRPVFH-PMHIMPPYAHLAT--DDLKIAEACGV
1e5eB           QMRMYGSMITFILKSGFEGAKKLLDNLKLI----TLAVSLGGCESLIQHPASMTHAVVPKEEREAAGITD
1cj0B           VTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDKSALRPSGLRSRGLLEKDFQKVAHFIH
2btwA           ----------------------------------------------------------------------
1cs1A           QQKGFGAMLSF----ELDGDEQTLRRFLGGLSLFTLAESLGGVESLISHAATMTHAGMAPEARAAAGISE
2a7vA           TDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPSRQFREDDFRRVVDFID
3ecdC           GGTDNH-LLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRPAGTTRGFGAVGRLILE
2aeuA           YERTPTGFVIKRV---------------------------------------------------------
1c4kA           PFVPPVVNGKKW----------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
1dfoA           ----------------------------------------------------------------------
3bcaA           TPHNPISLAMTLKTIDGHHDKAVTQLGSMLFTRQVSGARAVPL----GNVQTVSGHTFRGFMSHADNYPC
3e77B           ----------------------------------------------------------------------
3d19E           ----------------------------------------------------------------------
1cj0A           TGGSDNHLILV------------------DLRSKGTDGGRAEKVLEACSIACNKNTCPGDKSALRPSGLR
1e5eA           QMRMYGSMITFI----LKSGFEGAKKLLDNLKLITLAVSLGGCESLIQHPASMTHAVVPKEEREAAGITD
3ecdD           TGGTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRPAGTTRGFGAVGRLILE
1dfoB           ----------------------------------------------------------------------
3d19A           ----------------------------------------------------------------------
2dkjA           TGGTDNHLFLVD----LRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTP
1c8nA           ----------------------------------------------------------------------
3ecdB           --GTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRPAGTTRGFGAVGRLILE
2dgmE           CTGRPDEGIPAV----------------------------------------------------------
2dgmC           GRPDEGIPAVC-----------------------------------------------------------
3e6gB           ----------------------------------------------------------------------
3ei9A           ----------------------------------------------------------------------
1bw9A           ----------------------------------------------------------------------
3dzzB           SN--------------------------------------------------------------------
3e6gD           ----------------------------------------------------------------------
3dzzA           LDSNASYLAWVD----------------------------------------------------------
3ecdA           DNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRLGTPRGFGAAEFREVGRLILE
2douB           ----------------------------------------------------------------------
1c8eA           ----------------------------------------------------------------------
2e7jA           ----------------------------------------------------------------------
2bwoD           ----------------------------------------------------------------------
3eiaA           ----------------------------------------------------------------------
1djeA           ----------------------------------------------------------------------
2c44B           ----------------------------------------------------------------------
3dydB           ----------------------------------------------------------------------
2c44A           -GHAAFVDAGKLLPHIPADQFPAQALACELYKVAGI-----RAVEIGSFLLGRDPKTGKQLPCPAELL--
1ay4B           ----------------------------------------------------------------------
2bwpB           ----------------------------------------------------------------------
1bs0A           ----------------------------------------------------------------------
1bj4A           VTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRSALRPSGLRSRGLLEKDFQKVAHFIH
2dgkA           GRPDEG----------------------------------------------------------------
1ax4A           GGHAVFVDCKKLVPQIPGDQFPAQAVINALYLESGVVEIGSFLLGRD------------PATGEQKHADM
2bwpA           ----------------------------------------------------------------------
2ch2A           ----------------------------------------------------------------------
2cstA           ----------------------------------------------------------------------
1ay4A           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
2dgmA           CTGRPDEGIPA-----------------------------------------------------------
1bjwA           ----------------------------------------------------------------------
1eghA           ----------------------------------------------------------------------
3bs8A           FNRAGSMIGFF-----------------------------------------------------------
2ch1A           ----------------------------------------------------------------------
3e9kA           PSHVEERGCQL-----------------------------------------------------------
1bqaA           ----------------------------------------------------------------------
1eg5B           LEISLPNTLSV-----------------------------------------------------------
3caiA           ----------------------------------------------------------------------
1djuA           --KGAFYIFPR-----------------------------------------------------------
1ecxB           ----------------------------------------------------------------------
2cfbA           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
1ay5B           LSGSDRFGFVAEH---------------------------------------------------------
3d6kD           ----------------------------------------------------------------------
1c8fA           ----------------------------------------------------------------------
2dr1B           EPGHESPTITA-----------------------------------------------------------
1ejiA           IVTGGSDNHLILDL--------------------------------------------------------
3ei7B           ----------------------------------------------------------------------
1bkgA           ----------------------------------------------------------------------
3bc8A           TPHNPISLAMTLKTIDGHHDKAVTQLGSMLFTRQVSGARAVPL----GNVQTVSGHTFRGFMSHADNYPC
2aatA           ----------------------------------------------------------------------
2bwnB           DHGSHIVPVVI-----------------------------------------------------------
2aevA           ----------------------------------------------------------------------
2eh6A           ----------------------------------------------------------------------
2d61A           ----------------------------------------------------------------------
3bcbA           TPHNPISLAMTLKTIDGHHDKAVTQLGSMLFTRQVSGARAVPLGNVQTVS----GHTFRGFMSHADNYPC
3ei6B           ----------------------------------------------------------------------
2c44C           -GHAAFVDAGKLLPHIPADQFPAQALACELYKVAGI----------RAVEIGSFLLGRDPKTGKQLPCPA
1aiaA           ----------------------------------------------------------------------
1ariA           ----------------------------------------------------------------------
1c1dB           ----------------------------------------------------------------------
3cogD           LPSHPQHELVKRQ---------------------------------------------------------
1b5pA           ----------------------------------------------------------------------
1b4xA           ----------------------------------------------------------------------
3eiaB           ----------------------------------------------------------------------
3e6gA           ----------------------------------------------------------------------
1eg5A           LEISLPNTLSVS----------------------------------------------------------
1c7nA           ----------------------------------------------------------------------
5bj4A           ----------------------------------------------------------------------
2bwoB           ----------------------------------------------------------------------
1c1dA           ----------------------------------------------------------------------
7aatA           ----------------------------------------------------------------------
3e2yA           ----------------------------------------------------------------------
1djuB           --KGAFYIFPR-----------------------------------------------------------
1bw0B           TMPRGAMYLMSR----------------------------------------------------------
2dr1A           AEPGHESPTITA----------------------------------------------------------
1c1xA           ----------------------------------------------------------------------
3cq4A           ----------------------------------------------------------------------
3b46A           ----------------------------------------------------------------------
3a2bA           ----------------------------------------------------------------------
3bwnC           YPEAFCNYFGKS----------------------------------------------------------
1arhA           ----------------------------------------------------------------------
2d5yA           ----------------------------------------------------------------------
3d6kA           ----------------------------------------------------------------------
1b8gA           CLNGNAGLFCWV----------------------------------------------------------
1agxA           ----------------------------------------------------------------------
3cogB           ----------------------------------------------------------------------
2egyC           ----------------------------------------------------------------------
2douA           ----------------------------------------------------------------------
3bwnB           PEAFCNYFGKS-----------------------------------------------------------
3cq5A           ----------------------------------------------------------------------
1bw0A           TMPRGAMYLMSR----------------------------------------------------------
3c01F           ----------------------------------------------------------------------
3bwnE           KYPEAFCNYFG-----------------------------------------------------------
3c01E           ----------------------------------------------------------------------
3caeA           ----------------------------------------------------------------------
3d6kC           ----------------------------------------------------------------------
2bhxB           ----------------------------------------------------------------------
3d6kB           ----------------------------------------------------------------------
5bj3A           ----------------------------------------------------------------------
2d3jA           ----------------------------------------------------------------------
2b34A           ----------------------------------------------------------------------
1bxgA           ----------------------------------------------------------------------
1asbA           ----------------------------------------------------------------------
1b93B           ----------------------------------------------------------------------
3d19C           ----------------------------------------------------------------------
1ei7A           ----------------------------------------------------------------------
2eaaA           ----------------------------------------------------------------------
2e7uA           ----------------------------------------------------------------------
3d19B           ----------------------------------------------------------------------
3d19D           ----------------------------------------------------------------------
2bylA           ----------------------------------------------------------------------
3bwoC           KYPEAFCNYFGK----------------------------------------------------------
3bwnD           ----------------------------------------------------------------------
1asfA           ----------------------------------------------------------------------
3bwnA           ----------------------------------------------------------------------
3bwnF           ----------------------------------------------------------------------
3bk2A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RSLALPMFPELRDDEIKEVVDTIALFL
3bn1A           DGLNLPTHAGLTEADIDRVIAALDQVL
3dr4C           DGLNLPTHAGLTEADIDRVIAALDQVL
2ctzA           EMVRLSVGLEHVEDLKAELKEALA---
3bn1C           DGLNLPTHAGLTEADIDRVIAALD---
1b9iA           DCVWLHHRVLLAGEPLHATAEIIADAV
3bcxB           QTFWIGIYPGLTHDHLDYVVSKFEEFF
1b9hA           DCVWLHHRVLLAGPELHATAEIIADAV
3bb8A           QTFWIGIYPGLTHDHLDYVVSKF----
3bcxA           QTFWIGIYPGLTHDHLDYVVSKF----
3b8xB           NGLFVGNHQIELFDEIDYLREVL----
2cb1A           GLVRVS---------------------
3b8xA           NGLFVGNHQIELFDEIDYLREVL----
1dy2A           ---------------------------
2c81A           QSIVIHHAILLAEPSLSLLVDAVAELA
3dr4B           DGLNLPTHAGLTEADIDRVIAALD---
2c7tA           QSIVIHHAILLAEPSLSLLVDAVAELA
3bn1D           DGLNLPTHAGLTEADIDRVIAALD---
3dr7B           DGLNLPTHAGLTEADIDRVIAALD---
1cl1A           TLIRLHIGLEDVDDLIADLDAGFA---
2btwB           ---------------------------
1cl1B           TLIRLHIGLEDVDDLIADLDAGFA---
3dr4A           DGLNLPTHAGLTEADIDRVIAALD---
3dr4D           DGLNLPTHAGLTEADIDRVIAALD---
1e5eB           GMIRLSVGIEDADELIADFKQGLD---
1cj0B           RGIELTVQIQDDTGPRATLKEFKEKLA
2btwA           ---------------------------
1cs1A           TLLRISTGIEDGEDLIADLENGFR---
2a7vA           EGVNIGLEVKSKTAKLQDFKSFLL---
3ecdC           VFEALRTNPEGDHATEQRVRREIF---
2aeuA           ---------------------------
1c4kA           ---------------------------
3bh1C           ---------------------------
1dfoA           ---------------------------
3bcaA           AYLNAAAAIGMKMQDVDLFIKRLDKCL
3e77B           ---------------------------
3d19E           ---------------------------
1cj0A           LGTPALTSRGLLEKDFQKVAHFIH---
1e5eA           GMIRLSVGIEDADELIADFKQGLD---
3ecdD           VFEALRTNPEGDHATEQRVRREIFALC
1dfoB           ---------------------------
3d19A           ---------------------------
2dkjA           PLVAELIDRALLEGPSEALREEVRRLA
1c8nA           ---------------------------
3ecdB           VFEALRTNPEGDHATEQRVRREIFALC
2dgmE           ---------------------------
2dgmC           ---------------------------
3e6gB           ---------------------------
3ei9A           ---------------------------
1bw9A           ---------------------------
3dzzB           ---------------------------
3e6gD           ---------------------------
3dzzA           ---------------------------
3ecdA           VFEALRTNPEGDHATEQRVRREIF---
2douB           ---------------------------
1c8eA           ---------------------------
2e7jA           ---------------------------
2bwoD           ---------------------------
3eiaA           ---------------------------
1djeA           ---------------------------
2c44B           ---------------------------
3dydB           ---------------------------
2c44A           -RLTIP-RATYTQTHMDFIIEAFKHVK
1ay4B           ---------------------------
2bwpB           ---------------------------
1bs0A           ---------------------------
1bj4A           RGIELTLQIQSDTGVAATLKEFKE---
2dgkA           ---------------------------
1ax4A           EFMRLTIARRYTNDHMDYIADALIGLK
2bwpA           ---------------------------
2ch2A           ---------------------------
2cstA           ---------------------------
1ay4A           ---------------------------
3bh1A           ---------------------------
2dgmA           ---------------------------
1bjwA           ---------------------------
1eghA           ---------------------------
3bs8A           ---------------------------
2ch1A           ---------------------------
3e9kA           ---------------------------
1bqaA           ---------------------------
1eg5B           ---------------------------
3caiA           ---------------------------
1djuA           ---------------------------
1ecxB           ---------------------------
2cfbA           ---------------------------
3bh1D           ---------------------------
1ay5B           ---------------------------
3d6kD           ---------------------------
1c8fA           ---------------------------
2dr1B           ---------------------------
1ejiA           ---------------------------
3ei7B           ---------------------------
1bkgA           ---------------------------
3bc8A           AYLNAAAAIGMKMQDVDLFIKRLDKCL
2aatA           ---------------------------
2bwnB           ---------------------------
2aevA           ---------------------------
2eh6A           ---------------------------
2d61A           ---------------------------
3bcbA           AYLNAAAAIGMKMQDVDLFIKRLDKCL
3ei6B           ---------------------------
2c44C           ELLRLTIPRAYTQTHMDFIIEAFKHVK
1aiaA           ---------------------------
1ariA           ---------------------------
1c1dB           ---------------------------
3cogD           ---------------------------
1b5pA           ---------------------------
1b4xA           ---------------------------
3eiaB           ---------------------------
3e6gA           ---------------------------
1eg5A           ---------------------------
1c7nA           ---------------------------
5bj4A           ---------------------------
2bwoB           ---------------------------
1c1dA           ---------------------------
7aatA           ---------------------------
3e2yA           ---------------------------
1djuB           ---------------------------
1bw0B           ---------------------------
2dr1A           ---------------------------
1c1xA           ---------------------------
3cq4A           ---------------------------
3b46A           ---------------------------
3a2bA           ---------------------------
3bwnC           ---------------------------
1arhA           ---------------------------
2d5yA           ---------------------------
3d6kA           ---------------------------
1b8gA           ---------------------------
1agxA           ---------------------------
3cogB           ---------------------------
2egyC           ---------------------------
2douA           ---------------------------
3bwnB           ---------------------------
3cq5A           ---------------------------
1bw0A           ---------------------------
3c01F           ---------------------------
3bwnE           ---------------------------
3c01E           ---------------------------
3caeA           ---------------------------
3d6kC           ---------------------------
2bhxB           ---------------------------
3d6kB           ---------------------------
5bj3A           ---------------------------
2d3jA           ---------------------------
2b34A           ---------------------------
1bxgA           ---------------------------
1asbA           ---------------------------
1b93B           ---------------------------
3d19C           ---------------------------
1ei7A           ---------------------------
2eaaA           ---------------------------
2e7uA           ---------------------------
3d19B           ---------------------------
3d19D           ---------------------------
2bylA           ---------------------------
3bwoC           ---------------------------
3bwnD           ---------------------------
1asfA           ---------------------------
3bwnA           ---------------------------
3bwnF           ---------------------------
3bk2A           ---------------------------