[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tmar0:AAD35944.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2e3dC.bssp"
#ERROR : Can't open dsspfile "2e3dD.bssp"
#ERROR : Can't open dsspfile "2e3dB.bssp"
#ERROR : Can't open dsspfile "3dk5A.bssp"
#ERROR : Can't open dsspfile "3dj4A.bssp"
#ERROR : Can't open dsspfile "3d98A.bssp"
#ERROR : Can't open dsspfile "2e3dA.bssp"
#ERROR : Can't open dsspfile "3d8vA.bssp"
#ERROR : Can't open dsspfile "3cgxA.bssp"
#ERROR : Can't open dsspfile "3duvB.bssp"
#ERROR : Can't open dsspfile "3brkX.bssp"
#ERROR : Can't open dsspfile "2cu2A.bssp"
#ERROR : Can't open dsspfile "3bbdA.bssp"
#ERROR : Can't open dsspfile "1e5kA.bssp"
#ERROR : Can't open dsspfile "3c8vD.bssp"
#ERROR : Can't open dsspfile "3c8vB.bssp"
#ERROR : Can't open dsspfile "3c8vC.bssp"
#ERROR : Can't open dsspfile "3duvA.bssp"
#ERROR : Can't open dsspfile "3d5nA.bssp"
#ERROR : Can't open dsspfile "3d5nG.bssp"
#ERROR : Can't open dsspfile "2e8bA.bssp"
#ERROR : Can't open dsspfile "3d5nI.bssp"
#ERROR : Can't open dsspfile "2dpwA.bssp"
#ERROR : Can't open dsspfile "3d5nH.bssp"
#ERROR : Can't open dsspfile "3d5nE.bssp"
#ERROR : Can't open dsspfile "3c8vA.bssp"
#ERROR : Can't open dsspfile "3d5nB.bssp"
#ERROR : Can't open dsspfile "3d5nF.bssp"
#ERROR : Can't open dsspfile "2ehoB.bssp"
#ERROR : Can't open dsspfile "3ca8B.bssp"
#ERROR : Can't open dsspfile "3ca8A.bssp"
#ERROR : Can't open dsspfile "3eg4A.bssp"
#ERROR : Can't open dsspfile "3clbA.bssp"
#ERROR : Can't open dsspfile "3cbtA.bssp"
#ERROR : Can't open dsspfile "3bxyA.bssp"
#ERROR : Can't open dsspfile "3bmaA.bssp"
#ERROR : Can't open dsspfile "3clbD.bssp"
#ERROR : Can't open dsspfile "3bswA.bssp"
#ERROR : Can't open dsspfile "2eg0A.bssp"

## Summary of PDB Search
:355
    9e-64  33%  2e3dC  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    8e-50  30%  2e3dD  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    2e-44  31%  2e3dB  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    2e-42  25%  3dk5A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    4e-42  23%  3dj4A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    2e-41  19%  3d98A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    3e-40  32%  2e3dA  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    3e-40  23%  3d8vA  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    1e-36  12%  3cgxA  [x.x.x] PUTATIVE NUCLEOTIDE-DIPHOSPHO-SUGAR TRANSFERASE
    2e-36  17%  3duvB  [x.x.x] 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE
    4e-36  16%  3brkX  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE
    2e-35  20%  2cu2A  [x.x.x] PUTATIVE MANNOSE-1-PHOSPHATE GUANYLYL
    5e-32   8%  3bbdA  [x.x.x] RIBOSOME BIOGENESIS PROTEIN NEP1-LIKE
    9e-28  12%  1e5kA  [c.68.1] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    3e-27   8%  3c8vD  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    1e-26   8%  3c8vB  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    2e-25  11%  3c8vC  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    3e-24  16%  3duvA  [x.x.x] 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE
    5e-24  18%  3d5nA  [x.x.x] Q97W15_SULSO
    5e-24  15%  3d5nG  [x.x.x] Q97W15_SULSO
    1e-23  16%  2e8bA  [x.x.x] PROBABLE MOLYBDOPTERIN-GUANINE DINUCLEOTIDE
    2e-23  15%  3d5nI  [x.x.x] Q97W15_SULSO
    3e-23  13%  2dpwA  [x.x.x] HYPOTHETICAL PROTEIN TTHA0179
    4e-23  19%  3d5nH  [x.x.x] Q97W15_SULSO
    4e-23  15%  3d5nE  [x.x.x] Q97W15_SULSO
    2e-22  11%  3c8vA  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    5e-22  18%  3d5nB  [x.x.x] Q97W15_SULSO
    1e-20  17%  3d5nF  [x.x.x] Q97W15_SULSO
    2e-20   9%  2ehoB  [x.x.x] DNA REPLICATION COMPLEX GINS PROTEIN PSF1
    8e-20   7%  3ca8B  [x.x.x] PROTEIN YDCF
    7e-19   7%  3ca8A  [x.x.x] PROTEIN YDCF
    5e-12  12%  3eg4A  [x.x.x] 2,3,4,5-TETRAHYDROPYRIDINE-2,6-DICARBOXYLATE N-
    5e-11  11%  3clbA  [x.x.x] DHFR-TS
    5e-11   7%  3cbtA  [x.x.x] PHOSPHATASE SC4828
    3e-10  14%  3bxyA  [x.x.x] 2,3,4,5-TETRAHYDROPYRIDINE-2,6-DICARBOXYLATE N-
    9e-10  14%  3bmaA  [x.x.x] D-ALANYL-LIPOTEICHOIC ACID SYNTHETASE
    2e-08  13%  3clbD  [x.x.x] DHFR-TS
    1e-07  13%  3bswA  [x.x.x] ACETYLTRANSFERASE
    3e-04  15%  2eg0A  [x.x.x] HYPOTHETICAL CONSERVED PROTEIN
:355

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKAIVLCAGKGTRLRPLTFTTAKHLIPIANKPILFYSLENIARAGIEEVGIVVSPHNAEEFKSIVGTGE
2e3dC           VKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEI-VLVTHSSKNSIENHFDTSF
2e3dD           VKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKENHFDTSFELEA
2e3dB           VKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDEVQS
3dk5A           ---VLVLAAGPGTRMRSDT---PKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLG-HDHQRIAPLVGEAD
3dj4A           --AVLVLAAGPGTRMRSDT---PKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELAD
3d98A           --AVLVLAAGPGTRMRSDT---PKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELAD
2e3dA           VKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNRQLLDEVQSIC
3d8vA           --AVLVLAAGPGTRMRSDT---PKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELAD
3cgxA           LFFVKYPEPGKKTRLGEVV----GNDKAALYRHFVQDLQGLARLHADLHICYVPGDADLPEK-------F
3duvB           ---VIIPARFASSRLPG------KPLADIKGKPIQHV-FEKALQSGASRVIIATDNENVADVAKSFGAEV
3brkX           --AAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALNALNSGIRRIGVATQYKAHSLIRHLQRGRP
2cu2A           MKYALVMAGGRGERLWPLSRDRPKPFLPLFGKTLLEATLERLAPLVPPERTLLAVRRDQEAVARPYADGI
3bbdA           ----------------------------------------------------------------------
1e5kA           MTTGVVLAGGKARRMGG----VDKGLLELNGKPLWQHVADALMTQLSHVVVNANRHQEIYQA--------
3c8vD           ------------------------------------TQLELLLERIIDRVNVNLRKFDVGDYVRRQTPHL
3c8vB           ------------------------------------TQLELLLERIIDRVNVNLRHQKFDVGDYVRRQTP
3c8vC           -----------GTQLELLLRIIDRVNVNLRHQFDVGDYVRRQTPHLHYSKFSLAGSYLLGRVNVLHSALY
3duvA           --------------------------VIIPARKPIQHVFEKALQSGASRVIIATDNENVADVA------K
3d5nA           --GVIILAAGEGKRFGG-----DKLLAKIDNTPI----IRTIRIYGDLEKIIIVGKYVNELP--------
3d5nG           ----------------------AKLLAKIDNTPII----RTIRIYGDLEKIIIVGKYVNELP--------
2e8bA           --TCYVLAGGKSKRFGE-----DKLLYEIKGKKVIERVYETAKSVFKEVY-IVAKDREKFSFLNA-----
3d5nI           ----------------------AKLLAKIDNTPIIRTIRI----YGDLEKIIIVGKYVNELP--------
2dpwA           --SAIVLAGGKEAWA-ERFGVGSKALVPYRGRPVEWVLEALYAAGLSPVY-VGENPGLVPAPALTLPDRG
3d5nH           --GVIILAAGEGDKL----------LAKIDNTPII----RTIRIYGDLEKIIIVGKYVNELPL-------
3d5nE           --GVIILAAGEDKLL-----------AKIDNTPIIRTIRI----YGDLEKIIIVGKYVNELP--------
3c8vA           ------------------------------------TQLELLLERIIDRVNVNLRKFDVGDYGLSADDPV
3d5nB           --GVIILAAG------------DKLLAKIDNTPIIRTIRI----YGDLEKIIIVGKYVNELPLLD-----
3d5nF           --GVIILAAG------------DKLLAKIDNTPIIRTIRI----YGDLEKIIIVGKYVNELP--------
2ehoB           ----------------------------------------------------------------------
3ca8B           --DCVILAGNAVMPTIDAACKIARDISGGIGHSTTFLYSAIAQHPHYNTI-RTTGRAEATILADIAH-QF
3ca8A           --DCVILAGNAVMPTIDAACKIADQQIPLIGHSTTFLYSAIAQHPHYNTIRTTGRAEAADIAHQFWHIPH
3eg4A           ----------------------------------------------------------------------
3clbA           --NAVVMGRKTWDSIPPKFRPLPGRLNVVLSSTLTTQHLLDGLPDEHADSIVAVNGGLEQALQLLASPNY
3cbtA           ----------------------------------------------------------------------
3bxyA           ----------------------------------------------------------------------
3bmaA           ------------TTIDSFKERSQKVRALSDPNVRFPAVLAEKYNRSYRPYLL--GQGGAASLNQYFGMQQ
3clbD           --NAVVMGRKTWDSIPPKFRPLPGRLNVVLSSTLTTQHLLDGLPDHADS-IVAVNGGLEQALQLLASPNY
3bswA           ----------------------------------------------------------------------
2eg0A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NFGLRISYIIQEEPKGLAHAVWVSREFLGDEDFMMYLGDNLILEDLGKFVKDFENSDYAASILLSPVKDP
2e3dC           ELHVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDVILDENLAEMIRRFDETGHSQ-IMVEPVADV
2e3dD           MLPPHVTIMQVRQGKGLGHAVLCAHPVVGDEPVAVILPDVLSQDNLAEMIRRFDETG-HSQIMVEPVADV
2e3dB           ICPPHVTIMQVRQGKGLGHAVLCAHPVVGDEPVAVILPDVILDEYESDLSQRRFDETGHSQIMVEPVADV
3dk5A           TLGRTIDVALQDRPLGTGHAVLCGLSALPDDNVVVTSGDTPLLDTLADLIATHRAVSAAVTVLTTTLDDP
3dj4A           TLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSLDADTLADLIATHRAVSAAVTVLTTTLDDP
3d98A           TLGRTIDVALQDRPLGTGHAVLCGLSALPDDGNVVVTSGDTPLLDLADLIATHRAVSAAVTVLTTTLDDP
2e3dA           PPHVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDVILDEYESDLSQRRFDETGHSQIMVEPVADV
3d8vA           TLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSLDADTLADLIATHRAVSAAVTVLTTTLDDP
3cgxA           KAWLGPQHFAAQQGLDLGERKHAQKAFDDGYDRVVLGSDIPDYELVQKALNDLQHYDAAIGPAFDGGYYL
3duvB           -----CTSVNHNSGTERLAEVVEKLAIPDNEIIVNIQGDEPLIVIVRQVADNLAKFNVNASLAVEELFNP
3brkX           ERNESFDILPASWYEGTADAVYQNIDIIEAPEYVILAGDHIY--KDYEYLQQHVDSGADVTIGCLEVPRE
2cu2A           RLLLEPLGRDTAGAVGVAEALK-----EGAERLLVLPADHYVGDDEAYRMLEAAEEGFVVALGLRPTRPE
3bbdA           -------IILAKSALELIPEEIKNKIRKRVYKYDILDSNYHYKEKLKDKERGRPDIIHISLLNILDSPIN
1e5kA           -SGLKVIEDSLADYPGPLAGMLSVMQQEAGEWFLFCPCDTPYIPPDLAARLNHQRKDAPVVWVHDGERDH
3c8vD           HYSKFYAFY-GLSADDPVHFHFKNSSLAGLLGRVNVLHSALYKSDIRGDELKRKGQHFVCDDEVITIKDS
3c8vB           HLDDPVHFHFKNSSLAGSYLLGRVNVLHSALYKSDIRGDELKRKGQHFVCIPLHDDEVITIKDSFLNKTL
3c8vC           KSDIRGDELKRKGQHFVKIPLHDDEVITIKDSFLNKTLVHSNSPESPEEFTIRNTVAPYANIHGSLTEGS
3duvA           SFGAEV-CTSVNHNSGTERLAEVVEKLAIPDNIVNIQGDEPLIVIVRQVADNLAKFNVNASLAVKIHFNP
3d5nA           -LLDQIVIYNPFWNEGISTSLKLGLRFFKDYDAVLVALGDPFVKEDVNKIINTPNCKAVIPTHKGERGNP
3d5nG           -LLDQIVIYNPFWNEGISTSLKLGLRFFKDYDAVLVALGDPFVTEDVNKIINTFKPNCKAVIPTHERGNP
2e8bA           -PVVLDEFEESASIIGLYTALK----HAKEENVFVLSGDLPLMETVLYVLENFKEPV--SVAKTEKLHTL
3d5nI           -LLDQIVIYNPFWNEGISTSLKLGLRFFKDYDAVLVALGDPFVTEDVNKIINTFKPNCKAVIPTHERGNP
2dpwA           GLLENLEQALEHVE----------------GRVLVATGDIPHLEAVRFVLDKAPEAALVYPIVPKEAVEA
3d5nH           --LDQIVIYNPFWNEGISTSLKLGLRFFKDYDAVLVALGDFVTKEDVNKIINTPNCKAVIPTHKGERGNP
3d5nE           -LLDQIVIYNPFWNEGISTSLKLGLRFFKDYDAVLVALGDPFVTEDVNKIINTFKPNCKAVIPTHERGNP
3c8vA           HFHFKNSSLAGSYLLGRVNVLHSALYKSDIRGDELKRKGQHFVCDG----KIPLHDDEVITIKDSFLNKT
3d5nB           ----QIVIYNPFWNEGISTSLKLGLRFFKDYDAVLVALGDPFVTEDVNKIINTFKPNCKAVIPTHERGNP
3d5nF           -LLDQIVIYNPFWNEGISTSLKLGLRFFKDYDAVLVALGDPFVTEDVNKIINTFKPNCKAVIPTHERGNP
2ehoB           ------------------------------------------------------------AELIRELHRA
3ca8B           WHIPHEKIWIEDQSTNCGSIALLNQAVERVHTAIVVQDPTMQRRTMATFRRMTGDNPDAPRWLSYPQLGN
3ca8A           EKIWIEDQSTNCGENARFSIALLNQAVERVHTAIVVQDPTMQRRTMATFRRTGDNPDAPRWLSYPPQLGN
3eg4A           ----------------------------------------------------------------------
3clbA           TPSIETVYCIGGGSEALRPVHLLQAIYRTTIRASESSCSVFFRVPESGTEAAAGIEWQRETISEELTSAN
3cbtA           -------------------------------------GSHILWRYRENGGPHVH-IARPVTVVRDLAVWL
3bxyA           ----------------------------------------------------------------------
3bmaA           MLPQQVVYVIYDPAAFQQYFNGDLTSFLKHQSASQYAATRLLQQFPNVAMKDLVQIELLARFNERQASFF
3clbD           TPSIETVYCIGGGSEALRPPCVLQAIYRTTIRASESSCSVFFRVPESGTEAAAGIEWQRETISEELTSAN
3bswA           ----------------------------------------------------------------------
2eg0A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TRFGVAVMEGDRVIKVVEKPKTPPSNLAIVGLYLFRNKIFEGIKNIKPSWRGELEITDAIEYLIEKGEKV
2e3dC           TAYGVVDCKGVPMVGVVPKADVAPSNLAIVGRYVLSADIWPLLAKTPPGAGDEIQLTDAIDMLIEK-ETV
2e3dD           TAYGVVDCKGVELAPGESVPVVEPSNLAIVGRYVLSADIWPLLAK--TGAGDEIQLTDAIDMLIEKE-TV
2e3dB           TAYGVVDCKGVPMVGVVEKPKVAPSNLAIVGRYVLSADIWP--------LLAKTQLTDAIDMLIEKE-TV
3dk5A           F-------YGRIVMAIVE---------VNAGVYAFDIALRSALSRLSSNNQQELYLTDVIAILRSDGQTV
3dj4A           FGYGRILRTQDEVMAIVEQTDQREIREVNAGVYAFDIAALRSALSRLSSAQQELYLTDVIAILRSDGQTV
3d98A           FGYGRILRTQDEVMAIVEQTDATPIREVNAGVYAFDIAALRSALSRLSSAQQELYLTDVIAILRSDGQTV
2e3dA           TAYGVVDCKGVPMVGVVEKPKVAPSNLAIVGRYVLSADIWPLLAK----TPPEIQLTDAIDMLIEKE-TV
3d8vA           FGYGRILRTQDEVMAIVEQTDQREIREVNAGVYAFDIAALRSALSRLSSAQQELYLTDVIAILRSDGQTV
3cgxA           IGFRKDSFCPDFDGIRWGEADQPTVEKRRARLEVLQLPDWWDLNVLYRTNKSSFRRSSTYALLRENDALI
3duvB           NAVKVLTDKDGYVLYFSRSVQLSDAYLRHIGIYAYRAGFIKQYVQWAPTQLENLEKLEQL-RVLYNGERI
3brkX           ATGFGVHNEKDEIIDFIEKPADPPGIPGNEGFALASGIYVFHTKFLEAVRRDAADIIPYIVEHGKAVAHR
2cu2A           TEYGPREGAWYRGEGFVEKPSYAEAYVWNGGVFAFAPATMELFRRHLPSHHEALERLLAGYGVMEKAERV
3bbdA           KKLNIYIHTYDKVLKINPETRLPRNYFRFLGVEKVLKGERNHLIKEEKTLEDLLEINAKKIAITKTGKLT
1e5kA           PTIALVNRAIELLLEYLQAGERRVMVFAGGHAVDFSDHKDAFVNVNTPEELARWQ---------------
3c8vD           FLNKTLVHSNSFTIRNTVAPYANIHGSLTEGSFIGSFATVDLSTIHNSVVRYFSYVQTGELV-------G
3c8vB           VHSHDPESPEEFTIRNTVAPYANIHGSLTEGSFIGSFATVDLSTIHNSVVRYFSYVQTGELVGKCVEPGQ
3c8vC           FIGSDLSTIHNSVVRYFSYVQELVGKCVEPGQIWIKSGDELEFH-----------------YSFDKAILD
3duvA           NAVKVLTDKDGYVLYDVQKVQLSDAYLRHIGIYAYRAGFIKQYVQWAPTQLENLEKLEQLRVL-YNGERI
3d5nA           VLISKSLFNEVGARVILNKIKELCFIECSEGVLIDIDK--------------------------------
3d5nG           VLISKSLFNEIEKLRGDVGARLNKIKIEELCFIECSEGVLIDI---------------------------
2e8bA           VGVYSKKLGDYRIWALLKDVGYNEVEIPEELRYTLLN---------------------------------
3d5nI           VLISKSLFNEIEKLRVGARVILNKIKIEELCFIECSEGVLIDIDKK------------------------
2dpwA           RFPR--------TKRTYARLR--EGTFTGGNLLLLDKSLF------------------------------
3d5nH           VLISKSLKLRGDVGARVILNKIKCFIECSEGVLIDIDK--------------------------------
3d5nE           VLISKSLFNEIEKLRVGARVILNKIKIEELCFIECSEGVLIDIDK-------------------------
3c8vA           HSNSHDPESPEFTIRNTVAPYANIHGSLTEGSFIGSFATVD-------LSTIHNSVVRYFSYVQTGELVG
3d5nB           VLISKSLFNEIGARVILNKIKELCFIECSEGVLI------------------------------------
3d5nF           VLISKSLFNEIGARVILNKIKIEELCFIECSEGVLID---------------------------------
2ehoB           PEGQLPAFNEDLRQVLEEKALQNQSDVNEAKSGGRSDLIPTVAYLYDRLLRIRAEYGSILPNALRFH-AA
3ca8B           NADSVIFINLWPVERYLSLLTDSDGYGPRGRDFIVHVDFPAEIHAWQTLKAVLIEAMES-----------
3ca8A           NADSVIFINQRYLSLLTGELPRDDSDGYGPRGRDFIVHVD------------------------------
3eg4A           ------------------------------SLEKTIEKAFDERDGINTATRGEVRVEQSLILLDRGEVRV
3clbA           GNETKYYFEKLIPRNREEEQYLS----------LVDRIIREGNVKHDRTGVGTLSIFNRLPLLTTKRVFW
3cbtA           APGTECKPVLADGTPVHLEPLATRYTKP-RTVQRDQWFGTGVLKLARPGE-----AWSVWLFWDPGWR--
3bxyA           ------------------------------------ETAFERRAEITPANADT-VTREAVNQVIDSGALR
3bmaA           GQFSVRGYVNYDKHVAKYLKILPDQFSYQAIEYFYNEQIKKDLKKLKDSQKSEYNDLQLVLTQFSKS-KV
3clbD           GNETKYYFE-KLIPRNREEEQY---------LSLVDRIIREGNVKHDRTGVGTLSIFNRLPLLTTKRVFW
3bswA           --------------------------------------------------------TEKIYIYGGHGLVC
2eg0A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RGYIVYGWWKDTGKPEDLLEANRKIXXXXXXXXXXXXDDKSSIQGPVRIGKASKIVNSVIRGPAVIGENC
2e3dC           EAYHMKGKSHDCGNKLGYMQAF------------------------------------------------
2e3dD           EAYHMKGKSHDCGNKLGYMQAF------------------------------------------------
2e3dB           EAYHMKGKSHDCGNKLGYMQAF------------------------------------------------
3dk5A           HASHVDDSALVAGVNNRVQLANRRVVAAHQLAGVTVVDPATTIDVDVTIGRDTVIPGTQLLGRTQIGGRC
3dj4A           HASHVDDSALVAGVNNRVQLAEL-----------------------------------------------
3d98A           HASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATWIDVDVTIGGTQLLGRTQIGGRC
2e3dA           EAYHMKGKSHDCGNKLGYMQAFV-----------------------------------------------
3d8vA           HASHVDDSALVAGVNNRVQLAE------------------------------------------------
3cgxA           RQY-------------------------------------------------------------------
3duvB           HVELAKEPAVGVDTAEDLEKVRA-----------------------------------------------
3brkX           FADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDFVHDDEDRRGSAVSSVVSG-DCIISGA
2cu2A           RVVLGRFPWDDVGNWRALERVFSQD--PHENVVLGEGRHVALDTFGCVVYADRGVVATLGVSGLVVAKVG
3bbdA           HPKLLKEYDTFIIGGFPYGKLKI-----------------------------------------------
1e5kA           ----------------------------------------------------------------------
3c8vD           KCVEPGQIWIKSGDELEFHYAILDKYISQEAGSCPTGVLEFVEVRQEDFEEVFSASGASVSGYAVIKGDT
3c8vB           IWIKSGDELEFHYSFDKAILDKYIS---QEAGSCPTGVLEFVEVRQEDFEEVFSASGASVSGYAVIKGDT
3c8vC           KYISQEAGSCPTGVLEFVEVRQEDFEEVFASGHSA---SGASVSG-----------YAVIKGDTVIGENV
3duvA           HVELAKEPAVGVDTAEDLEKVRA-----------------------------------------------
3d5nA           ----------------------------------------------------------------------
3d5nG           ----------------------------------------------------------------------
2e8bA           ----------------------------------------------------------------------
3d5nI           ----------------------------------------------------------------------
2dpwA           ----------------------------------------------------------------------
3d5nH           ----------------------------------------------------------------------
3d5nE           ----------------------------------------------------------------------
3c8vA           KCVEPGQIWIKSGDELEFHYSFDKAILDKYISQEAGSCPTGVLEFVEVRQEASSASGASVSGYAVIKGDT
3d5nB           ----------------------------------------------------------------------
3d5nF           ----------------------------------------------------------------------
2ehoB           EEEWFNNYKRSLATYRSLGGDEGLD---------------------------------------------
3ca8B           ----------------------------------------------------------------------
3ca8A           ----------------------------------------------------------------------
3eg4A           AEKQADGNWHVNQWLKKAVLLSFRLNPMEVIKGGPGQS----SWWDKVPSKFDGWTANEFEKAGFRAVCI
3clbA           RGVCELWFLRGETYAKKLSDKGVHI---------------------------------------------
3cbtA           ----FKNWYVNLERPLTRWEGGVDS---------------------------------------------
3bxyA           VAEKIDGQWVTHQWLKKRINDNQVIEGAESRYFDKVPMKFADYDEARFQKEGFRVVPAAVRQGAFIARNT
3bmaA           NPIFIIKKWMDAGLREDMYQQT------------------------------------------------
3clbD           RGVCEELLWFLRGYAKKLSDKGVHI---------------------------------------------
3bswA           EDVAKNMGYKECIFLDDFKGMKFESTLPKYDFFIAIGNNEIRKKIYQKISENGFKIVNLIHKSALISPSA
2eg0A           ------------------------------------------------------MIYPYKGKTPQIAASA


                         .         *         .         .         .         .         +:350
query           FIKNSYVGPYSSIGNRVILEDCEVENSIVMDECSITGVEKRIDSSILGKGVSVKGSQKRPASLNLILGNM
2e3dC           ----------------------------------------------------------------------
2e3dD           ----------------------------------------------------------------------
2e3dB           ----------------------------------------------------------------------
3dk5A           VV-----GPDTTLTDVAVGDGASVVRTHGSS---------------------------------------
3dj4A           ----------------------------------------------------------------------
3d98A           VVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLAFVEVKNSTIGTKVPHL
2e3dA           ----------------------------------------------------------------------
3d8vA           ----------------------------------------------------------------------
3cgxA           ----------------------------------------------------------------------
3duvB           ----------------------------------------------------------------------
3brkX           ALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHGVVIPEGLIVGE---------------
2cu2A           --DEVLVVPKDWAREVREVVK-------------------------------------------------
3bbdA           ----------------------------------------------------------------------
1e5kA           ----------------------------------------------------------------------
3c8vD           VIGENVLVSQRAYLDNAWGKGSNAQENCYIINSRLERNCVTAHGGKIINAH-------------------
3c8vB           VIENVLVSQRAYLDNAWGKGSNAQENCYIINSR-------------------------------------
3c8vC           LVSQ------------------------------------------------------------------
3duvA           ----------------------------------------------------------------------
3d5nA           ----------------------------------------------------------------------
3d5nG           ----------------------------------------------------------------------
2e8bA           ----------------------------------------------------------------------
3d5nI           ----------------------------------------------------------------------
2dpwA           ----------------------------------------------------------------------
3d5nH           ----------------------------------------------------------------------
3d5nE           ----------------------------------------------------------------------
3c8vA           VIGE------------------------------------------------------------------
3d5nB           ----------------------------------------------------------------------
3d5nF           ----------------------------------------------------------------------
2ehoB           ----------------------------------------------------------------------
3ca8B           ----------------------------------------------------------------------
3ca8A           ----------------------------------------------------------------------
3eg4A           VRHSAYIAPNAILMPSFVNLGAYVDKGAMIDTW-------------------------------------
3clbA           ----------------------------------------------------------------------
3cbtA           ----------------------------------------------------------------------
3bxyA           VLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVH----------------------------------
3bmaA           ----------------------------------------------------------------------
3clbD           ----------------------------------------------------------------------
3bswA           IVAGILIMPYVVINAKAIEKGVILNTSSVIEHECVIGEFSHVSVGAKCAGNVKIG---------------
2eg0A           FIDYVTITGDVVIGEETSIWFNTVIRGDVAP---------------------------------------


                         .         .         .         .         *         .         .:420
query           SRVEx
2e3dC           -----
2e3dD           -----
2e3dB           -----
3dk5A           -----
3dj4A           -----
3d98A           TYVG-
2e3dA           -----
3d8vA           -----
3cgxA           -----
3duvB           -----
3brkX           -----
2cu2A           -----
3bbdA           -----
1e5kA           -----
3c8vD           -----
3c8vB           -----
3c8vC           -----
3duvA           -----
3d5nA           -----
3d5nG           -----
2e8bA           -----
3d5nI           -----
2dpwA           -----
3d5nH           -----
3d5nE           -----
3c8vA           -----
3d5nB           -----
3d5nF           -----
2ehoB           -----
3ca8B           -----
3ca8A           -----
3eg4A           -----
3clbA           -----
3cbtA           -----
3bxyA           -----
3bmaA           -----
3clbD           -----
3bswA           -----
2eg0A           -----