[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tmar0:AAD36720.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1brwA.bssp"
#ERROR : Can't open dsspfile "2dsjA.bssp"
#ERROR : Can't open dsspfile "2bpqA.bssp"
#ERROR : Can't open dsspfile "2bpqB.bssp"

## Summary of PDB Search
:434
    1e-79  56%  1brwA  [a.46.2 - c.27.1 - d.41.3] PROTEIN (PYRIMIDINE NUCLEOSIDE
    1e-75  50%  2dsjA  [x.x.x] PYRIMIDINE-NUCLEOSIDE (THYMIDINE) PHOSPHORYLASE
    6e-48  15%  2bpqA  [x.x.x] ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE[MASQUE :
    3e-42  13%  2bpqB  [x.x.x] ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE[MASQUE :
:434

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRAYDVILKKRNGEKLSREEIEFMVGGYVKGEIPDYQMAAFLMAVYFRHLDXXXXXXXXXXMMRSGEVLD
1brwA           MRMVDLIAKKRDGKALTKEEIEWIVRGYTNGDIPDYQMSALAMAIYFRGMTEEETAALTMAMVQSGEMLD
2dsjA           MNPVAFIREKREGKKHRREDLEAFLLGYLRDEVPDYQVSAWLMAAFLRGLDPEETLWLTETMARSGKVLD
2bpqA           ----QILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLP
2bpqB           ----QILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLP


                         .         .         *         .         .         .         .:140
query           LSEIPGTKVDKHSTGGVGDKTTLVVAPLVASAGVPVAKMSGRALGHTGGTIDKLESIPGFRTELSLEEFI
1brwA           LSSIRGVKVDKHSTGGVGDTTTLVLGPLVASVGVPVAKMSGRGLGHTGGTIDKLESVPGFHVEISKDEFI
2dsjA           LSGLPHP-VDKHSSGGVGDKVSLVVGPILAASGCTFAKMSGRGLAHTGGTIDKLESVPGWRGEMTEAEFL
2bpqA           ADTVPDDAVDVVGTGGDGVNXXXXXXXXXXXXXXXXXXXXNRAASSLSGGADTLEAL-GVRIDLGPDLVA
2bpqB           ADTVPDDAVDVVGTG--GGVNTXXXXXXXXXXXXXXXXXXXXXXXRAAGGADTLEAL-GVRIDLGPDLVA


                         +         .         .         .         .         *         .:210
query           KNVKKYGIAIVGQTGNLVPADKKIYALRDATATVDEISLIASSIMSKKLAGGSDAFVLDVKFGTGAFMKG
1brwA           RLVNENGIAIIGQTGDLTPADKKLYALRDVTATVNSIPLIASSIMSKKIAAGADAIVLDVKTGAGAFMKK
2dsjA           ERARRVGLVIAAQSPDLAPLDGKLYALRDVTATVESVPLIASSIMSKKLAAGARSIVLDVKVGRGAFMKT
2bpqA           RSLAEVGIGFCFAP-RFHPSYRHAAAVRREIGVPTVFNLLG-PLTNPARPXXXXXXXXXXXXRSSVLDDG
2bpqB           RSLAEVGIGFCPRFHPSAAVRRE-IGVPTVFNLLG-------PLTNPARPXXXXXXXXXXXXRSSVLDDG


                         .         .         .         +         .         .         .:280
query           FEDAKKLAFLMLRIAQQHGKKAVAVLSNMDQPLGKAVGNSLEVIEAIETLKGNGPEDLKELSLTLGALML
1brwA           LDEARRLARVMVDIGKRVGRRTMAVISDMSQPLGYAVGNALEVKEAIETLKGNGPHDLTELCLTLGSHMV
2dsjA           LEEARLLAKTMVAIGQGAGRRVRALLTSMEAPLGRAVGNAIEVREAIEALKGEGPGDLLEVALALAEEAL
2bpqA           LDELTTTTTSTIWRVAAGS---VDKLTFDPAGFGFARAQLDQLAAAVRAVLGGARGPVRDAVVLNAAGAI
2bpqB           LDELTTTTTSTIWRV-AAGSVDKLTFDPAGFGFARAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAI


                         .         *         .         .         .         .         +:350
query           ELAGVADFEEGKKILQEKLETGEALDKFRLLVKAQGGNERVVDDPWRVLPVAEQVVEFSAAREGFVSKID
1brwA           YLAEKASLDEARRLLEEAIRSGAAIAAFKTFLAAQGGDASVVDDLDK-LPKAAYTSTVTAAADGYVAEMA
2dsjA           RLEGL-----DPALARKALEGGAALEKFRAFLEAQGGDPRAVEDF--SLLPLAEEHPLRAEREGVVREVD
2bpqA           VAHAGLAWEEGLRRASAAIDTGAAEQLLARWVRFG-----------------------------------
2bpqB           VAHALPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQ---------------------------------


                         .         .         .         .         *         .         .:420
query           AEKVGIASMMLGAGRKKKEDRIDHSVGIIVEKKLGDSVKKGEAIARLFVSDRSDVESALKLLKEAYVISD
1brwA           ADDIGTAAMWLGAGRAKKEDVIDLAVGIVLHKKIGDRVQKGEALATIHSNRPDVLDVKEKIEAAIR-LSP
2dsjA           AYKVGLAVLALGGGRKRKGEPIDHGVGVYLLKKPGDRVERGEALALVY-HRRRGLEEALGHLREAYALGE
2bpqA           ----------------------------------------------------------------------
2bpqB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           SPSEPPRVVEEVIx
1brwA           QPVARPPLIYETI-
2dsjA           EAHPAPLVLE----
2bpqA           --------------
2bpqB           --------------