[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tmar0:AAD36835.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cr3A.bssp"
#ERROR : Can't open dsspfile "2btdA.bssp"
#ERROR : Can't open dsspfile "3ct6A.bssp"
#ERROR : Can't open dsspfile "3ct6B.bssp"
#ERROR : Can't open dsspfile "3b48D.bssp"
#ERROR : Can't open dsspfile "3cr3C.bssp"
#ERROR : Can't open dsspfile "2dt8A.bssp"
#ERROR : Can't open dsspfile "2d66A.bssp"
#ERROR : Can't open dsspfile "1aamA.bssp"
#ERROR : Can't open dsspfile "2e7uA.bssp"
#ERROR : Can't open dsspfile "1arsA.bssp"
#ERROR : Can't open dsspfile "1asbA.bssp"
#ERROR : Can't open dsspfile "2aatA.bssp"
#ERROR : Can't open dsspfile "2d5yA.bssp"
#ERROR : Can't open dsspfile "1ariA.bssp"
#ERROR : Can't open dsspfile "1arhA.bssp"

## Summary of PDB Search
:497
    3e-24  22%  3cr3A  [x.x.x] PTS-DEPENDENT DIHYDROXYACETONE KINASE, ADP-
    1e-23  20%  2btdA  [x.x.x] PTS-DEPENDENT DIHYDROXYACETONE KINASE
    1e-12  18%  3ct6A  [x.x.x] PTS-DEPENDENT DIHYDROXYACETONE KINASE,
    7e-12  19%  3ct6B  [x.x.x] PTS-DEPENDENT DIHYDROXYACETONE KINASE,
    7e-12  15%  3b48D  [x.x.x] UNCHARACTERIZED PROTEIN
    1e-08  22%  3cr3C  [x.x.x] PTS-DEPENDENT DIHYDROXYACETONE KINASE,
    6e-07  16%  2dt8A  [x.x.x] DEGV FAMILY PROTEIN
    3e-04  17%  2d66A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    3e-04  22%  1aamA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    3e-04  10%  2e7uA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    4e-04  17%  1arsA  [c.67.1 (1argA)] ASPARTATE AMINOTRANSFERASE
    4e-04  17%  1asbA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    5e-04  22%  2aatA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    5e-04  20%  2d5yA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    6e-04  22%  1ariA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    8e-04  22%  1arhA  [c.67.1] ASPARTATE AMINOTRANSFERASE
:497

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxPVPDGDTGSNMCSTMLEACKYIDNVKSDDLIEVWKAVKEGALMGARGNSGVILSQILRGMADASPREY
3cr3A           --PIGDGDHGANARGSETKALEVSNFG---NVSEIFKKV--ATLSKVGGASGPLYGSAFLASKTA-----
2btdA           ------ADHGLNMNRGFSKVVEKLPAIADKDIGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQATQRQS
3ct6A           ----------------------------------------------------------------------
3ct6B           ----------------------------------------------------------------------
3b48D           ----------------------------------------------------------------------
3cr3C           ----------------------------------------------------------------------
2dt8A           ----------------------------------------------------------------------
2d66A           ----------------------------------------------------------------------
1aamA           ----------------------------------------------------------------------
2e7uA           ----------------------------------------------------------------------
1arsA           ----------------------------------------------------------------------
1asbA           ----------------------------------------------------------------------
2aatA           ----------------------------------------------------------------------
2d5yA           ----------------------------------------------------------------------
1ariA           ----------------------------------------------------------------------
1arhA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ITPADFVKMISNARKVAYSAVMRPVEGTMLTVVRVLDERLQGKNFETFEELFDWIVEIARDTVNRTPHML
3cr3A           IETLDTSELIYAGLEAIQRGKAQVGEKTVDIWSAFLND------LQTDSA----SKDNLEKVVKASAGLL
2btdA           LTLEELYQMFRDGDGVISRGKAEPGDKTMCDVWVVVESLRQSSEQLSVPVALEAASSIAESAAQSTITMQ
3ct6A           ----------------------------------------------------------------------
3ct6B           ----------------------------------------------------------------------
3b48D           ----------------------------------------------------------------------
3cr3C           ----------------------------------------------------------------------
2dt8A           ----------------------------------------------------------------------
2d66A           ----------------------------------------------------------------------
1aamA           ----------------------------------------------------------------------
2e7uA           -------------------------------------------ERPISEAYFQEAKRHIPGGVSSPVRAF
1arsA           ----------------------------------------------------------------------
1asbA           ----------------------------------------------------------------------
2aatA           ----------------------------------------------------------------------
2d5yA           ----------------------------------------------------------------------
1ariA           ----------------------------------------------------------------------
1arhA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QKLREAGVVDAGAKGLYYIFEGMRDAVKGNIQVNLEEVEQASVEELQRMAFEEITNRYCTEVAVRRNQVV
3cr3A           ATKRSIGHIDPGTQSSAYLFETLLEVV-------------------------------------------
2btdA           ARERSIGHQDPGATSVMFMMQMLALAAK------------------------------------------
3ct6A           ----------------------------------------------------------------------
3ct6B           ----------------------------------------------------------------------
3b48D           ----------------------------------------------------------------------
3cr3C           ----------------------------------------------------------------------
2dt8A           ----------------------------------------------------------------------
2d66A           ----------------------------------------------------------------------
1aamA           ----------------------------------------------------------------------
2e7uA           KAVGGTPPFLVRGEGAYVWDADGNDYVMSWGPLILGHAHPKVLARVRETLERGLTFGAPSPLEVAAKKVK
1arsA           ----------------------------------------------------------------------
1asbA           ----------------------------------------------------------------------
2aatA           ----------------------------------------------------------------------
2d5yA           ----------------------------------------------------------------------
1ariA           ----------------------------------------------------------------------
1arhA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EKSELEAFLNEIGDSVVLVEQDDLIKLHVHTNHPGQVLEKVIEFGEIVKVKIDNMKLQHEHVISTQPTKE
3cr3A           ----------------------------------------------------------------------
2btdA           ----------------------------------------------------------------------
3ct6A           ----------------------------------------------------------------------
3ct6B           ----------------------------------------------------------------------
3b48D           --------------------------------------------------------------------AK
3cr3C           ----------------------------------------------------------------------
2dt8A           ----------------------------------------------------------------------
2d66A           ----------------------------------------------------------------------
1aamA           ----------------------------------------------------------------------
2e7uA           RAYPFVDLVRFVNSGTEATMSALRLARGYTGRPYIVKFRGNYHGHADGLLVEAGSGALTLGVPSSAGVPE
1arsA           ----------------------------------------------------------------------
1asbA           ----------------------------------------------------------------------
2aatA           ----------------------------------------------------------------------
2d5yA           ----------------------------------------------------------------------
1ariA           ----------------------------------------------------------------------
1arhA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IGVVAVSPGKGISDILKSLGVDVIVPGGQTMNPSFADLKAAVEQTHAKNVFLFPNNANVLLTAKQIAEAF
3cr3A           ----------------------------------------------------------------------
2btdA           ----------------------------------------------------------------------
3ct6A           YGIVIVSHSPEIASGLKKLLTAIGGLENGEIGTSFDRVMNAIEENEADNLLTFFDLGSARMNLDLVSEMT
3ct6B           YGIVIVSHSPEIASGLKKLLTAIGGLENGEIGTSFDRVMNAIEENEADNLLTFFDLGSARMNLDLVSEMT
3b48D           ADILLVSHSKGIKEIEQNEEITIHSLGGTSDGSSDPKIIDTINEADDREFLIFADLGSAVLSSELAFDLE
3cr3C           -GIVIVSHSPEIASGLKKLSLTAIGGLENGEIGTSFDRVNAIEENEADNLLTFGSARNLDLVSET-----
2dt8A           ----------------QKVREGAAFP--TTSQPSPEDFARVYREALEEAVLSLHISGKLSGTVQSAELAA
2d66A           -------------------------------------ANRDFSFIIKQNGMFSFSG----LTKEQVLRLR
1aamA           --------------------------------------------------FIIKQNGMFSLTKEQVLRLR
2e7uA           EYAKLTLVLEYNDEVLKRRGEEIAAIGNAGVLVPTEDFLKALHEAKAYGVLLI-----------------
1arsA           -------------------------------------ANRDFSFIIKQNGMFSFSG----LTKEQVLRLR
1asbA           -------------------------------------ANRDFSFIIKQNGMFSFSG----LTKEQVLRLR
2aatA           --------------------------------------------------FIIKQNGMFSLTKEQVLRLR
2d5yA           -----------------------------------------FSFTIKQNGMFFFGG----LTKEQVLRLR
1ariA           --------------------------------------------------FIIKQNGMFSLTKEQVLRLR
1arhA           --------------------------------------------------FIIKQNGMFSLTKEQVLRLR


                         .         .         .         .         *         .         .:420
query           DDRRVIVVPTSFVQECVAAMVEYDPDAEPEDLLKRFEEAISQCVPISVTRAVRDSRYGNRRIRKGEYLLF
3cr3A           ----------------------------------------------------------------------
2btdA           ----------------------------------------------------------------------
3ct6A           DK-ELTIFNVPLIEGAYTASALLEAGATFEAIKEQLEKMLIEKRSHHHH---------------------
3ct6B           DK-ELTIFNVPLIEGAYTASALLEAGATFEAIKEQLEKMLIEKR--------------------------
3b48D           EDQQKHYVDAPLVEGAFASAITAGVSDDLTQILAEAQNAG------------------------------
3cr3C           -DKELTIFNVPLIEGAYTASALLEAGATFEAIKEQLEKLIEK----------------------------
2dt8A           QEGRVTVVDTQAASLGVGVLRAKELLEEGQSLEAVLAELERLRRDHFVRFSVATLEFLKRGLNLKPVLTL
2d66A           EEFGVYAVASGRV--NVAGM----TPDNMAPLCEAIVAVL------------------------------
1aamA           EEFGVYAVASGRV--NVAGM----TPDNMAPLCEAIVAVL------------------------------
2e7uA           ----------------------------------------------------------------------
1arsA           EEFGVYAVASGRV--NVAGM----TPDNMAPLCEAIVAVL------------------------------
1asbA           EEFGVYAVASGRV--NVAGM----TPDNMAPLCEAIVAVL------------------------------
2aatA           EEFGVYAVASGRV--NVAGM----TPDNMAPLCEAIVAVL------------------------------
2d5yA           EEFGVYAVASGRL--NVAGM----TPDNLAPLCEAIVAVL------------------------------
1ariA           EEFGVYAVASGRV--NVAGM----TPDNMAPLCEAIVAVL------------------------------
1arhA           EEFGVYAVASGAV--NVAGM----TPDNMAPLCEAIVAVL------------------------------


                         .         .         +         .         .         .         .:490
query           VRKELVSHGFSLVKVLKEALEKENAHEKEILTVFLGDNYRKPELEKIQKLIGEEFPNLDLEIYEGGQPHY
3cr3A           ----------------------------------------------------------------------
2btdA           ----------------------------------------------------------------------
3ct6A           ----------------------------------------------------------------------
3ct6B           ----------------------------------------------------------------------
3b48D           ----------------------------------------------------------------------
3cr3C           ----------------------------------------------------------------------
2dt8A           KEGRVEAAGRARGEKILKAFRAWAEGRKRIRAYFLYSGDEDAVAALRQEVLASGLPVEEALVNELGAVIA
2d66A           ----------------------------------------------------------------------
1aamA           ----------------------------------------------------------------------
2e7uA           ----------------------------------------------------------------------
1arsA           ----------------------------------------------------------------------
1asbA           ----------------------------------------------------------------------
2aatA           ----------------------------------------------------------------------
2d5yA           ----------------------------------------------------------------------
1ariA           ----------------------------------------------------------------------
1arhA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           PYLxxxx
3cr3A           -------
2btdA           -------
3ct6A           -------
3ct6B           -------
3b48D           -------
3cr3C           -------
2dt8A           SHT----
2d66A           -------
1aamA           -------
2e7uA           -------
1arsA           -------
1asbA           -------
2aatA           -------
2d5yA           -------
1ariA           -------
1arhA           -------