[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tmar0:AAD35126.1

[Show Plain Result]


## Summary of Sequence Search
    1::381
   16::158     6e-19  37%  181 aa  PF00480 ROK "ROK family"
    8::57      1e-04  34%   59 aa  PF01047 MarR "MarR family"
    5::53      4e-04  44%  190 aa  PF09840 DUF2067 "Uncharacterized protein conserved in archaea
   14::62      6e-04  38%   63 aa  PF01978 TrmB "Sugar-specific transcriptional regulator TrmB"
    1::381

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxVLRYLIESGPHSRVEIARKTGLAQSAIWRIIEELVNEGLVEEKGTATGRRRKx
PF00480         ----------------------------------------------------------------------
PF01047         -----------------VLLILAENGGLTQSELAERLGLSKSTVTRLLKRLEKKGLIERERDPEDRR---
PF09840         ----------------------------------------------------------------------
PF01978         ---------------------LLKNGPLTAREIAKELGIPRSTVYEVLKKLEEKGLVEEKGRPKKYRKK-


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxLDGAWRIIERFSTPKDFDEFKQRVTSSYENILKSHVLNKNIS
PF00480         ----------------------------LDGEILARERIPTPSDDPEALLAALAELIAELLAEL--GRVL
PF01047         ----------------------------------------------------------------------
PF09840         ----------------------------------------------------------------------
PF01978         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KVVFSLPGIVNTESKFLIHAPNLGWRNIDFRREFGNLDLEVLVENDSNLSLLAEEFFSQDVKESDVAFFL
PF00480         GIGIGVPGPVDPETGGVVSAPNPGWRNVPLKEELEELGLPVFVENDANAAALAEAWFGAGRGADDVVY-V
PF01047         ----------------------------------------------------------------------
PF09840         ----------------------------------------------------------------------
PF01978         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YFGEGIGGAISVNGKIVRGENFAAGEIGHVVLDVKNGKEVEEFLSISKLVERMEKFVELQGESLDEKFRY
PF00480         TLGTGVGGGIVINGRLLRGANGNAGEIGHMPVD-------------------------------------
PF01047         ----------------------------------------------------------------------
PF09840         ---------------------------------VRDEEEAEEFLELSKLVKAIDVYVDIKGNSLKIKV--
PF01978         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IKRLWFSGEKNVKETMEExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00480         ----------------------------------------------------------------------
PF01047         ----------------------------------------------------------------------
PF09840         -----FGTEKELKEAIKE----------------------------------------------------
PF01978         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00480         -------------------------------
PF01047         -------------------------------
PF09840         -------------------------------
PF01978         -------------------------------