[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tmar0:AAD35173.1

[Show Plain Result]


## Summary of Sequence Search
    1::322
   17::313     4e-48  42%  313 aa  PF01032 FecCD "FecCD transport family"
    1::322

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxVPLDPLEVLGVLFGLKENPGVERILSLRIPRVLASFLVGAGLSIVGNSF
PF01032         ---------------------VSISPSDVLQALLGGGDSLAQLIVWELRLPRILAALLVGAALAVAGALM


                         .         .         *         .         .         .         .:140
query           QNLLKNPLVDPYLLGISSGASFGTVVSFYLAETLGISWIYRIPLLSFGFSMIASLLTLLIARKEGRFPVT
PF01032         QGLTRNPLADPGILGVSSGAALGAVLAILLFPGLSL---LGLPLAAFIGALLAALLVYLLARRRGGLSPL


                         +         .         .         .         .         *         .:210
query           TIVLSGVVVSTLFSSLTYMTIVLLKRNVTTISMWLFGSFSGSTWEDVLFYLMVVIPFLLYSLIFSKHLNA
PF01032         RLLLAGIAVSALFSALTSLLLLLADEQLQSLLFWLMGSLAGATWSDVLILLPVLLIGLILALLLARRLNV


                         .         .         .         +         .         .         .:280
query           MALGEEEAFILGVSVERLKVVTFLFGNLITAFLVSRSGVIGFVGLIVPHISRYLVGPNFXXXXXXXXXXX
PF01032         LSLGDDVARSLGVNVERLRLLLLLLAALLTAAAVAVVGPIGFVGLVVPHIARLLVGPDHRRLLPASALLG


                         .         *         .         .         .         .         +:350
query           XXXXXXCDTAARTFFSPTELPVGVVTALIGAPFLAFLMKRxx
PF01032         ALLLLLADLLARTLLAPAELPVGIVTALIGAPFFLYLLRR--