[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tmar0:AAD35418.1

[Show Plain Result]


## Summary of Sequence Search
    1::187
   19::112     7e-06  43%  116 aa  PF00156 Pribosyltran "Phosphoribosyl transferase domain"
    1::187

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDVETVVGPAMGGVIL
PF00156         -------------------------------------------------------DKDVVVGIPRGGVPL


                         .         .         *         .         .         .         .:140
query           SYVVARYLKARSLFAERENGVMKLRRGFFVKPGEKVAVVEDVVTTGGSVKEVIELLKEYGANVVCVxxxx
PF00156         AAALARRRRPSSDEEERERGVARLIRLVGDVKGKRVLLVDDVITTGGTLAAAAEALREAGAKVVYV----


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00156         -----------------------------------------------