[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tmar0:AAD35545.1

[Show Plain Result]


## Summary of Sequence Search
    1::614
    4::364     5e-36  35%  366 aa  PF00496 SBP_bac_5 "Bacterial extracellular solute-binding proteins,
    1::614

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00496         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PRLAERWEILDDGKTYKFYIRKGVKFHEGGDLTPEDVEYSFERGLIFDPTAGPMWMLWEALFGVDSLETF
PF00496         PDLAESWEVSDDGLTYTFKLRKGVKWSDGTPVTADDVVFSFER--LLDP---------------------


                         +         .         .         .         .         *         .:210
query           VEEKIGKPYSELFDENGEPLPEYRDALIKIYTDYIDPAIEVEGDAVVFHLVRPFAPFMYILAQSASWSAV
PF00496         ---KTASPYASLLSD-----------------DDIEGVEAVDDYTVVITLKKPDPLFLYLLAPPPASPVP


                         .         .         .         +         .         .         .:280
query           LDKEWCIEIGCWDGRADTWWKYHDIRKEDSPLYARMNGTGPFKFVEWDRAQQKVILERNDNYWREPAKIK
PF00496         KAK----------GDDD---KYGTL--PENPV-----GTGPYKLKEYDPGQY-IVLERNPDYWDGKPKLD


                         .         *         .         .         .         .         +:350
query           RVIIWGIDEWSTRRAMFLQGDADICAVPTQYLEQVEGKPGVTVVKGLPELAVTSLHFAWNVPEDSKYIGS
PF00496         EITFRVVPDESTALLALESGEIDIAGVPPSDIDQLKANPGLKVLVTGPGLGTYYLGFNTDNPP-------


                         .         .         .         .         *         .         .:420
query           GKLDGNGIPPDFFSDENVRKAFIYAFDYDTFINEVLKGLGRKIPTDXXXXXXXXXXXXXXDPDAPHFDIV
PF00496         ------------FADKRVRQALAYAIDRDAIVKAVYGGLGT--PANGPIPPGSPGYDDGLEDYEYAYDPE


                         .         .         +         .         .         .         .:490
query           KATEYFKKAWNGEVWKKGFKITLLYNTGNEVRRQAAEMLKAYIEMINPKFKVEVRGVQWPTYLDATKRGE
PF00496         KAKELLAEA-GYKLGKGGLVLTLLLTSGDPERKKIAEAIQQQLKKLG--IKVELKALDWAVYLDRLRKGD


                         *         .         .         .         .         +         .:560
query           VPAFIIGWLADYPDPHNFIFTYYHSAGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00496         FDIALGGWGADYPDPDNFLDLFSNSGG-------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00496         ------------------------------------------------------