[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tmar0:AAD35678.1

[Show Plain Result]


## Summary of Sequence Search
    1::246
    1::220     8e-43  46%  222 aa  PF00497 SBP_bac_3 "Bacterial extracellular solute-binding proteins,
    1::246

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLVGLSADFPPFEFVDENGNIVGFDVDLAKEIARRLGVELK
PF00497         ------------------------------LVG-TADYPPFSYVDENGKLVGFDIDLLKAIAKRLGFKVE


                         .         .         *         .         .         .         .:140
query           IVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGQVIVVRKDSDFRPKTYEDLVGKTVA
PF00497         FVPTSWNGLIPALQSGKADLAVAGLTITPEREKVVDFSDPYYESGIVILVKKDEMISPKSLEDLKGKRVG


                         +         .         .         .         .         *         .:210
query           VQIGTTGDIEVSKYDGIKVVRFDKFTDAFLELKRGRADAVVLDSATARAFVAKNPDLVISSGVLSSEQYG
PF00497         VVKGSSTELRDQLPKGAKLVTYDSYEEALKALAAGRVDAFLMDSPVLDYLLARDPNLVVVGGPLFDEPGY


                         .         .         .         +         .         .         .:280
query           IAVRKEDTDLLEFINSVLRELKKSPYDVLIEKWFxx
PF00497         GAVRKKDSPLRDKINKALLELKEGELQKLYDKWF--