[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tmar0:AAD35750.1

[Show Plain Result]


## Summary of Sequence Search
    1::377
    6::357     6e-74  42%  358 aa  PF01041 DegT_DnrJ_EryC1 "DegT/DnrJ/EryC1/StrS aminotransferase
   17::164     7e-12  37%  341 aa  PF00155 Aminotran_1_2 "Aminotransferase class I and II"
   51::229     4e-08  33%  384 aa  PF01053 Cys_Met_Meta_PP "Cys/Met metabolism PLP-dependent enzyme"
   24::121     6e-05  31%  285 aa  PF01212 Beta_elim_lyase "Beta-eliminating lyase"
    1::377

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAM
PF01041         ----------------EEIAAVAEVLDSGWLTTGPEVKEFEEEFAEYLGVKHAVAVNSGTAALHLALRAL
PF00155         --------------------------AAGGGLLGQGLPELREAIADFLGRRRGVPVTSGAQAALALLLQL
PF01053         --------------------------------LGNPTRALEERLAALEGGEAALAFASGMAAITAALLAL
PF01212         ----------------------------GDDVYGDDVNALEEKVAELFGKEAALFVPSGTQANLIALRA-


                         .         .         *         .         .         .         .:140
query           GVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDL
PF01041         GIGPGDEVITPAFTFVATANAILYVGATPVFVDIDPDTLNIDPEALEAAI-TPRTKAIIPVHLFGQPADM
PF00155         LLDPGDEVLVPEPTYPSYIAAARLAGAEVVPVPLDEDDFGLDLEALEAALTEAKTKLIVPNNPTGAVLSL
PF01053         -LKAGDHIVASDDLYGGTEKVLPRFGIEVTFVD------PTDLEALEAAIRPNTKLVFLPSNPLLEVVDI
PF01212         HCQRGEEVIQPAHIYFDETGAIAELGGAKVLPVPGAEDGKLDLEKLEAAIKPD-----------------


                         +         .         .         .         .         *         .:210
query           EALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIA
PF01041         DAIMAIAKKHGLPVIEDAAQALGATYKG-----RKVGTFGDIGCFSFHPTKNL-TTGEGGAVVTNDEELA
PF00155         EELEELAEKYDLLIIED-----------------------------------------------------
PF01053         EAIAAIAHAHGALLVVDNT--------FATPYLQRPLELG-ADIVVHSATKYLGGHSDGGVVVDNGKELA
PF01212         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPR
PF01041         ERARLLRNHGAFDRYLHEELGYNYRMTELQAAIGLAQLKRLDEFIARRRAIAARYDEALAD--LPGITLL
PF00155         ----------------------------------------------------------------------
PF01053         ERLRFLR---------------------------------------------------------------
PF01212         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSK
PF01041         PLPDGAEEHSWHLFPIRLDEEIDRDELIEALKEAGIGTRVHYPIPLHLQPAYKDLGYAPGDLPVAERLAE
PF00155         ----------------------------------------------------------------------
PF01053         ----------------------------------------------------------------------
PF01212         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RSLALPMFPELRDDEIKEVVDTIxxxx
PF01041         RVLSLPLHPGLTEEDVDRVIEAI----
PF00155         ---------------------------
PF01053         ---------------------------
PF01212         ---------------------------