[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tmar0:AAD35944.1

[Show Plain Result]


## Summary of Sequence Search
    1::355
    2::222     1e-42  42%  238 aa  PF00483 NTP_transferase "Nucleotidyl transferase"
    3::150     1e-07  31%  222 aa  PF01128 IspD "Uncharacterized protein family UPF0007"
  251::310     1e-04  28%  394 aa  PF07959 Fucokinase "L-fucokinase"
    1::355

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxAIVLCAGKGTRLRPLTFTTAKHLIPIANKPILFYSLENIARAGIEEVGIVVSPHNAEEFKSIVGTGE
PF00483         ---AVILAGGLGTRLRPLTRERPKKLLPVGGKPLIQYTLERLAAAGIEEIIVVVTGYHKESIEEHLGDGY
PF01128         ---AIILAAGSGSRMGA---GLPKQYLELGGKPILEHTLEALAHPAIDEIVVVVSPDDIEYFEELLG---
PF07959         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NFGLRISYIIQEEPKGLAHAVWVSREFLGDEDFMMYLGDNLILEDLGKFVKDFENSDYAASILLSPVKDP
PF00483         ELGVEITYVLQPEPLGTAHAVLLAADFIGDEPFVVLVGDHLIDDDFAELLEAHRGADGLVTVGIVPVEDP
PF01128         KYDKRVK-VVEGGAERQDSVLNGLAALAGDADWVLVHDAAVTPEDIDRLIAAAE--EYGAAILAVPVKDT
PF07959         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TRFGVAVMEGDRVIKVVEKPKTPPSNLAIVGLYLFRNKIFEGIKNIKPSWRGELEITDAIEYLIEKGEKV
PF00483         TGYGVIERDEDRVTRFVEKPDATASNLANTGIYVFNPGIFDFLELLEPLARGEPELTDAIPALLEEGKVV
PF01128         IKRGVVVETVDR----------------------------------------------------------
PF07959         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RGYIVYGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSSIQGPVRIGKASKIVNSVIRGPAVIGENC
PF00483         VAYLFRG---------------------------------------------------------------
PF01128         ----------------------------------------------------------------------
PF07959         ----------------------------------------SSPATPCDVAATSVVINSILEGGVSVGPGS


                         .         *         .         .         .         .         +:350
query           FIKNSYVGPYSSIGNRVILEDCEVENSIVMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00483         ----------------------------------------------------------------------
PF01128         ----------------------------------------------------------------------
PF07959         VVEYSHLGGGVSIGSRCIVSGVDVNASTLL----------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxx
PF00483         -----
PF01128         -----
PF07959         -----