[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tmar0:AAD36098.1

[Show Plain Result]


## Summary of Sequence Search
    1::422
   12::175     7e-19  31%  347 aa  PF07690 MFS_1 "Major Facilitator Superfamily"
   31::183     1e-11  34%  433 aa  PF00083 Sugar_tr "Sugar (and other) transporter"
    2::335     6e-04  28%  560 aa  PF03137 OATP "Organic Anion Transporter Polypeptide (OATP) family"
  542::599     8e-04  43%  644 aa  PF10136 SpecificRecomb "Site-specific recombinase"
    1::422

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxIFILILMVLLNADQMVMSPNIGAIEQEFNITDAQIGLVASSFTVIGALVSLVWGYLADRYSRKNLLI
PF07690         ---------------DRSILSPALPALAEDLGLSPSQVGLLLSAFLLGYALGSPPAGPLADRFGRRRVLL
PF00083         ----------------------------------DDSVGLLTGSILFLGALIALFFGPLADRFGRKKALL
PF03137         ---MFLLVLGLLGFLQAMVFNSTITTIEKRFKIPSSTTGLIASGNEIGNLLLSVFVSYFGGRGHRPRWIG
PF10136         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YSILVGEIPCLMSAFSRSYGELFFWRALTGIGVGASFPIVYSMIGDMFDEVKRGKVVALISSAISIGSVL
PF07690         LGLLLFALGSLLLAFASNSWLLLVARFLQGLGAGGLFPAASALIADWFPPEERGRALGIFSAGGGLGAAL
PF00083         LSLLLMAVGTLLIAFAPNPALLIVGRFLQGLGVGGESGVAPVYISEIAPPKKRGFLVSLYQLFITLGILL
PF03137         IGLLLMGLGCLLFALSTSVPLVLFFLAQLLLGIGAT-PLYTLGITYLDDNVKKKNYLGILYSLRMLGPAI
PF10136         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GMIVGGFLGPKYGWRVPFIAVSVPNIFFAVLSIFVLKEPKRGAFEKGIGELVQSGYEYPKAPKLSDYAKL
PF07690         GPLLGGLLAESLGWRWAFLILAILGLLALLLALLLLPEP-------------------------------
PF00083         AALVGSLIGGDWGWRIPFGLGAVPALLLLLGRLFLPESPR------------------------------
PF03137         GFLLGSFLLKIYAWWLGFLILGALLLLVAIPLFFFPKEPK--AKKESLSERKTEDEELKAAEELKDFPKL
PF10136         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VKVKTNLLLFFQGIAGTIPWGAIPYFLVEFFRRERGLSVETATLVxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF03137         KRLLTNPVYMFNTLAGSLGVSGFATFLPKYLETQFGLSASSASFL-------------------------
PF10136         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxI
PF07690         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF03137         ----------------------------------------------------------------------
PF10136         ---------------------------------------------------------------------L


                         .         .         .         .         *         .         .:420
query           FNLTDSLGTGFGKFAGGVMSVALGSLGAALKVSAYFWLICAVLLFVLVxxxxxxxxxxxxxxxxxxxxxx
PF07690         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF03137         ----------------------------------------------------------------------
PF10136         LGLTPAIGSFFGTFSSGNLGYALGSLGDALGLPAFWWAVAGVLLIGLL----------------------


                         .         .         +         .         .         .         .:490
query           xx
PF07690         --
PF00083         --
PF03137         --
PF10136         --