[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tmar0:AAD36465.1

[Show Plain Result]


## Summary of Sequence Search
    1::290
   10::275     5e-49  43%  277 aa  PF01430 HSP33 "Hsp33 protein"
    1::290

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxDHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAALVTPWLAEKERWTLDIEGNGPI
PF01430         --------DGDVRGEAVRLTETVQEALKRHDYPPPVTALLGEALAATALLGATLKFDGRLTLQIQGDGPV


                         .         .         *         .         .         .         .:140
query           RRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIGQGVLRVVRDLGLKTPFVSQVPLVSGEIAEDL
PF01430         GLIVVDADADGEVRGYAGNPEVDLPLAPDG--DVGELVGNGYLAVTKDPGLGEPYQGIVPLEGGEIAEDL


                         +         .         .         .         .         *         .:210
query           AYYFAVSEQIPSAFSIGVLVDSDGVKIAGGFAVQIIDRTLEQEKVEMIEKNIKNLPSISKLFQEAEPLDV
PF01430         EHYFAQSEQLPTRVGLGVLVDEDGVKRAGGLLLQVLPGA-DEEDWERLETLLETLISEELLDPGLSPEEL


                         .         .         .         +         .         .         .:280
query           LERIFGEKVGFVETAEIKYKCDCNREKAKNALLVLDKKELEDMRKEGKGEVVCKWCNTRYVFxxxxxxxx
PF01430         LYRLFHEEVRILEPQPVRFRCTCSRERVADALLSLGKEELEDMEEDGKIEVTCEFCGKKYHF--------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxx
PF01430         ----------