[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tmar0:AAD36480.1

[Show Plain Result]


## Summary of Sequence Search
    1::716
   11::569     2e-83  44%  571 aa  PF09960 DUF2194 "Uncharacterized protein conserved in bacteria
    1::716

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09960         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSDINTLLNLLGVSFRYGWRQETVF
PF09960         ---------------------------------------------LYKINNVLNKIGVHYTYGWKQEKNF


                         +         .         .         .         .         *         .:210
query           SYEIEDGYLIKLPSFPVKKAFDGFEVFSSNVKIVSYAVTKKGKHPVIFYGPFGGMALFDHAFNENGEPVV
PF09960         D---------KTPANAVAKDVDKYKLF---------------------------------LFDSNGE---


                         .         .         .         +         .         .         .:280
query           DLRKIVMDIVGGYRENKVLMLDENHHIRKMFEYALFEVDSSRSGVLQKYRAIVIPDVSFLEEKEIKSYLE
PF09960         ------------------LSLDIEENLKKALEYAKIEYDTSSIPSLSPYRTIIIEDLDPLPDEDIKNYVE


                         .         *         .         .         .         .         +:350
query           NGGVVILVGSGTHYIQGEVVLEKENLYIPQDITVGERKVGYIPAPENAKAFITISGTPVSWMEKREKGAF
PF09960         NGGNVIFAGTNLNSILGGEKLDVKGIYFEEDLFPGGGDLSEVTLDENSTVLITAEDTPLLWEKKYGKGKV


                         .         .         .         .         *         .         .:420
query           VFFPEDLLEKWSRGILFNEFLEASDFVISPMVNAFSVFLDDFPLPAYGIEYDILGTTDEIFYYKIWWRDM
PF09960         VYINGDLLNKKLRGLLAQSISLLSDFFIYPVINSFIFYLDDFPSPIPSGEKKNIGISDEEFYYKIWWPDM


                         .         .         +         .         .         .         .:490
query           KELCEDFSIKPITALVTSYEQKTDYNGFFEFLEKDSSLKVLKNLIEDERVDTGIHGYNHVPPKSENWDLE
PF09960         KKLAEEYNIKYTGVLIENYNNKTKPPEFFEQLDTDEFIYFGRELLNSGG-ELGIHGYNHQPLLLENYNKE


                         *         .         .         .         .         +         .:560
query           ELGKAYKSLRIFLSQLSSSYEPVAFVAPNNEIDQAGIEVLKSVFPTIKVIGTAYSLKDSTGEFTLLDDAL
PF09960         AMVASLKALKKFLKNLFPNYELKVYVPPSNIIDEEGREALKEAFPTIKTIASTYSGDDSEGEFGVAEDGI


                         .         .         .         *         .         .         .:630
query           ILPRTTSGCYPLQRLLMETVSTLLNLGTYHHFSHPDDVISLDRNPERYSWNEMFDQLRSFFRIMKENYPW
PF09960         VFPRITSGYYPDDRELLTAVSTLANLGVFSHFIHPDDVLDEDRNGN-LTWEELFKSLDKFLDEIKENYPW


                         .         +         .         .         .         .         *:700
query           LRNMDSKELYNTFKDYFENKPRILYHDKKIVIVLPRTAELPRYFFLKAKGDVNVHGGVILFRDKDLxxxx
PF09960         LRNMTASEAYGAVKDYLTLKPAISYEDDKIEIILENFPDLPYYFLRKNKGPVKVIGGSITKLDGDL----


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxx
PF09960         ----------------