[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tmar0:AAD36720.1

[Show Plain Result]


## Summary of Sequence Search
    1::434
    1::198     2e-23  41%  252 aa  PF00591 Glycos_transf_3 "Glycosyl transferase family, a/b domain"
    1::75      1e-16  53%   75 aa  PF07831 PYNP_C "Pyrimidine nucleoside phosphorylase C-terminal
  237::309     2e-04  37%  348 aa  PF06381 DUF1073 "Protein of unknown function (DUF1073)"
    1::43      7e-04  47%   65 aa  PF02885 Glycos_trans_3N "Glycosyl transferase family, helical
    1::434

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxAYDVILKKRNGEKLSREEIEFMVGGYVKGEIPDYQMAAFLMAVxxxxxxxxxxxxxxxxxxxxxxxxx
PF00591         ----------------------------------------------------------------------
PF07831         ----------------------------------------------------------------------
PF06381         ----------------------------------------------------------------------
PF02885         --AVEIIKKLRDGRDLTREEARAAFDGILDGEVSDAQIAAFLMAL-------------------------


                         .         .         *         .         .         .         .:140
query           xxxxPGTKVDKHSTGGVGDKTTLVVAPLVASAGVPVAKMSGRALGHTGGTIDKLESIPGFRTELSLEEFI
PF00591         ----PGPVVDKHGTGGDGDNTFNIAAPVVAAAGVPVAKHGNRALTSKSGTADVLEAL-GVNVDLSPEEVR
PF07831         ----------------------------------------------------------------------
PF06381         -------EVIKYSLSGLKDALELIKADIAAASGIPLTRLFGKGLGATGGDISNYDNIKGVQ-ELVLTPFL
PF02885         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KNVKKYGIAIVGQTGNLVPADKKIYALRDATATVDEISLIASSIMSKKLAGGSDAFVLDVKFGTGAFMKG
PF00591         RVLEEVGIAFL-FAPNLHPADKHLYPVRDELGTRTIFNLLGP--LSNPAAAGAQLLGVDVPVGAGAFAEA
PF07831         ----------------------------------------------------------------------
PF06381         ERLLKY----------------------------------------------------------------
PF02885         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FEDAKKLAFLMLRIAQQHGKKAVAVLSNMDQPLGKAVGNSLEVIEAIETLKGNGPEDxxxxxxxxxxxxx
PF00591         LELLGELAALVVHGGEGLDEISLAGPTDVAELLGGEIGNALEVPEPLEDLKGGLPEE-------------
PF07831         ----------------------------------------------------------------------
PF06381         ----------------------------------------------------------------------
PF02885         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFVSKID
PF00591         ----------------------------------------------------------------------
PF07831         ----------------------------------------------------------------YVSAID
PF06381         ----------------------------------------------------------------------
PF02885         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AEKVGIASMMLGAGRKKKEDRIDHSVGIIVEKKLGDSVKKGEAIARLFVSDRSDVESALKLLKEAYVISx
PF00591         ----------------------------------------------------------------------
PF07831         ARALGLAAVLLGAGRARKEDPIDHAVGISLHKKVGDQVKKGEPLATIHANDEAKLEQALEALKNAYRIA-
PF06381         ----------------------------------------------------------------------
PF02885         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxx
PF00591         --------------
PF07831         --------------
PF06381         --------------
PF02885         --------------