[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tmar0:AAD36800.1

[Show Plain Result]


## Summary of Sequence Search
    1::1074
   60::351     2e-32  30%  354 aa  PF03739 YjgP_YjgQ "Predicted permease YjgP/YjgQ family"
    1::1074

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03739         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxVPVGVLLAIFWTFSRLSEERELMAIQVHGISQKNLIVPFLILGALLSIAVFFLSDQIVPEYQS
PF03739         -------LPLAVLLASLLTFGRLAEDSELTAMRASGISLLRLMRPLLVLALLLSLLTFLFNNYVVPWANQ


                         +         .         .         .         .         *         .:210
query           KAEEAMSKYVLKKPEVFVVENVISKIGDDQYFYVEKYDERTSTMWNVVIFRYGHEETIVTAKRVQKKGND
PF03739         KARNLLADIKQKKPALAIQEGVFYKDGDGYVIYVGKVDDDGGTLKDVFIYDFGGLTSVITADRLETTADD


                         .         .         .         +         .         .         .:280
query           WYLFDGNYYTVDKDGFLKLDVHFSEMKLDITEDIEKLLRVGKTPKEMTGXXXXXXXXXXXXVGVKPSPWV
PF03739         LVLYDGTRYELDPGGSDFSITEFDEYRIPISLTPSDLSRLDEDPEELSISELWVYIKYLKSSGQDLRRYE


                         .         *         .         .         .         .         +:350
query           VELHSRYANSLTPIVIVLVGVPLSLLFQLRSKSWGVIFTFVLVVLYQGSGAWLSAMGKENLLNPVLAPWI
PF03739         AELHKKLALPLACLVFVLIGAPLGAIIRRGGRGLPVLIAILLFLLYYVLLILGEKLAEDGKLPPLLGAWL


                         .         .         .         .         *         .         .:420
query           PNIVFTIVGTLLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03739         PNLIFLLLGLYL----------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03739         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03739         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03739         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03739         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03739         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03739         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03739         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03739         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03739         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxx
PF03739         ------------------------