[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tmar0:AAD36835.1

[Show Plain Result]


## Summary of Sequence Search
    1::497
    1::171     8e-18  41%  173 aa  PF02734 Dak2 "DAK2 domain"
   29::103     8e-04  31%  180 aa  PF07882 Fucose_iso_N2 "L-fucose isomerase, second N-terminal
    1::497

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxVPDGDTGSNMCSTMLEACKYIDNVKSDDLIEVWKAVKEGALMGARGNSGVILSQILRGMADASPREY
PF02734         ---VGDGDTGTNMARGFRAALEALDDLPLADIGEVLKAIAMALLSGAGGNSGVLLGQFFRGAAKAKGKEE
PF07882         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ITPADFVKMISNARKVAYSAVMRPVEGTMLTVVRVLDERLQGKNFETFEELFDWIVEIARDTVNRTPHML
PF02734         LTAADLAAALQAALD-AVQAVAKPGDKTMLDVLRPAAEALEAKDGEDLAEALEAAAEAAEAGAESTKDML
PF07882         ---------------------MRVESVDMTEIVRRIDEGIYDE--EEFEKALAWLEENCKEGDDKNPEDL


                         +         .         .         .         .         *         .:210
query           QKLREAGVVDAGAKGLYYIFEGMRDAVKGNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02734         AVLRSLGVVDPGAVGLALILEAL-----------------------------------------------
PF07882         QRQREQ--KDAQWEFSIKMYLAIRDIMEGN----------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02734         ----------------------------------------------------------------------
PF07882         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02734         ----------------------------------------------------------------------
PF07882         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02734         ----------------------------------------------------------------------
PF07882         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02734         ----------------------------------------------------------------------
PF07882         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxx
PF02734         -------
PF07882         -------