[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tmar0:AAD36863.1

[Show Plain Result]


## Summary of Sequence Search
    1::220
    2::177     8e-04  30%  189 aa  PF09704 Cas_Cas5d "CRISPR-associated protein (Cas_Cas5)"
    1::220

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLVFDVSAPYALFRRPYTTTSSYTLPFPPRTTXXXXXXXXXXYSTPERLDSAKVAVQIKNPLKFLRTG
PF09704         ---LVFRLYGPLASFRRPATKVSRLTYPVPPPSAVLGLLAAILGIRRDDRLNALKFAVRVDRRGEVLR-D


                         .         .         *         .         .         .         .:140
query           TNFVETKKDKKASKRTRISLQLLKNPAYRVFFSWEDEDFERLKNLLEHSETIFTPYLGVASFIARLNYVG
PF09704         YHTVQTRRDRKQRAGTILSREYLIDAHFLVAVSAEDDKLEELERALR--KPVFPLYLGRRECLAPVEPVG


                         +         .         .         .         .         *         .:210
query           KYEATRVADFPCEVHTVVPNTVKLLPExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09704         EGLEDALDEYPLEADDETRRDVPLDPE-------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxx
PF09704         ----------