[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tmar0:AAD36879.1

[Show Plain Result]


## Summary of Sequence Search
    1::124
    5::89      2e-05  35%   94 aa  PF02579 Nitro_FeMo-Co "Dinitrogenase iron-molybdenum cofactor"
    1::124

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIV
PF02579         ----------------VDGHFGHAPRFLIYEVEDGEVELVE-NRNPYAPAEGGGGLAELLAASDVDVVIV


                         .         .         *         .         .         .         .:140
query           RGIGRRAIAAFEAMGVKVIKGASGTVEEVVxxxxxxxxxxxxxxxxxxxxxxxx
PF02579         GGIGQGAAAKLAAAGIKVIKTAEGDIEEAL------------------------