[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tmar0:AAD35126.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2hoeA2.bssp"
#ERROR : Can't open dsspfile "1z05A2.bssp"
#ERROR : Can't open dsspfile "2ap1A1.bssp"
#ERROR : Can't open dsspfile "1sz2A1.bssp"
#ERROR : Can't open dsspfile "1sazA2.bssp"
#ERROR : Can't open dsspfile "2gupA2.bssp"
#ERROR : Can't open dsspfile "1g99A2.bssp"
#ERROR : Can't open dsspfile "1xc3A2.bssp"
#ERROR : Can't open dsspfile "2aa4A2.bssp"
#ERROR : Can't open dsspfile "2gupA1.bssp"
#ERROR : Can't open dsspfile "1woqA1.bssp"
#ERROR : Can't open dsspfile "1q18A2.bssp"
#ERROR : Can't open dsspfile "2ewsA1.bssp"
#ERROR : Can't open dsspfile "1woqA2.bssp"
#ERROR : Can't open dsspfile "1z05A1.bssp"
#ERROR : Can't open dsspfile "2htjA1.bssp"
#ERROR : Can't open dsspfile "1z05A3.bssp"
#ERROR : Can't open dsspfile "2jn6A1.bssp"
#ERROR : Can't open dsspfile "2aa4A1.bssp"
#ERROR : Can't open dsspfile "1z6rA1.bssp"
#ERROR : Can't open dsspfile "2ap1A2.bssp"
#ERROR : Can't open dsspfile "2hoeA3.bssp"
#ERROR : Can't open dsspfile "1wi9A.bssp"
#ERROR : Can't open dsspfile "1qbjA.bssp"
#ERROR : Can't open dsspfile "1xc3A1.bssp"
#ERROR : Can't open dsspfile "1sfxA.bssp"
#ERROR : Can't open dsspfile "2hoeA1.bssp"
#ERROR : Can't open dsspfile "2ethA1.bssp"
#ERROR : Can't open dsspfile "2b0lA1.bssp"
#ERROR : Can't open dsspfile "2a61A1.bssp"
#ERROR : Can't open dsspfile "1xd7A.bssp"
#ERROR : Can't open dsspfile "1lnwA.bssp"
#ERROR : Can't open dsspfile "1oyiA.bssp"
#ERROR : Can't open dsspfile "2oa4A1.bssp"
#ERROR : Can't open dsspfile "2h6bA1.bssp"
#ERROR : Can't open dsspfile "2ch5A2.bssp"
#ERROR : Can't open dsspfile "1biaA1.bssp"
#ERROR : Can't open dsspfile "1ulyA.bssp"
#ERROR : Can't open dsspfile "1ub9A.bssp"
#ERROR : Can't open dsspfile "1fp2A1.bssp"
#ERROR : Can't open dsspfile "2fbhA1.bssp"
#ERROR : Can't open dsspfile "2fbiA1.bssp"
#ERROR : Can't open dsspfile "3bz6A2.bssp"
#ERROR : Can't open dsspfile "1mkmA1.bssp"
#ERROR : Can't open dsspfile "1lvaA3.bssp"
#ERROR : Can't open dsspfile "1u2wA1.bssp"
#ERROR : Can't open dsspfile "1s3jA.bssp"
#ERROR : Can't open dsspfile "1on1A1.bssp"
#ERROR : Can't open dsspfile "2p8tA1.bssp"
#ERROR : Can't open dsspfile "1jgsA.bssp"
#ERROR : Can't open dsspfile "1p4xA1.bssp"
#ERROR : Can't open dsspfile "1xcbA1.bssp"
#ERROR : Can't open dsspfile "1q18A1.bssp"
#ERROR : Can't open dsspfile "1t6sA2.bssp"
#ERROR : Can't open dsspfile "1zybA1.bssp"
#ERROR : Can't open dsspfile "1q1hA.bssp"
#ERROR : Can't open dsspfile "1lvaA4.bssp"
#ERROR : Can't open dsspfile "2obpA1.bssp"
#ERROR : Can't open dsspfile "1nmnA.bssp"
#ERROR : Can't open dsspfile "1sfuA.bssp"
#ERROR : Can't open dsspfile "1i1gA1.bssp"
#ERROR : Can't open dsspfile "2cohA1.bssp"
#ERROR : Can't open dsspfile "2eshA1.bssp"
#ERROR : Can't open dsspfile "2fxaA1.bssp"
#ERROR : Can't open dsspfile "1cgpA1.bssp"
#ERROR : Can't open dsspfile "2bv6A1.bssp"
#ERROR : Can't open dsspfile "1ft9A1.bssp"
#ERROR : Can't open dsspfile "1h3dA2.bssp"
#ERROR : Can't open dsspfile "1p6rA.bssp"
#ERROR : Can't open dsspfile "1h54A1.bssp"
#ERROR : Can't open dsspfile "2hs5A1.bssp"
#ERROR : Can't open dsspfile "1v4rA1.bssp"
#ERROR : Can't open dsspfile "2gauA1.bssp"
#ERROR : Can't open dsspfile "2fnaA1.bssp"
#ERROR : Can't open dsspfile "1fnnA1.bssp"
#ERROR : Can't open dsspfile "1xmkA1.bssp"
#ERROR : Can't open dsspfile "1mzbA.bssp"
#ERROR : Can't open dsspfile "1lj9A.bssp"
#ERROR : Can't open dsspfile "1aoyA.bssp"
#ERROR : Can't open dsspfile "1p4xA2.bssp"
#ERROR : Can't open dsspfile "2pg4A1.bssp"

## Summary of PDB Search
:381
    9e-27  34%  2hoeA2 [c.55.1.10] N-ACETYLGLUCOSAMINE KINASE A:200 -- 368
    1e-21  15%  1z05A2 [c.55.1.10] TRANSCRIPTIONAL REGULATOR, ROK FAMILY A:209 --
    1e-21  25%  2ap1A1 [c.55.1.10] PUTATIVE REGULATOR PROTEIN A:118 -- 303
    1e-20  12%  1sz2A1 [c.55.1.7] GLUCOKINASE A:3 -- 321
    2e-18  14%  1sazA2 [c.55.1.2] PROBABLE BUTYRATE KINASE 2 A:173 -- 375
    3e-18  26%  2gupA2 [c.55.1.10] ROK FAMILY PROTEIN A:115 -- 289
    7e-18  17%  1g99A2 [c.55.1.2] ACETATE KINASE A:198 -- 398
    5e-17  21%  1xc3A2 [c.55.1.10] PUTATIVE FRUCTOKINASE A:119 -- 294
    6e-17  21%  2aa4A2 [c.55.1.10] PUTATIVE N-ACETYLMANNOSAMINE KINASE A:120 -- 289
    6e-13  22%  2gupA1 [c.55.1.10] ROK FAMILY PROTEIN A:1 -- 114
    2e-11  27%  1woqA1 [c.55.1.10] INORGANIC POLYPHOSPHATE/ATP-GLUCOMANNOKINASE
    4e-11  21%  1q18A2 [c.55.1.7] GLUCOKINASE A:112 -- 321
    1e-09  10%  2ewsA1 [c.55.1.14] PANTOTHENATE KINASE A:1 -- 267
    2e-09  22%  1woqA2 [c.55.1.10] INORGANIC POLYPHOSPHATE/ATP-GLUCOMANNOKINASE
    2e-08  27%  1z05A1 [a.4.5.63] TRANSCRIPTIONAL REGULATOR, ROK FAMILY A:10 --
    3e-08  18%  2htjA1 [a.4.5.73] P FIMBRIAL REGULATORY PROTEIN KS71A A:1 -- 73
    3e-08  19%  1z05A3 [c.55.1.10] TRANSCRIPTIONAL REGULATOR, ROK FAMILY A:81 --
    5e-08  16%  2jn6A1 [a.4.1.19] PROTEIN CGL2762 A:1 -- 89
    6e-08  17%  2aa4A1 [c.55.1.10] PUTATIVE N-ACETYLMANNOSAMINE KINASE A:1 -- 119
    1e-07  35%  1z6rA1 [a.4.5.63] MLC PROTEIN A:12 -- 81
    3e-07  21%  2ap1A2 [c.55.1.10] PUTATIVE REGULATOR PROTEIN A:1 -- 117
    4e-07  21%  2hoeA3 [c.55.1.10] N-ACETYLGLUCOSAMINE KINASE A:72 -- 199
    6e-07  20%  1wi9A  [a.4.5.47] PROTEIN C20ORF116 HOMOLOG
    6e-07  21%  1qbjA  [a.4.5.19] PROTEIN (DOUBLE-STRANDED RNA SPECIFIC ADENOSINE
    8e-07  17%  1xc3A1 [c.55.1.10] PUTATIVE FRUCTOKINASE A:1 -- 118
    1e-06  22%  1sfxA  [a.4.5.50] CONSERVED HYPOTHETICAL PROTEIN AF2008
    1e-06  25%  2hoeA1 [a.4.5.63] N-ACETYLGLUCOSAMINE KINASE A:10 -- 71
    1e-06  25%  2ethA1 [a.4.5.28] TRANSCRIPTIONAL REGULATOR, PUTATIVE, MAR FAMILY
    2e-06  19%  2b0lA1 [a.4.5.66] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC A:167
    2e-06  18%  2a61A1 [a.4.5.28] TRANSCRIPTIONAL REGULATOR TM0710 A:5 -- 143
    3e-06  17%  1xd7A  [a.4.5.55] YWNA
    3e-06  22%  1lnwA  [a.4.5.28] MULTIDRUG RESISTANCE OPERON REPRESSOR
    3e-06  12%  1oyiA  [a.4.5.19] DOUBLE-STRANDED RNA-BINDING PROTEIN
    3e-06  16%  2oa4A1 [a.4.12.3] SIR5 A:1 -- 93
    4e-06  20%  2h6bA1 [a.4.5.4] CHLOROPHENOL REDUCTION GENE K A:148 -- 229
    5e-06  13%  2ch5A2 [c.55.1.5] NAGK PROTEIN A:1 -- 117
    7e-06  21%  1biaA1 [a.4.5.1] BIRA BIFUNCTIONAL PROTEIN A:1 -- 63
    8e-06  19%  1ulyA  [a.4.5.58] HYPOTHETICAL PROTEIN PH1932
    8e-06  17%  1ub9A  [a.4.5.28] HYPOTHETICAL PROTEIN PH1061
    1e-05  13%  1fp2A1 [a.4.5.29] ISOFLAVONE O-METHYTRANSFERASE A:8 -- 108
    1e-05  27%  2fbhA1 [a.4.5.28] TRANSCRIPTIONAL REGULATOR PA3341 A:8 -- 144
    1e-05  20%  2fbiA1 [a.4.5.28] PROBABLE TRANSCRIPTIONAL REGULATOR A:5 -- 140
    1e-05  19%  3bz6A2 [a.4.5.75] UPF0502 PROTEIN PSPTO_2686 A:97 -- 180
    1e-05  24%  1mkmA1 [a.4.5.33] ICLR TRANSCRIPTIONAL REGULATOR A:1 -- 75
    1e-05  24%  1lvaA3 [a.4.5.35] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR A:511
    1e-05  18%  1u2wA1 [a.4.5.5] CADMIUM EFFLUX SYSTEM ACCESSORY PROTEIN A:12 --
    1e-05  24%  1s3jA  [a.4.5.28] YUSO PROTEIN
    2e-05  14%  1on1A1 [a.4.5.24] TRANSCRIPTIONAL REGULATOR MNTR A:2 -- 62
    2e-05  16%  2p8tA1 [a.4.5.72] HYPOTHETICAL PROTEIN PH0730 A:14 -- 82
    2e-05  24%  1jgsA  [a.4.5.28] MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN MARR
    2e-05  18%  1p4xA1 [a.4.5.28] STAPHYLOCOCCAL ACCESSORY REGULATOR A HOMOLOGUE
    3e-05  11%  1xcbA1 [a.4.5.38] REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX A:4
    3e-05   6%  1q18A1 [c.55.1.7] GLUCOKINASE A:2 -- 111
    3e-05  29%  1t6sA2 [a.4.5.60] CONSERVED HYPOTHETICAL PROTEIN A:86 -- 162
    3e-05  15%  1zybA1 [a.4.5.4] TRANSCRIPTION REGULATOR, CRP FAMILY A:148 -- 220
    4e-05  25%  1q1hA  [a.4.5.41] TRANSCRIPTION FACTOR E
    4e-05  18%  1lvaA4 [a.4.5.35] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR A:575
    4e-05  18%  2obpA1 [a.4.5.71] PUTATIVE DNA-BINDING PROTEIN A:12 -- 92
    5e-05  15%  1nmnA  [c.55.3.8] HYPOTHETICAL PROTEIN YQGF
    6e-05  12%  1sfuA  [a.4.5.19] 34L PROTEIN
    7e-05  27%  1i1gA1 [a.4.5.32] TRANSCRIPTIONAL REGULATOR LRPA A:2 -- 61
    7e-05  20%  2cohA1 [a.4.5.4] TRANSCRIPTIONAL REGULATOR A:118 -- 199
    9e-05  17%  2eshA1 [a.4.5.61] CONSERVED HYPOTHETICAL PROTEIN TM0937 A:4 --
    9e-05  20%  2fxaA1 [a.4.5.28] PROTEASE PRODUCTION REGULATORY PROTEIN HPR A:6
    1e-04  18%  1cgpA1 [a.4.5.4] PROTEIN (CATABOLITE GENE ACTIVATOR PROTEIN (CAP)
    1e-04  13%  2bv6A1 [a.4.5.28] HTH-TYPE TRANSCRIPTIONAL REGULATOR MGRA A:5 --
    1e-04  19%  1ft9A1 [a.4.5.4] CARBON MONOXIDE OXIDATION SYSTEM TRANSCRIPTION
    1e-04  17%  1h3dA2 [d.58.5.3] ATP-PHOSPHORIBOSYLTRANSFERASE A:225 -- 299
    2e-04   9%  1p6rA  [a.4.5.39] PENICILLINASE REPRESSOR
    3e-04  19%  1h54A1 [a.102.1.4] MALTOSE PHOSPHORYLASE A:269 -- 753
    3e-04  14%  2hs5A1 [a.4.5.6] PUTATIVE TRANSCRIPTIONAL REGULATOR GNTR A:25 --
    3e-04  18%  1v4rA1 [a.4.5.6] TRANSCRIPTIONAL REPRESSOR A:1 -- 100
    4e-04  22%  2gauA1 [a.4.5.4] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY A:152
    4e-04  13%  2fnaA1 [a.4.5.11] CONSERVED HYPOTHETICAL PROTEIN A:284 -- 356
    5e-04  13%  1fnnA1 [a.4.5.11] CELL DIVISION CONTROL PROTEIN 6 A:277 -- 388
    5e-04  21%  1xmkA1 [a.4.5.19] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE
    6e-04  13%  1mzbA  [a.4.5.42] FERRIC UPTAKE REGULATION PROTEIN
    6e-04  20%  1lj9A  [a.4.5.28] TRANSCRIPTIONAL REGULATOR SLYA
    6e-04  14%  1aoyA  [a.4.5.3] ARGININE REPRESSOR
    8e-04   9%  1p4xA2 [a.4.5.28] STAPHYLOCOCCAL ACCESSORY REGULATOR A HOMOLOGUE
    8e-04  25%  2pg4A1 [a.4.5.48] UNCHARACTERIZED PROTEIN A:1 -- 92
:381

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MHKKLNPKSMKRENKKMVLRYLIESGPHSRVEIARKTGLAQSAIWRIIEELVNEGLVEEKGTATGRRRKA
2hoeA2          ----------------------------------------------------------------------
1z05A2          ----------------------------------------------------------------------
2ap1A1          ----------------------------------------------------------------------
1sz2A1          ----------------------------------------------------------------------
1sazA2          ----------------------------------------------------------------------
2gupA2          ----------------------------------------------------------------------
1g99A2          ----------------------------------------------------------------------
1xc3A2          ----------------------------------------------------------------------
2aa4A2          ----------------------------------------------------------------------
2gupA1          ----------------------------------------------------------------------
1woqA1          ----------------------------------------------------------------------
1q18A2          ----------------------------------------------------------------------
2ewsA1          ----------------------------------------------------------------------
1woqA2          ----------------------------------------------------------------------
1z05A1          ---------IKQINAGRVYKLIDQKGPISRIDLSKESELAPASITKITRELIDAHLIHETTVQEAISR--
2htjA1          --------------KNEILEFLNRHNGGKTAEIAEALAVTDYQARYYLLLLEKAGMVQRSPLRRGMATYW
1z05A3          ----------------------------------------------------------------------
2jn6A1          -------KTYSEEFKRDAVALYENSDGASLQQIANDLGINRVTLKNWIIKYGSNHNVQGT-----TPSAA
2aa4A1          ----------------------------------------------------------------------
1z6rA1          ---------IKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVHEXLEAHLVQELG---------
2ap1A2          ----------------------------------------------------------------------
2hoeA3          ----------------------------------------------------------------------
1wi9A           -----------------FINYIKKSKVVLLEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKF---
1qbjA           -----------EQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQEAGTPPLWK---
1xc3A1          ----------------------------------------------------------------------
1sfxA           -----------------IYSLLLERGGXRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYI
2hoeA1          -----------------ILKRIXK-SPVSRVELAEELGLTKTTVGEIAKIFLEKGIVVEE---KDSPRPT
2ethA1          -----------------AFLYVALFGPKKXKEIAEFLSTTKSNVTNVVDSLEKRGLVVREXDPVDRRTYR
2b0lA1          MSKAVVQMAISSAIEHIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIE------------
2a61A1          ------------PAQFDILQKIYFEGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYF
1xd7A           ----------------HILSLISMDEKTSSEIIADSVNTNPVVVRRMISLLKKADILTSRAGVPGASLK-
1lnwA           -----------------VLKLIDEQRGLNLQDLGRQXCRDKALITRKIRELEGRNLVRRERNPSDQRSFQ
1oyiA           -----------RSNAEIVCEAIKTIGGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSDDIPPRWF---
2oa4A1          --LPPANTRRWVASRKIAVVRGVIYGLITLAEAKQTYGLSDEEFNSWVSALAEHGKDALKVTALKKYRQ-
2h6bA1          -------YELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILD------------
2ch5A2          ----------------------------------------------------------------------
1biaA1          ---------MKDTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYS---
1ulyA           ------------DTRRKILKLLRN-KEXTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEXKGNLVE
1ub9A           -------HILGNPVRLGIMIFLLPRRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTV
1fp2A1          ------SMSLKWAVEMNIPNIIQNHGKPISLNLVSILQVPSSKVRRLMRYLAHNGFFEIITKEEESYA--
2fbhA1          -----------------VLLHLARHDSPTQRELAQSVGVEGPTLARLLDGLESQGLVRRLAVAEDRRAKH
2fbiA1          -----------------VIRILRQQGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPKDQRRVY
3bz6A2          -----------------LTGLLLLRGPQTVSELLTRSNEDSEQVVHQLERLIARGLATLVPRQSGQREDR
1mkmA1          -----------------ILDFIVKNGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLR--KKDKRYV--
1lvaA3          -------SETQKKLLKDLEDKYRVSRPPSFKEVAGSFNLDPSELEELLHYLVREGVLV------------
1u2wA1          -------KAIADENRAKITYALCQDEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRLGDEHIR---
1s3jA           -----------------VLASLKKHGSLKVSEIAERXEVKPSAVTLXADRLEQKNLIARTHNTKDRRVID
1on1A1          ---------------EQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYL-------------
2p8tA1          ----------EYTVEDVLAVIFLLKEPLGRKQISERLELGEGSVRTLLRKLSHLDIIRSKGTLKGKE---
1jgsA           -----------------VLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVL
1p4xA1          -----------------LLTYLFHQQTLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTY
1xcbA1          ------PEAAISITYLRILEELEAQGRTSSEQLGELAQVTAFQVRKDLSYFGSYGTR-GVGYTVPVLKRE
1q18A1          ----------------------------------------------------------------------
1t6sA2          -----------------VLAVVAWHQPVTKGEIQQIRG---ASPDYSIDRLLARGLIEVRGRADSPGRP-
1zybA1          -----------------EKPQGEKTFKVKXDDLARCLDDTRLNISKTLNELQDNGLIEHRKEILIPDAQK
1q1hA           -----------------VLRILLDKGEMTDEEIANQLNIKVNDVRKKLNLLEEQGFVSYRKTRSGWFI--
1lvaA4          ------------GEAREVIKNLASTGPFGLAEARDALGSSRKYVLPLLEYLDQVKFTRRVG---------
2obpA1          ----IDPAIVEVLLVLREAGIENGATPWSLPKIAKRAQLPXSVLRRVLTQLQAAGLA--DVSVEADGRGH
1nmnA           ----------------------------------------------------------------------
1sfuA           ---------------KKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKM------VPSNP
1i1gA1          -----------------ILEILEKDARTPFTEIAKKLGISETAVRKRVKALEEKGIIE------------
2cohA1          ------------------EEEGKVVLKATHDELAAAVGSVRETVTKVIGELAREGYIR------------
2eshA1          ----------------TILLLVAEKPSHAEFGIEIPGIGHMGNIYRVLADLEESGFLSTEWDTTVSPPR-
2fxaA1          -----------------ILWIAYQLNGASISEIAKFGVXHVSTAFNFSKKLEERGYL-------------
1cgpA1          -------LNLAKQPDAMTHPDG-MQIKITRQEIGQIVGCSRETVGRILKMLEDQNLIS------------
2bv6A1          -----------------VLTILWDESPVNVKKVVTELALDTGTVSPLLKRXEQVDLIKRERSEVDQREVF
1ft9A1          ---------------TGRQTGVIVSVDFTVEEIANLIGSSRQTTSTALNSLIKEGYISRQ-----GRGHY
1h3dA2          ----------PTERLDEVIALLPGAERPTILPLAMHMVSSETLFWETMEKLKALGASS------------
1p6rA           -----------------VMKVIWKHSSIVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEGRVFVYTP
1h54A1          ------------------------NQNWSWDKILRSPYIKQ-GDVLQGIWDFIDDYTPEQKKANFDFYEP
2hs5A1          -------TRVAGILRDAIIDGTFRPGRLSEPDICAALDVSRNTVREAFQILIEDRLVAHE-----LNRGV
1v4rA1          -----------THFRTLIKSGELAPGLPSVADIRAQFGVAAKTVSRALAVLKSEGLVS------SRGALG
2gauA1          ------------------NDGATLSIYLSREELATLSNMTVSNAIRTLSTFVSERMLA------------
2fnaA1          -------------------KCGKWSDVKRALELEEGIEISDSEIYNYLTQLTKHSWII------------
1fnnA1          -------SLKISHTPYITFGDAEE-SYKIVCEEYGERPRVHSQLWSYLNDLREKGIVETR-----QNTTL
1xmkA1          ------------EIKEKICDYLFNVSDSSALNLAKNIGLTARDINAVLIDMERQGDVYR------QGTTP
1mzbA           ------------LPRVKILQMLDSAQRHMSAEMEAGEDVGLATVYRVLTQFEAAGLVVRHNFDGGHAVFE
1lj9A           -----------------YLVRVCENPGIIQEKIAELIKVDRTTAARAIKRLEEQGFIY------------
1aoyA           -------SSAKQEELVKAFKALLKEEKFAALQEQGFDNINQSKVSRMLTKFGAVRTRN------------
1p4xA2          -----------------ILAIITSQNIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTEDERKIL
2pg4A1          --------------------------EPSLAEIVKASGVSEKTFFXLKDRLIRAGLVKEE--TLSYRVKT


                         .         .         *         .         .         .         .:140
query           VTYGPTRSFITSIIYNVEVLETLVAVGFLDGAWRIIERFSTPKDFDEFKQRVTSSYENILKSHVLNKNIS
2hoeA2          ----------------------------------------------------------------------
1z05A2          ----------------------------------------------------------------------
2ap1A1          ----------------------------------------------------------------------
1sz2A1          ---------------------ARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKV------EVK
1sazA2          ----------------------------------------------------------------------
2gupA2          ----------------------------------------------------------------------
1g99A2          ----------------------------------------------------------------------
1xc3A2          ----------------------------------------------------------------------
2aa4A2          ----------------------------------------------------------------------
2gupA1          -------------IATIDIGGTGIKFASLTPDGKILDKISTPENLEDLLAW--------LDQRLSEQDYS
1woqA1          --------------------------------------------------------------------GS
1q18A2          ----------------------------------------------------------------------
2ewsA1          ----------------------------------------------------------------------
1woqA2          ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------
2htjA1          FLKGEK----------------------------------------------------------------
1z05A3          ------------QFLSMRLGRGYLTIALHELGGEVLIDTKHEIDQDDVLARLLFEIEEFFTYAAQLDRVT
2jn6A1          VSEAEQIRQLKKENALQRARTRHPA---------------------------------------------
2aa4A1          ---------------------TKLAAALIGADGQIRDRRELPTPASQTPEALRDALSALVSPLQ--AHAQ
1z6rA1          ----------------------------------------------------------------------
2ap1A2          -------------YYGFDIGGTKIALGVFDSTRRLQWEKRVPTPHTSYSAFLDAVCELVEEADQRFGVKG
2hoeA3          ---------------------DEIAACLIDASXNILAHEAHPLDREETLNVXYRIIDRAKDXEKLGSKLS
1wi9A           ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1xc3A1          ------------MLGGIEAGGTKFVCAVGREDGTIIDRIEFPTKMPDETIEKVIQYFSQFSLQAIG--IG
1sfxA           YS--------------------------------------------------------------------
2hoeA1          KSLKIS----------------------------------------------------------------
2ethA1          VV--------------------------------------------------------------------
2b0lA1          ----------------------------------------------------------------------
2a61A1          LV--------------------------------------------------------------------
1xd7A           ----------------------------------------------------------------------
1lnwA           LF--------------------------------------------------------------------
1oyiA           ----------------------------------------------------------------------
2oa4A1          ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
2ch5A2          ---------------------TRSEVLLVSEDGKILAEADGL-----STNHWLIGTDKCVEREMVNRAKR
1biaA1          ----------------------------------------------------------------------
1ulyA           KYYGRTADVFYINLYLGDEELRYIARSRLKTKIDIFKRLGYQFEENELLNIXDRXSQKEFDATVISKYIE
1ub9A           VE--------------------------------------------------------------------
1fp2A1          ----------------------------------------------------------------------
2fbhA1          IV--------------------------------------------------------------------
2fbiA1          VN--------------------------------------------------------------------
3bz6A2          Y---------------------------------------------------------------------
1mkmA1          ----------------------------------------------------------------------
1lvaA3          ----------------------------------------------------------------------
1u2wA1          ----------------------------------------------------------------------
1s3jA           LS--------------------------------------------------------------------
1on1A1          ----------------------------------------------------------------------
2p8tA1          ----------------------------------------------------------------------
1jgsA           VK--------------------------------------------------------------------
1p4xA1          IS--------------------------------------------------------------------
1xcbA1          LRH-------------------------------------------------------------------
1q18A1          ---------------------ARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVE------VK
1t6sA2          ----------------------------------------------------------------------
1zybA1          ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
2obpA1          AS--------------------------------------------------------------------
1nmnA           ---------------------KSIGVAVGQRITGTARPLPAIQDGTPDWNII----ERLLKEW----QPD
1sfuA           PKW-------------------------------------------------------------------
1i1gA1          ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
2eshA1          ----------------------------------------------------------------------
2fxaA1          ----------------------------------------------------------------------
1cgpA1          ----------------------------------------------------------------------
2bv6A1          IH--------------------------------------------------------------------
1ft9A1          TIPNLVR---------------------------------------------------------------
1h3dA2          ----------------------------------------------------------------------
1p6rA           NI--------------------------------------------------------------------
1h54A1          LTVHE------SSLSPAIHSVLAADLHYEDKAVELYSRT-ARLDLDNYNNDTTDGLHGAWIA--------
2hs5A1          FVRVPT----------------------------------------------------------------
1v4rA1          TVVEKNPIVITGADRLKRMEKNGMR---------------------------------------------
2gauA1          ----------------------------------------------------------------------
2fnaA1          ----------------------------------------------------------------------
1fnnA1          ISIGTEPLDTLEAV--------------------------------------------------------
1xmkA1          PIWHLT----------------------------------------------------------------
1mzbA           LADSGHHDHM------------------------------------------------------------
1lj9A           ----------------------------------------------------------------------
1aoyA           ----------------------------------------------------------------------
1p4xA2          IH--------------------------------------------------------------------
2pg4A1          LK--------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KVVFSLPGIVNTESKFLIHAPNLGWRNIDFRREFGNLDLEVLVENDSNLSLLAEEFFSQDVKESDVAFFL
2hoeA2          --------------------------------------------------------------------WI
1z05A2          --------------------------------------------------------------DVDNSVLI
2ap1A1          ---------------------------------------------------------------------L
1sz2A1          DGCIAIACPITGDWVAXTNHTWAFSIAEXKKNLGF---SHLEIINDFTAVSXAIPXLKKEAEPVEGKPIA
1sazA2          --------------------------------------------------------------------VA
2gupA2          ------------------------------------------------------------------AACV
1g99A2          -------------------------------------------------------------AEETKIITC
1xc3A2          --------------------------------------------------------------------YI
2aa4A2          --------------------------------------------------------------------FI
2gupA1          GIAXSVPGAVNQETGVIDGFSAVPYIGFSWYEALSSYQLPVHLENDANCVGLSELLA-------------
1woqA1          PVGVTFPGIIQHGVVHSAANVDKSWLNTDIDALLTALGRPVEVINDADAAGLAEARY-------------
1q18A2          ----------------------------------------------------------------------
2ewsA1          -----IDQVVEWLNQQQIEKLCLTGNAGVIAENIN-IPAQIFVEFDAASQGLGILLKEQG-HDLADYIFA
1woqA2          ------------------------------------------------------------VKGT--VLVI
1z05A1          ----------------------------------------------------------------------
2htjA1          ----------------------------------------------------------------------
1z05A3          SIAITLPGLVNSEQGIVLQMPHYNVKNLALGPEIYKTGLPVFVANDTRAWALAEKLFG------------
2jn6A1          ----------------------------------------------------------------------
2aa4A1          RVAIASTGIIRDGSLLALNPHNLGLLHFPLVKTLEQTNLPTIAINDAQAAAWAE----------------
1z6rA1          ----------------------------------------------------------------------
2ap1A2          SVGIGIPGMPETEDGTLYAANVPAASGKPLRADLARLDRDVRLDNDANCFALSEAW--------------
2hoeA3          ALTVAAPGPIDTERGIIIDPRNFPLSQIPLANLLKEYGIEVWVENDADXGAVGEKWY-------------
1wi9A           ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1xc3A1          SFGPVDNDKTSQTYGTITATPKAGWRHYPFLQTVNEMKIPVGFSTDVNAAALGEFLF-------------
1sfxA           ----------------------------------------------------------------------
2hoeA1          ----------------------------------------------------------------------
2ethA1          ----------------------------------------------------------------------
2b0lA1          ----------------------------------------------------------------------
2a61A1          ----------------------------------------------------------------------
1xd7A           ----------------------------------------------------------------------
1lnwA           ----------------------------------------------------------------------
1oyiA           ----------------------------------------------------------------------
2oa4A1          ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
2ch5A2          KAGVDPLVPLRSLGLSLSGDQEDGRILIEELRDRPYLSESYLITTDAAGSIATA----------------
1biaA1          ----------------------------------------------------------------------
1ulyA           EKE---DALKDFSNEDIIHA--------------------------------------------------
1ub9A           ----------------------------------------------------------------------
1fp2A1          ----------------------------------------------------------------------
2fbhA1          ----------------------------------------------------------------------
2fbiA1          ----------------------------------------------------------------------
3bz6A2          ----------------------------------------------------------------------
1mkmA1          ----------------------------------------------------------------------
1lvaA3          ----------------------------------------------------------------------
1u2wA1          ----------------------------------------------------------------------
1s3jA           ----------------------------------------------------------------------
1on1A1          ----------------------------------------------------------------------
2p8tA1          ----------------------------------------------------------------------
1jgsA           ----------------------------------------------------------------------
1p4xA1          ----------------------------------------------------------------------
1xcbA1          ----------------------------------------------------------------------
1q18A1          DGCIAIACPITGDWVAXTNHTWAFSIAEXKKNLGF---SHLEIINDFTAVSXAI----------------
1t6sA2          ----------------------------------------------------------------------
1zybA1          ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
2obpA1          ----------------------------------------------------------------------
1nmnA           EIIVGLPLNMDGTEQPL------TARARKFANRIGRFGVEVKLHDERLSTVGKV----------------
1sfuA           ----------------------------------------------------------------------
1i1gA1          ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
2eshA1          ----------------------------------------------------------------------
2fxaA1          ----------------------------------------------------------------------
1cgpA1          ----------------------------------------------------------------------
2bv6A1          ----------------------------------------------------------------------
1ft9A1          ----------------------------------------------------------------------
1h3dA2          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------
1h54A1          -VVQGFAGMRVRDGQLHY-APFLTWTSYTFRQVFRDRLIEVSVHADG-----------------------
2hs5A1          ----------------------------------------------------------------------
1v4rA1          ----------------------------------------------------------------------
2gauA1          ----------------------------------------------------------------------
2fnaA1          ----------------------------------------------------------------------
1fnnA1          ----------------------------------------------------------------------
1xmkA1          ----------------------------------------------------------------------
1mzbA           ----------------------------------------------------------------------
1lj9A           ----------------------------------------------------------------------
1aoyA           ----------------------------------------------------------------------
1p4xA2          ----------------------------------------------------------------------
2pg4A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YFGEGIGGAISVNGKIVRGENFAAGEIGHVVLDVKNGKEVEEFLSISKLVERMEKFVELQGESLDEKFRY
2hoeA2          LTGKGIGAGIIIDGELYRGENGYAGEIGYTR--VFNGNEYV-FLEDVCNENVVLKHVLSXGFSLAEARD-
1z05A2          SIHHGLGAGIVLDGRVLQGRHGNIGELGHIQIDPQGKRCLETVASSQAIRDQVTARIQAGEPSCLATIED
2ap1A1          ILGTGVGGGLVLNGKPITGQSYITGEFGHMRLPVDALTLIENYLSGRGFAWLYQ---HYYDQSLQ--APE
1sz2A1          VYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAERVLSGPGLVNLYRAIVKADNRLPENLKDI
1sazA2          HXGGGISIAAHRKGRVIDVNNALDGDGPFTPERSGTLPQLVDLCFSGKFTYEIVGNGGLVAYLGTSDARE
2gupA2          VIGTGIGGAXIINGRLHRGRHGLGGEFGYXTTLAPAEKNWSQLASTGNXVRYVIEKSGHTDWDGRK----
1g99A2          HLGNGSSITAVEGGKSVETSMGFTPLEGLAMGTRCGSIDPKEGLTTREIDTLMNKKSGVLGVSGLSDFRD
1xc3A2          TIGTGIGAGAIVEGRLLQGLS--HPEMGHIYIR--RHPDDVYQGKCPYHGDCFEGLASGPA------IEA
2aa4A2          TVSTGVGGGVVSGCKLLTGPGGLAGHIGHTLAD-PHGP--VCGCGRTGCVEAIASAAAAQGELAGADAKT
2gupA1          ----------------------------------------------------------------------
1woqA1          ----------------------------------------------------------------------
1q18A2          --GTGLGVAHLVHVD--KRWVSLPGEGGHVDFAPNSEEEAERVLSGPGLVNLYRAIVKADNRLPENLKPK
2ewsA1          NVGTGTSLHYFDGQSQRRVGGIGTGGQGLGYLLSQITDYKQLTDMAQHGDRNTIDLKVRHIIPGDLTAAN
1woqA2          TLGTGIGSAFIFDGKLVPN-----AELGHLEI---DGHDAETKASAVAR---------------------
1z05A1          ----------------------------------------------------------------------
2htjA1          ----------------------------------------------------------------------
1z05A3          ----------------------------------------------------------------------
2jn6A1          ----------------------------------------------------------------------
2aa4A1          ----------------------------------------------------------------------
1z6rA1          ----------------------------------------------------------------------
2ap1A2          ----------------------------------------------------------------------
2hoeA3          ----------------------------------------------------------------------
1wi9A           ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1xc3A1          ----------------------------------------------------------------------
1sfxA           ----------------------------------------------------------------------
2hoeA1          ----------------------------------------------------------------------
2ethA1          ----------------------------------------------------------------------
2b0lA1          ----------------------------------------------------------------------
2a61A1          ----------------------------------------------------------------------
1xd7A           ----------------------------------------------------------------------
1lnwA           ----------------------------------------------------------------------
1oyiA           ----------------------------------------------------------------------
2oa4A1          ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
2ch5A2          ----------------------------------------------------------------------
1biaA1          ----------------------------------------------------------------------
1ulyA           ----------------------------------------------------------------------
1ub9A           ----------------------------------------------------------------------
1fp2A1          ----------------------------------------------------------------------
2fbhA1          ----------------------------------------------------------------------
2fbiA1          ----------------------------------------------------------------------
3bz6A2          ----------------------------------------------------------------------
1mkmA1          ----------------------------------------------------------------------
1lvaA3          ----------------------------------------------------------------------
1u2wA1          ----------------------------------------------------------------------
1s3jA           ----------------------------------------------------------------------
1on1A1          ----------------------------------------------------------------------
2p8tA1          ----------------------------------------------------------------------
1jgsA           ----------------------------------------------------------------------
1p4xA1          ----------------------------------------------------------------------
1xcbA1          ----------------------------------------------------------------------
1q18A1          ----------------------------------------------------------------------
1t6sA2          ----------------------------------------------------------------------
1zybA1          ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
2obpA1          ----------------------------------------------------------------------
1nmnA           ----------------------------------------------------------------------
1sfuA           ----------------------------------------------------------------------
1i1gA1          ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
2eshA1          ----------------------------------------------------------------------
2fxaA1          ----------------------------------------------------------------------
1cgpA1          ----------------------------------------------------------------------
2bv6A1          ----------------------------------------------------------------------
1ft9A1          ----------------------------------------------------------------------
1h3dA2          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------
1h54A1          ----------------------------------------------------------------------
2hs5A1          ----------------------------------------------------------------------
1v4rA1          ----------------------------------------------------------------------
2gauA1          ----------------------------------------------------------------------
2fnaA1          ----------------------------------------------------------------------
1fnnA1          ----------------------------------------------------------------------
1xmkA1          ----------------------------------------------------------------------
1mzbA           ----------------------------------------------------------------------
1lj9A           ----------------------------------------------------------------------
1aoyA           ----------------------------------------------------------------------
1p4xA2          ----------------------------------------------------------------------
2pg4A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IKRLWFSGEKNVKETMEEFLQHVAVVLKNIIYFLNPGVIVLGGVVNDLWDTFGSFIKRELEKITDREIAN
2hoeA2          ------SGDVRVKEYFDDIARYFSIGLLNLIHLFGISKIVIGGFFKELGENFLKKIKIEVET-------H
1z05A2          ICAAAADGDPLAVDVIQQLGRYLGAAIAIVINLFNPEKILIGGVINQAKSILYPSIEQCIREQSLPVHQD
2ap1A1          IIALWEQGDEQAHAHVERYLDLLAVCLGNILTIVDPDLLVIGGGLS-NFTAITTQLAERLPRHLLPVARA
1sz2A1          TERALADSCTDCRRALSLFCVIXGRFGGNLALLGTFGGVFIAGGIVPRFLEFFKASGFRAAKGRFKEYVH
1sazA2          VVRRIKQGDEWAKRVYRAXAYQIAKWIGKXAAVLKGDFIVLTGGLAHEKEFLVPWITKRVSFIAPVLV--
2gupA2          IYQEAAAGNILCQEAIERXNRNLAQGLLNIQYLIDPGVISLGGSIS----QNPDFIQGVKKAV--EDFVD
1g99A2          LDEAASKGNRKAELALEIFAYKVKKFIGEYSAVLNADAVVFTAGIGENSASIRKRILTGLDGIGIK----
1xc3A2          RWGKKAADLSDIAQVWELEGYYIAQALAQYILILAPKKIILGGGVMQQKQVFSY-IYQYVPKIMNSYLDF
2aa4A2          IFTRAGQGDEQAQQLIHRSARTLARLIADIKATTDCQCVVVGGSVG-LAEGYLALVETYLAQEPAAF---
2gupA1          ----------------------------------------------------------------------
1woqA1          ----------------------------------------------------------------------
1q18A2          TERALADSCTDCRRALSLFCVIXGRFGGNLALLGTFGGVFIGGIVPRFLEFFSGFRAAFEDKGRFKE---
2ewsA1          FGHVLHTPSNKLAAVIGVVGEVVTTMAITVAREFKTENIVYIGSSFHNNALLRKVVEDYTVL--------
1woqA2          --------ERDGLS-WDEYSVLLQRYFSHVEFLFSPELFIVGGGISKRADEYLPNLRLRTP---------
1z05A1          ----------------------------------------------------------------------
2htjA1          ----------------------------------------------------------------------
1z05A3          ----------------------------------------------------------------------
2jn6A1          ----------------------------------------------------------------------
2aa4A1          ----------------------------------------------------------------------
1z6rA1          ----------------------------------------------------------------------
2ap1A2          ----------------------------------------------------------------------
2hoeA3          ----------------------------------------------------------------------
1wi9A           ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1xc3A1          ----------------------------------------------------------------------
1sfxA           ----------------------------------------------------------------------
2hoeA1          ----------------------------------------------------------------------
2ethA1          ----------------------------------------------------------------------
2b0lA1          ----------------------------------------------------------------------
2a61A1          ----------------------------------------------------------------------
1xd7A           ----------------------------------------------------------------------
1lnwA           ----------------------------------------------------------------------
1oyiA           ----------------------------------------------------------------------
2oa4A1          ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
2ch5A2          ----------------------------------------------------------------------
1biaA1          ----------------------------------------------------------------------
1ulyA           ----------------------------------------------------------------------
1ub9A           ----------------------------------------------------------------------
1fp2A1          ----------------------------------------------------------------------
2fbhA1          ----------------------------------------------------------------------
2fbiA1          ----------------------------------------------------------------------
3bz6A2          ----------------------------------------------------------------------
1mkmA1          ----------------------------------------------------------------------
1lvaA3          ----------------------------------------------------------------------
1u2wA1          ----------------------------------------------------------------------
1s3jA           ----------------------------------------------------------------------
1on1A1          ----------------------------------------------------------------------
2p8tA1          ----------------------------------------------------------------------
1jgsA           ----------------------------------------------------------------------
1p4xA1          ----------------------------------------------------------------------
1xcbA1          ----------------------------------------------------------------------
1q18A1          ----------------------------------------------------------------------
1t6sA2          ----------------------------------------------------------------------
1zybA1          ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1lvaA4          ----------------------------------------------------------------------
2obpA1          ----------------------------------------------------------------------
1nmnA           ----------------------------------------------------------------------
1sfuA           ----------------------------------------------------------------------
1i1gA1          ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
2eshA1          ----------------------------------------------------------------------
2fxaA1          ----------------------------------------------------------------------
1cgpA1          ----------------------------------------------------------------------
2bv6A1          ----------------------------------------------------------------------
1ft9A1          ----------------------------------------------------------------------
1h3dA2          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------
1h54A1          ----------------------------------------------------------------------
2hs5A1          ----------------------------------------------------------------------
1v4rA1          ----------------------------------------------------------------------
2gauA1          ----------------------------------------------------------------------
2fnaA1          ----------------------------------------------------------------------
1fnnA1          ----------------------------------------------------------------------
1xmkA1          ----------------------------------------------------------------------
1mzbA           ----------------------------------------------------------------------
1lj9A           ----------------------------------------------------------------------
1aoyA           ----------------------------------------------------------------------
1p4xA2          ----------------------------------------------------------------------
2pg4A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VLIRDTIFKEISPSLVGGNVLAIEEFLRQIT
2hoeA2          LLYKHSVFSKVQEPAFGAAVHALENYLERVT
1z05A2          LKLVESRFYK-QATMPGAALIKQALYDGLL-
2ap1A1          PRIERARHGD-AGGMRGAAFLHLTD------
1sz2A1          DIPVYLIVHD-NPGLLGSGAHLRQTLGHIL-
1sazA2          FPGSN----EEKALALSALRVLRGEEKPK--
2gupA2          AYEEYTVAPVIQACLYGALVNWLQEE-----
1g99A2          -------------------------------
1xc3A2          SELSDDISDYIVPPIIGTLVLAHQALQAE--
2aa4A2          -------------------------------
2gupA1          -------------------------------
1woqA1          -------------------------------
1q18A2          -YVHDIPVYLINPGLLGSGAHLRQT------
2ewsA1          -------------------------------
1woqA2          -------------------------------
1z05A1          -------------------------------
2htjA1          -------------------------------
1z05A3          -------------------------------
2jn6A1          -------------------------------
2aa4A1          -------------------------------
1z6rA1          -------------------------------
2ap1A2          -------------------------------
2hoeA3          -------------------------------
1wi9A           -------------------------------
1qbjA           -------------------------------
1xc3A1          -------------------------------
1sfxA           -------------------------------
2hoeA1          -------------------------------
2ethA1          -------------------------------
2b0lA1          -------------------------------
2a61A1          -------------------------------
1xd7A           -------------------------------
1lnwA           -------------------------------
1oyiA           -------------------------------
2oa4A1          -------------------------------
2h6bA1          -------------------------------
2ch5A2          -------------------------------
1biaA1          -------------------------------
1ulyA           -------------------------------
1ub9A           -------------------------------
1fp2A1          -------------------------------
2fbhA1          -------------------------------
2fbiA1          -------------------------------
3bz6A2          -------------------------------
1mkmA1          -------------------------------
1lvaA3          -------------------------------
1u2wA1          -------------------------------
1s3jA           -------------------------------
1on1A1          -------------------------------
2p8tA1          -------------------------------
1jgsA           -------------------------------
1p4xA1          -------------------------------
1xcbA1          -------------------------------
1q18A1          -------------------------------
1t6sA2          -------------------------------
1zybA1          -------------------------------
1q1hA           -------------------------------
1lvaA4          -------------------------------
2obpA1          -------------------------------
1nmnA           -------------------------------
1sfuA           -------------------------------
1i1gA1          -------------------------------
2cohA1          -------------------------------
2eshA1          -------------------------------
2fxaA1          -------------------------------
1cgpA1          -------------------------------
2bv6A1          -------------------------------
1ft9A1          -------------------------------
1h3dA2          -------------------------------
1p6rA           -------------------------------
1h54A1          -------------------------------
2hs5A1          -------------------------------
1v4rA1          -------------------------------
2gauA1          -------------------------------
2fnaA1          -------------------------------
1fnnA1          -------------------------------
1xmkA1          -------------------------------
1mzbA           -------------------------------
1lj9A           -------------------------------
1aoyA           -------------------------------
1p4xA2          -------------------------------
2pg4A1          -------------------------------