[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tmar0:AAD35255.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1c4xA.bssp"
#ERROR : Can't open dsspfile "1cvlA.bssp"
#ERROR : Can't open dsspfile "1pjaA.bssp"
#ERROR : Can't open dsspfile "2dstA1.bssp"
#ERROR : Can't open dsspfile "1i6wA.bssp"
#ERROR : Can't open dsspfile "1ac5A.bssp"
#ERROR : Can't open dsspfile "1agyA.bssp"
#ERROR : Can't open dsspfile "1dwoA.bssp"
#ERROR : Can't open dsspfile "1ju3A2.bssp"
#ERROR : Can't open dsspfile "1inpA.bssp"
#ERROR : Can't open dsspfile "2b20A2.bssp"
#ERROR : Can't open dsspfile "1hlgA.bssp"
#ERROR : Can't open dsspfile "2fukA1.bssp"
#ERROR : Can't open dsspfile "1lbsA.bssp"
#ERROR : Can't open dsspfile "1bcr.1.bssp"

## Summary of PDB Search
:771
    4e-09  20%  1c4xA  [c.69.1.10] PROTEIN (2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-
    8e-08  20%  1cvlA  [c.69.1.18] TRIACYLGLYCEROL HYDROLASE
    2e-07  10%  1pjaA  [c.69.1.13] PALMITOYL-PROTEIN THIOESTERASE 2 PRECURSOR
    2e-06  14%  2dstA1 [c.69.1.39] HYPOTHETICAL PROTEIN TTHA1544 A:2 -- 123
    3e-06  18%  1i6wA  [c.69.1.18] LIPASE A
    5e-06   6%  1ac5A  [c.69.1.5] KEX1(DELTA)P
    1e-05   6%  1agyA  [c.69.1.30] CUTINASE
    5e-05  14%  1dwoA  [c.69.1.20] HYDROXYNITRILE LYASE
    6e-05  10%  1ju3A2 [c.69.1.21] COCAINE ESTERASE A:5 -- 351
    1e-04  10%  1inpA  [e.7.1.1] INOSITOL POLYPHOSPHATE 1-PHOSPHATASE
    2e-04  17%  2b20A2 [c.69.1.2] ENTEROCHELIN ESTERASE A:151 -- 397
    2e-04  13%  1hlgA  [c.69.1.6] LIPASE, GASTRIC
    4e-04   9%  2fukA1 [c.69.1.36] XC6422 PROTEIN A:3 -- 220
    6e-04  13%  1lbsA  [c.69.1.17] LIPASE B
    7e-04  14%  1bcr.1 [c.69.1.5] SERINE CARBOXYPEPTIDASE II A:- -- - B:- -- -
:771

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1c4xA           ----------------------------------------------------------------------
1cvlA           ----------------------------------------------------------------------
1pjaA           ----------------------------------------------------------------------
2dstA1          ----------------------------------------------------------------------
1i6wA           ----------------------------------------------------------------------
1ac5A           ----------------------------------------------------------------------
1agyA           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1ju3A2          ----------------------------------------------------------------------
1inpA           ----------------------------------------------------------------------
2b20A2          ----------------------------------------------------------------------
1hlgA           ----------------------------------------------------------------------
2fukA1          ----------------------------------------------------------------------
1lbsA           ----------------------------------------------------------------------
1bcr.1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1c4xA           ----------------------------------------------------------------------
1cvlA           ----------------------------------------------------------------------
1pjaA           ----------------------------------------------------------------------
2dstA1          ----------------------------------------------------------------------
1i6wA           ----------------------------------------------------------------------
1ac5A           ----------------------------------------------------------------------
1agyA           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1ju3A2          ----------------------------------------------------------------------
1inpA           ----------------------------------------------------------------------
2b20A2          ----------------------------------------------------------------------
1hlgA           ----------------------------------------------------------------------
2fukA1          ----------------------------------------------------------------------
1lbsA           ----------------------------------------------------------------------
1bcr.1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxVEAFTYHLSVFGVVLRSAGFQKHGIRLLREAVNSSGPAVLLVPGEDPTFEGVVKDN
1c4xA           ----------------------------FPSGTLASH----ALVAGDPQSPAVVLLHGAGP---GAHAAS
1cvlA           ----------------------------------------------AATRYPVILVHG----LAGTDKFA
1pjaA           ------------------------------------------------SYKPVIVVHG----LFD---SS
2dstA1          ------------------------------------------------KGPPVLLVAEEASRWPEALPEG
1i6wA           --------------------------------------------------NPVVMVHG----IGG---AS
1ac5A           ----------------------------------------------------------------------
1agyA           ------------------------------------DDLIN-GNSASCRDVIFIYARG----STETGNLG
1dwoA           ----------------------------------------------KMVTAHFVLIHT----ICH---GA
1ju3A2          --------------------------VMVPMRDGVRLAVDLYRPDADGPVPVLLVRNPYDKFDVFAWSTQ
1inpA           ----------------------------------------------------------------------
2b20A2          --------------AKEIIWKSERLKNSRR--------VWIFTTGDVTERPLAVLLDGEFWA-----QSX
1hlgA           --------------------------------GYILEVNRIPGKKNSGQRPVVFLQHGLLASATNWISNL
2fukA1          --------------------------------------VDLPEPDVAVQPVTAIVCHP----LSTEGGSM
1lbsA           --------------------------------SVLDAGLTCQGASPSSVSKPILLVPG----TGT---TG
1bcr.1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NIWETIFPDRTIMTYEYALYEPRSLAYSEMYRSFIEKEGRRSFIDFESDFLSQEILKYSQYEFDILAHGT
1c4xA           N-WRPIIPD---LAENFFVVAPDLIGFGQSEYPETYPGHIMSWVGMRVEQILGLMNHFGIEKSHIVGNSM
1cvlA           NVVDYWYGIQ------SDLQSHGAKVYVANLSGFQSDDGPNGRGEQLLAYVKQVLAATGATKVNLIGHSQ
1pjaA           YSFRHLLEYINETHPGTVVTVLDLFDGRE-------SLRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQ
2dstA1          --YAFYLLDL------------PGYGRTEGPR-------MAPEELAHFVAGFAVMMNLGAPWVLLRGLGL
1i6wA           FNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTN--------YNNGPVLSRFVQKVLDETGAKKVDIVAHSM
1ac5A           --GDLLFIDQPTGTGFSVEQNKDEGKIDKNKFDEDLEDVTKHFMDFLENYFKIFP-EDLTRKIILSGESY
1agyA           TLGPSIASNLESAFGKVWIQGVGGAYRATLGDNALPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQ
1dwoA           WIWHKLKPALERAGHKVTALDMA------ASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGEC
1ju3A2          STNWLEFVRDG-----YAVVIQDTRGLFASEGEF--VPHVDDEADAEDTLSWILEQAWCDGNVGMFGVSY
1inpA           ----------------------------------------------------------------------
2b20A2          PVW-PVLTSLTHRQQLPPAVYVLIDAIDTTHRAH-ELPCNADFWLA----VQQELLPLVKVIAPVAGQSF
1hlgA           PNNSLAFILADAG-YDVWLGNSRGNTWARLYYSPDSVEFWAFSFDEMAKYDLPATIDFIVKKTGYVGHSQ
2fukA1          HNKVVTMAARALRELGITVVRFN---FRSVGTSAGSFDHGDGEQDDLRAVAEWVRAQRPTDTLWLAGFSF
1lbsA           PQSFDSNWIPLSTQLGYTPCWISPPPFMLNDTQV--------NTEYMVNAITALYAGSGNNKLPVLTWSQ
1bcr.1          ------------------------------------------------AKWFERFPHYKYRDFYIAGESY


                         .         *         .         .         .         .         +:350
query           GGLIVLRMLQRHPEVNNVRKVVLLSTPVQGTNVVNPLYFSSIFYGKDPEVLEDIFGIEWTKLKMLTLHIR
1c4xA           GGAVTLQLVVEAPER--FDKVALMGSVGAPMNARPPELARLLAFYADP----------------------
1cvlA           GGLTSRYVAAVAPQL--VASVTTIGTPHRGSEF--------------ADFVQDVLKTDPTGLSSTV--IA
1pjaA           GGLVCRALLSVMDD--HNVDSFISLSSP------------------------------------------
2dstA1          ALGPHLEALGLRAL--PAEGVEVAEVLSSKLS--------------------------------------
1i6wA           GGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPG--------------------------------
1ac5A           AGQYIPFFANAILNH--NKFSKIDGDTYDLKALL-IGNGWIDPNTQSLSYLPFAMEKKLIDESN------
1agyA           GAALAAASIEDLDSAIRIAGTVLFGYTKNLQ---------------------------------------
1dwoA           AGLNIAIAADRYVD--KIAAGVFHN-SLLPDTVHSPSYTVEKLLESFPDWRDTEY---------------
1ju3A2          LGVTQWQAAVSGVG--GLKAIAPSMASA------------------------------------------
1inpA           ----------------------------------------------------------------------
2b20A2          GGLSALYAGLHWPER--FGCVLSQS---------------------------------------------
1hlgA           GTTIGFIAFSTNPS--LAKRIKTFYALAPVATVKYTKSLINKLRFVPQSLFKFIFGDKI-----------
2fukA1          GAYVSLRAAAALEP--QVLISIAPPAGRWDFSDVQPPAQWLVIQGDADEIVDPQAVYDW-----------
1lbsA           GGLVAQWGLTFFP--SIRSKVDRLMAFAPDYKGTVLAGPLDALAVSAPSVWQQTTGSALTTALRNAGGLT
1bcr.1          AGHYVPELSQLVHR--SKNPVINLKGFMVGNGLIDDYHDYVGTF--------------------------


                         .         .         .         .         *         .         .:420
query           NLIDTLGEVVQEILPDSQLVKELGGFSRNDVEIVSICGDTPPYGVDVSGTELERFYPEFVKGRGDGFVSI
1c4xA           ----------------------------------------------------------------------
1cvlA           AFVNVFGTLV-------------SSSHNTDQDALAALRTL----TTAQTATYNRNFPSAGLG------AP
1pjaA           ----------------------------------------------------------------------
2dstA1          ----------------------------------------------------------------------
1i6wA           ----------------------------------------------------------------------
1ac5A           ----------------------------------------------------------------------
1agyA           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1ju3A2          ----------------------------------------------------------------------
1inpA           ----------------------------------------------------------------------
2b20A2          ----------------------------------------------------------------------
1hlgA           ----------------------------------------------------------------------
2fukA1          ----------------------------------------------------------------------
1lbsA           QIVPTT----------------------------------------------------------------
1bcr.1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           QSCRVGKVEQLSGNFYDLYSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1c4xA           ----------------------------------------------------------------------
1cvlA           GSCQTGAAETVGGSQHLLYS--------------------------------------------------
1pjaA           ----------------------------------------------------------------------
2dstA1          ----------------------------------------------------------------------
1i6wA           ----------------------------------------------------------------------
1ac5A           ----------------------------------------------------------------------
1agyA           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1ju3A2          ----------------------------------------------------------------------
1inpA           ----------------------------------------------------------------------
2b20A2          ----------------------------------------------------------------------
1hlgA           ----------------------------------------------------------------------
2fukA1          ----------------------------------------------------------------------
1lbsA           ----------------------------------------------------------------------
1bcr.1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxERIRSLELSSYLSGALVGKEVYIATESGVFAWDKKVLDKKIEFFKKIEDY
1c4xA           ----------------------------------------------------------------------
1cvlA           ----------------------------------------------------------------------
1pjaA           ----------------------------------------------------------------------
2dstA1          ----------------------------------------------------------------------
1i6wA           ----------------------------------------------------------------------
1ac5A           ----------------------------------------------------------------------
1agyA           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1ju3A2          ----------------------------------------------------------------------
1inpA           --------------------EALAKVVHQDVFFSDPALDSVEINIPQDILGIWVDPIDSTYQYIKGSADI
2b20A2          ----------------------------------------------------------------------
1hlgA           ----------------------------------------------------------------------
2fukA1          ----------------------------------------------------------------------
1lbsA           ----------------------------------------------------------------------
1bcr.1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           ASFVGEGDIFIIDNIGIKKYAPFPLVGDISDALITRNAIIYARVVPGGVRYYLFRNGAEKLIATSPGTTV
1c4xA           ----------------------------------------------------------------------
1cvlA           ----------------------------------------------------------------------
1pjaA           ----------------------------------------------------------------------
2dstA1          ----------------------------------------------------------------------
1i6wA           ----------------------------------------------------------------------
1ac5A           ----------------------------------------------------------------------
1agyA           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1ju3A2          ----------------------------------------------------------------------
1inpA           TPNQGLQCVTVLIGV-YDIQTGVPLMGVINQP--FVSQDLHT--RRWKGQCYWGLSYLGLLPPVSTRSNS
2b20A2          ----------------------------------------------------------------------
1hlgA           ----------------------------------------------------------------------
2fukA1          ----------------------------------------------------------------------
1lbsA           ----------------------------------------------------------------------
1bcr.1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           RMKSENGNYLLITDGEVVAIGSDFKEKGRVLSSLFGEKVKIVDASFKDDAFYILLNDGSIAFVSSSRSET
1c4xA           ----------------------------------------------------------------------
1cvlA           ----------------------------------------------------------------------
1pjaA           ----------------------------------------------------------------------
2dstA1          ----------------------------------------------------------------------
1i6wA           ----------------------------------------------------------------------
1ac5A           ----------------------------------------------------------------------
1agyA           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1ju3A2          ----------------------------------------------------------------------
1inpA           EAQSQGTQNPSSEGSCRFSVVISTSEKETIKGALSHVCGERIFRAAGAGYKSLCVILGLADIYIFSEDTT
2b20A2          ----------------------------------------------------------------------
1hlgA           ----------------------------------------------------------------------
2fukA1          ----------------------------------------------------------------------
1lbsA           ----------------------------------------------------------------------
1bcr.1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           KNYGLAVPKKVLNFQGRILVVYDGVILDLSAGKAQRFDRGIIDVFPGNESLFxxxxxxxxxxxxxxxxxx
1c4xA           ----------------------------------------------------------------------
1cvlA           ----------------------------------------------------------------------
1pjaA           ----------------------------------------------------------------------
2dstA1          ----------------------------------------------------------------------
1i6wA           ----------------------------------------------------------------------
1ac5A           ----------------------------------------------------------------------
1agyA           ----------------------------------------------------------------------
1dwoA           ----------------------------------------------------------------------
1ju3A2          ----------------------------------------------------------------------
1inpA           FKWDSCAAHAILRAMGGGMVDLKECLERNPDTGLDL-----PQLVYHVGNEG------------------
2b20A2          ----------------------------------------------------------------------
1hlgA           ----------------------------------------------------------------------
2fukA1          ----------------------------------------------------------------------
1lbsA           ----------------------------------------------------------------------
1bcr.1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           x
1c4xA           -
1cvlA           -
1pjaA           -
2dstA1          -
1i6wA           -
1ac5A           -
1agyA           -
1dwoA           -
1ju3A2          -
1inpA           -
2b20A2          -
1hlgA           -
2fukA1          -
1lbsA           -
1bcr.1          -