[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tmar0:AAD35418.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2aeeA1.bssp"
#ERROR : Can't open dsspfile "1lh0A.bssp"
#ERROR : Can't open dsspfile "1g2pA.bssp"
#ERROR : Can't open dsspfile "1o57A2.bssp"
#ERROR : Can't open dsspfile "1vdmA1.bssp"
#ERROR : Can't open dsspfile "1mzvA.bssp"
#ERROR : Can't open dsspfile "1y0bA1.bssp"
#ERROR : Can't open dsspfile "1a95A.bssp"
#ERROR : Can't open dsspfile "1g9sA.bssp"
#ERROR : Can't open dsspfile "1u9yA2.bssp"
#ERROR : Can't open dsspfile "1vchA1.bssp"
#ERROR : Can't open dsspfile "1a3cA.bssp"
#ERROR : Can't open dsspfile "1dqnA.bssp"
#ERROR : Can't open dsspfile "1bzyA.bssp"
#ERROR : Can't open dsspfile "1ao0A1.bssp"

## Summary of PDB Search
:187
    2e-17  20%  2aeeA1 [c.61.1.1] OROTATE PHOSPHORIBOSYLTRANSFERASE A:1 -- 208
    4e-17  24%  1lh0A  [c.61.1.1] OMP SYNTHASE
    2e-16  17%  1g2pA  [c.61.1.1] ADENINE PHOSPHORIBOSYLTRANSFERASE 1
    4e-15  23%  1o57A2 [c.61.1.1] PUR OPERON REPRESSOR A:75 -- 276
    1e-14  21%  1vdmA1 [c.61.1.1] PURINE PHOSPHORIBOSYLTRANSFERASE A:1 -- 153
    1e-14  22%  1mzvA  [c.61.1.1] ADENINE PHOSPHORIBOSYLTRANSFERASE
    1e-12  22%  1y0bA1 [c.61.1.1] XANTHINE PHOSPHORIBOSYLTRANSFERASE A:1 -- 191
    2e-12  14%  1a95A  [c.61.1.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    2e-12  16%  1g9sA  [c.61.1.1] HYPOXANTHINE PHOSPHORIBOSYLTRANSFERASE
    1e-11  22%  1u9yA2 [c.61.1.2] RIBOSE-PHOSPHATE PYROPHOSPHOKINASE A:156 -- 284
    6e-11  24%  1vchA1 [c.61.1.1] PHOSPHORIBOSYLTRANSFERASE-RELATED PROTEIN A:2 --
    8e-10  19%  1a3cA  [c.61.1.1] PYRIMIDINE OPERON REGULATORY PROTEIN PYRR
    1e-08  16%  1dqnA  [c.61.1.1] GUANINE PHOSPHORIBOSYLTRANSFERASE
    2e-08  18%  1bzyA  [c.61.1.1] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    5e-08  32%  1ao0A1 [c.61.1.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE A:235 --
:187

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIKEILEKTGALMEGHFILSSGKHSSRYVQCARLFEFPEYGDVVGEELAKLLKKYDVETVVGPAMGGVIL
2aeeA1          -----IKAVYLKPEDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIKAHFPEVIAGTATAGIPH
1lh0A           QFIEFALNKQVLKFGEFTLKSGRKSPYFFNA-GLFNTGRDLALLGRFYAEALVDSGIELLFGPAYKGIPI
1g2pA           -------KLALHQYPNFPSEGILFEDFLPIFRNPGLFQKLIDAFKLHLEEAFPEVKIDYIVGLESRGFLF
1o57A2          -----------QTLGQSLANPERILPGYVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPL
1vdmA1          --------------------------------KVYLTWWQVDRAIFALAEKLREYKPDVIIGVARGGLIP
1mzvA           --------------------SPRNVPRFADVSSITESPETLKAIRDFLVERYRTMSPTHILGFDARGFLF
1y0bA1          -------------------------------------PLLXQRIGDEFASRFAKDGITKIVTIESSGIAP
1a95A           ---------------------------------IVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVP
1g9sA           -----------------------------------EIKARIAELGRQITERYKDGSDMVLVGLLRGSFMF
1u9yA2          -----------------------------------------------------------VLAPDKGALEF
1vchA1          -------------------------------------PEFTRAAAEALRPLVPK-EAEILFTTETSPIPL
1a3cA           ---------------------------------------------TRIAHEMIERNKCILVGIKTRGIYL
1dqnA           -------------------------------------------TARRMNEYYKVAEPVTLVALLTGAYLY
1bzyA           ---------------------------------FIPHGLIMDRTERLARDVMKEMGGHHALCVLKGGYKF
1ao0A1          --------------------------------------------GKMLAQ---ESAVEAVTGVPDSSISA


                         .         .         *         .         .         .         .:140
query           SYVVARYLKARSLFAERENGVMKLRRGFFVKPGEKVAVVEDVVTTGGSVKEVIELLKEYGANVVCVGSII
2aeeA1          GAIIADKMTLPFAYIRSKPKGN--QIEGRVLKGQKMVIIEDLISTGGSVLDAAAAASREGADVLGVVAIF
1lh0A           ATTTAVALAEHYCFNRKEAKHGEGGSLVGSALQGRVMLVDDVITAGTAIRESMEIIQAHGATLAGVLISL
1g2pA           GPTLALALGVGFVPVRKAGSDLFEIQKNAIPAGSNVIIVDDIIATGGSAAAAGELVEQLEANLLEYNFVM
1o57A2          AYAAASYLNVPVVIVSNRIQTMSLAKRSMK-TGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLV
1vdmA1          AVRLSHILDVKFYKGERGEKPVITIPIHGDLKDKRVVIVDDVSDTGKTLEVVIEEVKKLGAKEIKIACLA
1mzvA           GPMIAVELGIPFVLMRKADEVMTIRHGS-IGKNSRVVLIDDVLATGGTALSGLQLVEASGAEVVEMVSIL
1y0bA1          AVXTGLKLKHKSLFTKQTESQIAVSGTH-LSDQDHVLIIDDFLANGQAAHGLVSIVKQAGASIAGIGIVI
1a95A           GALLARELGIRHVDTVCISSYNQRELKVLKGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAG
1g9sA           MADLCREVQVEVDFMTASSRDLKILKDLDEDRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLL
1u9yA2          AKTASKILNAEYDY-------LEIAPKTLDAKDRDVFIVDDIISTGGTMATAVKLLKEQGAKKIIAACVH
1vchA1          THVLAEALMEDPIIQEVQTEVLWLRRFAEKLLNQRVVLVSDVVASGETMRAMEKMVLRAGGHVVARLAVF
1a3cA           AKRLAERIEQIEGNITLYRNDEPLVKGADIPVDQKVILVDDVLYTGRTVRAGMDALVDVGPSSIQLAVLV
1dqnA           ASLLTVHLKVSSYKGTRQESVVFDEEDLKQLKKREVVLIDEYVDSGHTIFSIQEQIKHAKICSCFV----
1bzyA           FADLLDYIKALNRNSDRSIPMVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLL
1ao0A1          AIGYAEATGGRTFIALREQGVMKLSAVRGVVEGKRVVMVDDSIVRGTTSRRIVTMLREAGATEV------


                         +         .         .         .         .         *         .:210
query           DRSGGKVDFGVPFESLLKLDLPVYDPEDCPLCKQGIPAxxxxxxxxx
2aeeA1          TYELPKKEAGIKLITLSNYELIAVAKLQGYITNDGL-----------
1lh0A           DRQERGRDYGCKVISIITLKDLIAYLEEKPDMAEHLAA---------
1g2pA           ELLKGRSKLNAPVFTLL------------------------------
1o57A2          EAEGVD-----------------------------------------
1vdmA1          MKPWTSYVFRTEKWIV-------------------------------
1mzvA           TIPFLK-----------------------------------------
1y0bA1          EKSPGRVKLGYRVESLARIQ---------------------------
1a95A           RPLVDDYVVDIP-----------------------------------
1g9sA           DKPSRREVNVPVEFIG--FSIPDEF----------------------
1u9yA2          PVLIGD-----------------------------------------
1vchA1          RQ---------------------------------------------
1a3cA           DRGHRELPI--------------------------------------
1dqnA           -----------------------------------------------
1bzyA           VKRTPRSVGYKP-----------------------------------
1ao0A1          -----------------------------------------------