[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tmar0:AAD35545.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xocA1.bssp"
#ERROR : Can't open dsspfile "1dpeA.bssp"
#ERROR : Can't open dsspfile "1uiuA.bssp"
#ERROR : Can't open dsspfile "1uqwA.bssp"
#ERROR : Can't open dsspfile "1b05A.bssp"
#ERROR : Can't open dsspfile "1vr5A1.bssp"
#ERROR : Can't open dsspfile "1hhsA.bssp"
#ERROR : Can't open dsspfile "1al0F.bssp"
#ERROR : Can't open dsspfile "1qhdA2.bssp"
#ERROR : Can't open dsspfile "1qgiA.bssp"

## Summary of PDB Search
:614
    1e-73  21%  1xocA1 [c.94.1.1] OLIGOPEPTIDE-BINDING PROTEIN APPA A:17 -- 520
    2e-72  23%  1dpeA  [c.94.1.1] DIPEPTIDE-BINDING PROTEIN
    4e-70  22%  1uiuA  [c.94.1.1] NICKEL-BINDING PERIPLASMIC PROTEIN
    7e-69  21%  1uqwA  [c.94.1.1] PUTATIVE BINDING PROTEIN YLIB
    2e-68  21%  1b05A  [c.94.1.1] PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
    9e-61  17%  1vr5A1 [c.94.1.1] OLIGOPEPTIDE ABC TRANSPORTER, PERIPLASMIC A:23 --
    6e-25  12%  1hhsA  [e.8.1.6] RNA-DIRECTED RNA POLYMERASE
    1e-20   8%  1al0F  [b.121.5.1] CAPSID PROTEIN GPF
    4e-17   9%  1qhdA2 [b.19.1.1] VIRAL CAPSID VP6 A:149 -- 332
    3e-09   8%  1qgiA  [d.2.1.7] PROTEIN (CHITOSANASE)
:614

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxEVKNPDTIIDATIGEPDTLDPHFAYDTASGEVIYNVYENLIAYKGESLTEFE
1xocA1          ------------------KPQQGGDLVVGSIGEPTLFNSLYSTDDASTDIENMLYSFLTKTDEK--LNVK
1dpeA           ------------------------TLVYCSEGSPEGFNPQLFISGTTYDASVPLYNRLVEFKIGTTE-VI
1uiuA           -----------------------DEITTAWPVNVGPLNPHLYTPNQM-FAQSMVYEPLVKYQAD--GSVI
1uqwA           -----------------------KDVVVAVGSNFTTLDPYDANDTLSQAVAKSFYQGLFGLDKEX--KLK
1b05A           --------------------ADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVE--GHPS
1vr5A1          ------------------ERNKTLYWGGALWSPPSNWNPFTPWNAVAG-TIGLVYEPLFLYDPLNDK-FE
1hhsA           ----------------------------------------------------------------------
1al0F           ----------------------------------------------------------------------
1qhdA2          --------------------HKPNIFPYSASFTLHDNLMGTMWLNAGSEIQVAGFDYSCAINAP--ANTQ
1qgiA           -----------------------------------SVEQARQRGFTSAVTIGSFVDTALNQGTGGSDTLQ


                         .         .         *         .         .         .         .:140
query           PRLAERWEILDDGKTYKFYIRKGVKFHEGGDLTPEDVEYSFERGLIFDPTAGPMWMLWEALFGVDSLETF
1xocA1          LSLAESIKELDGGLAYDVKIKKGVKFHDGKELTADDVVFTYSV--PLSKDYKGER---------------
1dpeA           PGLAEKWEVSEDGKTYTFHLRKGVKWHDNKEFKPTRELNADDV--------------------VFSFDRQ
1uiuA           PWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENFRA--VLDNRQRHAWLE-------------
1uqwA           NVLAESYTVSDDGITYTVKLREGIKFQDGTDFNAAAVKANLDR--ASDPANHLKRHNL--YKNIAKTEA-
1b05A           PGVAEKWEN-KDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQR--LADPNTASPYASYLQYGHIANIDDI
1vr5A1          PWLAEKGEWVSNN-EYVLTLRKGLRWQDGVPLTADDVVFTFEIAK--KYTGISYSPVWNWLGRIER----
1hhsA           ----------------------------------------------------------------------
1al0F           ----------------------------------------------------------------------
1qhdA2          QFEHIVQL-RRVLTTATITLLPDARFSFPRVITSADGATTWYF--NPVILRPNNVEI-------------
1qgiA           GLLARSGSSSNEKTFMKNFHAKVDTNKYNKPPNGKNRVKQWDT---------------------------


                         +         .         .         .         .         *         .:210
query           VEEKIGKPYSELFDENGEPLPEYRDALIKIYTDYIDPAIEVEGDAVVFHLVRPFAPFMYILAQSASWSAV
1xocA1          ----------------------------GSTYEMLKSVEKKGDYEVLFKLKYKDGNFYNNAL---DSTAI
1dpeA           KNAQNPYHKVSGGS--------YEYFEGMGLPELISEVKKVDDNTVQFVLTRPEAPFLADLAMD--FASI
1uiuA           ------------------------------LANQIVDVKALSKTELQITLKSAYYPFLQELALP--RPFR
1uqwA           ----------------------------------------IDPTTVKITLKQPFSAFINILAHPATAXI-
1b05A           IAGKKPAT---------------------------DLGVKALDDHFEVTLSEPVPYFYKLLVHP--SVSP
1vr5A1          ----------------------------------------VDERTLKFVFSDPRYQE---WKQXLINTPI
1hhsA           ---------------------------------------------GLLSVDPRFLSFKNELS--RYLTDH
1al0F           ----------------------------------------------------------------------
1qhdA2          ------------------EFLLNGQIINTYQARFGTIIARNFDTRLSFQLMRPPNMTPAVAALFPN----
1qgiA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LDKEWCIEIGCWDGRADTWWKYHDIRKEDSPLYARMNGTGPFKFVEWDRAQQKVILERNDNYWREPAKIK
1xocA1          LPKHILGNVPIADLEENEFNRKKPI------------GSGPFKFKEWKQ-GQYIKLEANDDYFEGRPYLD
1dpeA           LSKEY--------------ADAMMKAGTPEKLDLNPIGTGPFQLQQYQK-DSRIRYKAFDGYWGTKPQID
1uiuA           FIAPS----------QFKNHETMNGIKA-------PIGTGPWILQESKL-NQYDVFVRNENYWGEKPAIK
1uqwA           --------------------SPAALEKYGKEIGFYPVGTGPYELDTWNQ-TDFVKVKKFAGYWPGLPKLD
1b05A           VPKSA------VEKFGDKWT-----------QPANIVTNGAYKLKNWVV-NERIVLERNPQYWNAKTVIN
1vr5A1          VPKHIWENKTEEEVLQAANEN--------------PVGSGPYYVESWA--DDRCVFKKNGNWWGIDPKPE
1hhsA           FPANVDEYGRVYGNGVRT-----------NFFGMRHMNGFPMIPATWPL-ASNLKKRADADLADPVSERD
1al0F           --------------------------------AERMPDLSHLGFLAGQIGRL-ITISTTPVIAGDSFEMD
1qhdA2          ----------------------------------------------------------------------
1qgiA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RVIIWGIDEWSTRRAMFLQGDADICAVPTQYLEQVEGKPGVTVVKGLPELAVTSLHFAWNVPEDSKYIGS
1xocA1          TVTYKVIPDANAAEAQLQAGDINFFNVPATDYKTAEKFNNLKIVTD-LALSYVYIGWNEKN---------
1dpeA           TLVFSITPDASVRYAKLQKNECQVMPYPNADIARMKQDKSINLMEM-PGLNVGYLSYNVQKK--------
1uiuA           KITFNVIPDPTTRAVAFETGDIDLLYGNEDTFARFSQNPAYHTQLS-QPIETVMLALNTAKA--------
1uqwA           SITWRPVADNNTRAAXLQTGEAQFFPIPYEQATLLEKNKNIELXAS-PSIXQRYISXNVTQK--------
1b05A           QVTYLPISSEVTDVNRYRSGEIDMTYNNIELFQKLKKEIPNEVRVD-PYLCTYYYEINNQKA--------
1vr5A1          RIVELRVLSNNVAVGXLXKGELDWSNFLPGVPVLKKAYGIVTWYENAPYXLPANTAGIYINVNK------
1hhsA           NLLFRAAVR--LMFSDLEPVPLKIRKGSSTCIPYFSNDMGTKI-----------------------EIAE
1al0F           AVGALRLSPLRRGLAIDSTVDIFTFYVPHRH------VYGEQWIK--FMKDGVNATPLPTVN--------
1qhdA2          ----------------------------------------------------------------------
1qgiA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GKLDGNGIPPDFFSDENVRKAFIYAFDYDTFINEVLKGLGRKIPTDXXXXXXXXXXXXXXDPDAPHFDIV
1xocA1          ----------ELFKDKKVRQALTTALDRESIVSQVLDGDG--EVAYIPESPLSWNYPKDIDVPKFEYNEK
1dpeA           -----------PLDDVKVRQALTYAVNKDAIIKAVYQGAGVSAKN----LIPPTMWGYNDDVQDYTYDPE
1uiuA           -----------PTNELAVREALNYAVNKKSLIDNALYGTQQVADT----LFAPSVPYANLGLKPSQYDPQ
1uqwA           -----------PFDNPKVREALNYAINRPALVKVAFAGYATPATG-----VVPPSIAYAQSYKPWPYDPV
1b05A           -----------PFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWKWSQQKRNE
1vr5A1          ----------YPLSIPEFRRAXAYAINPEKIVTRAYENXVTAANPLPLPGYXKYYPKEVVDKYGFKYDPE
1hhsA           RALEKAEEAGNLMLQGKFDDAYQL-HQMGGAYYVVYRAQSTDITLDPKTGKFVSKDRMVADFEYAVTGGE
1al0F           -----------TTGYIDHAAFLGTNPDTNKIPKHLFQGYLNIYNN----YFKAPWMPDRTEANPNELNQD
1qhdA2          ----------------------------------------------------------------------
1qgiA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KATEYFKKAWNGEVWKKGFKITLLYNTGNEVRRQAAEMLKAYIEMINPKFKVEVRGVQWPTYLDATKRGE
1xocA1          KAKQMLAEAGWKDTNGKKFSFTLKTNQGNKVREDIAVVVQEQLKKIG--IEVKTQIVEWSALVEQMNPPN
1dpeA           KAKALLKEAGLEKGFSIDLWAMPVQRPYNPNARRMAEMIQADWAKVGVQ--AKIVTYEWGEYLKRAKDGE
1uiuA           KAKALLEKAGWTLPAGKDLRIELSFIGTDALSKSMAEIIRADMRQIGAD--VSLIGEEESSIYARQRDGR
1uqwA           KARELLKEAG----YPNGFSTTLWSSHNHSTAQKVLQFTQQQLAQVG--IKAQVTAXDAGQRAAEVEGKG
1b05A           EAKKLLAEA--GFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLG--VNVNLENQEWKTFLDTRHQGT
1vr5A1          XAKKILDELGFKDVNKKPFKLTIECPYGWTDWXVSIQSIAEDLVKVG--INVEPKYPDYSKYADDLYGGK
1hhsA           QGSLFAAKEQYGIDVPDGFF-CERRRTAMGGPFALNAPIMAVAQPVTTRLNKEEKVKEWSLCV-ATDVSD
1al0F           DARYGFRCC--HLKNIWTAPLPPETELSRQMTTSTTSIDIMGLQAA--YANLHTDQERDYFMQRYRDVIS
1qhdA2          ----------------------------------------------------------------------
1qgiA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           VPAFIIGWLADYPDPHNFIFTYYHSAGVYSGRQGENFRKFVSTPHPDLGGRSLDELIEEAIAKTDPAERQ
1xocA1          WDFDAMVMGWSLSTFPDQYDIFHSSQIKKGLNYV-----WYKNAE-------ADKLMKDAKSISDRKQYS
1dpeA           HQTVMMGWTGDNGDPDNFFATEFSCAASEQGSNYSKWCYK-----------PFEDLIQPARATDDHNKRV
1uiuA           FGMIFHRTWGAPYDPHAFLSSMRVPSHADFQAQQGLADKPL-----------IDKEIGEVLATHDETQRQ
1uqwA           QKEFYTGWSASTGEADWALSPLFASQ--NWPPTLFNTAFYSNKQ--------VDDFLAQALKTNDPAEKT
1b05A           FDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSP---------------AFDKLIADTLKVADDTQRS
1vr5A1          FDLILNNFTTGVATIWSYFNGVFYPDAVESEYSYSGNFGKYANPE-------VETLLDELNRSNDDAKIK
1hhsA           HDTFWPGWLRDLICDELLNMGYAPWWVKLF-ETSLKLPVYVGAPAPEQGHPDLEVGLSSGQGATD-----
1al0F           SFGGKTSY-----DADNRPLLVMRSNLWASGYDVDGT----------------DQTSLGQFSGRVQQTYK
1qhdA2          ----------------------------------------------------------------------
1qgiA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           ALYEEIQRFAMKHALGMPLYQPLGVRVQRSWVKGWYHNPMRPGDDYYVLWKAEx
1xocA1          KEYEQIYQKIAEDQPYTFLYYPNNHMAMPENLEGYKYHPKRDLYNIEKWWLAK-
1dpeA           ELYKQAQVVMHDQAPALIIAHSTVFEPVRKEVKGYVVDPLGKHHFENVSIE---
1uiuA           ALYRDILTRLHDEAVYLPISYISMMVVSKPELGNIPYAPIATEIPF--------
1uqwA           RLYKAAQDIIWQESPWIPLVVEKLVSAHSKNLTGFWIXPDTGFSFEDADLQ---
1b05A           ELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIK-
1vr5A1          EVVAKLSEILLKDLPFIPLWYNGAWFQASEAVWTNWPTEKNPPIGWNGWWQ---
1hhsA           ------------------------------------------------------
1al0F           HSVPRFFVPEHGTMFTLALRFPPTATKEIQYLNAKGALTYTDIAGDPVLYGN--
1qhdA2          ------------------------------------------------------
1qgiA           ------------------------------------------------------