[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tmar0:AAD35671.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1s7bA.bssp"

## Summary of PDB Search
:301
    8e-08  16%  1s7bA  [f.39.1.1] EMRE PROTEIN
:301

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIVMAGFWGVF
1s7bA           ------------------------------------------------------------SVGTIICYCA


                         .         .         *         .         .         .         .:140
query           SYFAFENSALMFTEPTNAAIIVSSAPVFFLLFSHLVQKKKTTSKMYLGVILSFLGVALVVLNGxxxxxxx
1s7bA           SFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLS-------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1s7bA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1s7bA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxx
1s7bA           ---------------------