[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tmar0:AAD35678.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ii5A.bssp"
#ERROR : Can't open dsspfile "1gggA.bssp"
#ERROR : Can't open dsspfile "1xt8A1.bssp"
#ERROR : Can't open dsspfile "1hslA.bssp"
#ERROR : Can't open dsspfile "1nh7A1.bssp"
#ERROR : Can't open dsspfile "1z7mE1.bssp"
#ERROR : Can't open dsspfile "1ftjA.bssp"
#ERROR : Can't open dsspfile "1pb7A.bssp"
#ERROR : Can't open dsspfile "1h3dA1.bssp"
#ERROR : Can't open dsspfile "1zbmA1.bssp"
#ERROR : Can't open dsspfile "1hq6.1.bssp"
#ERROR : Can't open dsspfile "3btaA2.bssp"
#ERROR : Can't open dsspfile "1us4A.bssp"
#ERROR : Can't open dsspfile "1o63A.bssp"

## Summary of PDB Search
:246
    3e-51  25%  1ii5A  [c.94.1.1] HYPOTHETICAL PROTEIN SLR1257
    9e-49  36%  1gggA  [c.94.1.1] GLUTAMINE BINDING PROTEIN
    9e-46  32%  1xt8A1 [c.94.1.1] PUTATIVE AMINO-ACID TRANSPORTER PERIPLASMIC A:10
    4e-45  34%  1hslA  [c.94.1.1] HISTIDINE-BINDING PROTEIN
    8e-42  15%  1nh7A1 [c.94.1.1] ATP PHOSPHORIBOSYLTRANSFERASE A:1 -- 210
    1e-35  14%  1z7mE1 [c.94.1.1] ATP PHOSPHORIBOSYLTRANSFERASE E:1 -- 204
    6e-35  25%  1ftjA  [c.94.1.1] GLUTAMATE RECEPTOR SUBUNIT 2
    2e-34  21%  1pb7A  [c.94.1.1] N-METHYL-D-ASPARTATE RECEPTOR SUBUNIT 1
    2e-28  14%  1h3dA1 [c.94.1.1] ATP-PHOSPHORIBOSYLTRANSFERASE A:5 -- 224
    3e-28  14%  1zbmA1 [c.94.1.1] HYPOTHETICAL PROTEIN AF1704 A:2 -- 261
    2e-25  11%  1hq6.1 [d.155.1.1] HISTIDINE DECARBOXYLASE A:- -- - B:- -- -
    2e-12  13%  3btaA2 [b.42.4.2] PROTEIN (BOTULINUM NEUROTOXIN TYPE A) A:1079 --
    8e-09  17%  1us4A  [c.94.1.1] PUTATIVE GLUR0 LIGAND BINDING CORE
    2e-08  17%  1o63A  [c.94.1.1] ATP PHOSPHORIBOSYLTRANSFERASE
:246

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxIDEIKSRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKEIARRLGVELK
1ii5A           -----------------------------LKVGVVGN-PPFVFY---GAFTGISLDVWRAVAESQKWNSE
1gggA           -----------------------------LVVATDTAFVPFEFKQ-GDLYVGFDVDLWAAIAKELKLDYE
1xt8A1          --------------------LDKIKQNGVVRIGVFGDKPPFGYVDEKGNNQGYDIALAKRIAKELENKVQ
1hslA           -------------------------IPQKIRIGTDPTYAPFESKNAQGELVGFDIDLAKELCKRINTQCT
1nh7A1          -----------------------------LRVAVPNKGALSEPATEILAEAGRRTDSKDLTVIDPVNNVE
1z7mE1          -----------------------------IKIAITKGRIQKQVTK-LLENADYDVEPIRELQIKTKDDLQ
1ftjA           ------------------------------VVVTTILESPYEMLEGNERYEGYCVDLAAEIAKHCGFKYK
1pb7A           ---------------------------------------------------GFCIDLLIKLARTMNFTYE
1h3dA1          -----------------------------LRIAMQKSGRLSDDSRELLARCGIKINLHRLIAMAENMPID
1zbmA1          ----------------------------------------------------------THGKVDTWLEIE
1hq6.1          ------------------------------------NMTTASFTGVQGRVIGYDILRSPEVDKAKPLF--
3btaA2          ------------------------------------NKCKMNLQDNNGNDIGFIGFH------QFNNIAK
1us4A           -----------------------------------------------GSTTGVYFPVATGIAKNVGIRAN
1o63A           --------------------------------------------------------ERESSILREGKDIV


                         .         .         *         .         .         .         .:140
query           IVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGQVIVVRKDSDFRPKTYEDLVGKTVA
1ii5A           YVRQNISAGITAVAEGELDILIGPISVTPERAAIITFTQPYFSSGIGLLIPGTATPLFRSVGDLKNKEVA
1gggA           LKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKAN-NNDVKSVKDLDGKVVA
1xt8A1          FVLVEAANRVEFLKSNKVDIILANFTQTPQRAEQVDFCSPYMKVALGVAVPKDSN--ITSVEDLKDKTLL
1hslA           FVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKN-SDIQPTVASLKGKRVG
1nh7A1          FFFLRPKDIAIYVGSGELDFGITGRDLVCDSGAQVRERLALGFGSSSFRYAAP-AGRNWTTADLAGMRIA
1z7mE1          IIFGKPNDVITFLEHGIVDIGFVGKDTLDENDFDDYYELLYLKIGQCIFALASYP-DFSNKNFQRHKRIA
1ftjA           LTIKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPI--ESAEDLSKQTEI
1pb7A           VHKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDK
1h3dA1          ILRVRDDDIPGLVMDGVVDLGIIGRRAQGEDPRYFTLRRLDFGCRLSLATPVDEAW--DGPLSLNGKRIA
1zbmA1          HVIEDIETLNRKAFNAEYEVTAISAHAYALLDDKYRILSAGASVGDGYGPVVVA----KSEISLDGKRIA
1hq6.1          -TETQWDGSELPIYDPLQDALVEYFGTEQDRRHY-PAPGSFIVCANKGVTAERPK-NDADMKPGQGYGVW
3btaA2          LVASNWYNRQIERSSRTLGCSWEFIPVDDGWGERP-----------------------------------
1us4A           ARSTGGSANINAINAGEFEXALAQNDICIPAFEGKPVKTALYPEVVHVVARKDAGI--RTVADLKGKRVV
1o63A           CFXVRPFDVPTYLVHGVADIGFCGTDVLLEKETSLIFFIPTNISRXVLAGPKGTKFPNVTQRYCESKGWH


                         +         .         .         .         .         *         .:210
query           VQIGTTGDIEVSKYDGIKVVRFDKFTDAFLELKRGRADAVVLDSATARAFVAKNPDLVISSGVLSSEQYG
1ii5A           VVRDTTA-VDWANFYQADVRETNNLTAAITLLQKKQVEAVMFDRPALIYYTRQNPNLEVTEIRVSLEPYG
1gggA           VKSGTGSDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIKTAGQFKAVGDSLEAQQYG
1xt8A1          LNKGTTAAYFTQNYPNIKTLKYDQNTETFAALMDKRGDALSHDNTLLFAWVKDHPDFKMGIKLGNKDVIA
1hslA           VLQGTTQETFGNEHKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGAVKDEKLFGVGTG
1nh7A1          TAYPNLVR-KDLATKGIEATVIRLDGAVEISVQLGVADAIADVVGSGRTLSQH--DLVAFGEPLCDSEAV
1z7mE1          SKYPRVTKKYFAQK-QEDIEIIKLEGSVELGPVVGLADAIVDIVETGNTLSANG--LEVIEKISDISTRM
1ftjA           AYGTLDSRSKIAVFDKMWTVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKDTMKVGGNLDSKGYG
1pb7A           FIYATVKQSSVTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFG
1h3dA1          TSYPHLL-KRYLDQKGISFKSCLLNGSVEVAPRAGLADAICDLVSTGAT--LEANGLREVEVIYRSKACL
1zbmA1          VPGRYTTANLLLKLVEDFEPVEXPFDRIIQAVLDEEVDAGLLIHEGQITYADYGLKCVLDLWDWWSEQVK
1hq6.1          SAIAISFAKDAGVWETPNEDELLEYLEAKSIAECGQDAHASFESSWGFAYTMMEPGQI--GNAITVAPYV
3btaA2          ----------------------------------------------------------------------
1us4A           VDVGSGTEQNARTFDDLGQAIRVSASQGIQLXQDKRADALFYTVGLGASAIQQ-----------------
1o63A           CRIILKGSVELA-------------------PIAGLSDLIV--DITETGRTLKENNLEILDEIFVIRTHV


                         .         .         .         +         .         .         .:280
query           IAVRKEDTDLLEFINSVLRELKKSPYDVLIEKWFSE
1ii5A           FVLKE-NSPLQKTINVEMLNLLYSVIAEFTERWLGE
1gggA           IAFPKGSDELRDKVNGALKTLRENGYNEIYKKWFGT
1xt8A1          PAVKKGDKELKEFIDNLIIKLGQEQFHKAYDETL--
1hslA           MGLRKEDNELREALNKAFAEMRADGYEKLAKKYFDF
1nh7A1          LIEREARDQLVARVQGVVF-----------------
1z7mE1          IVNKSSFKFKKDKIIEMVERLE--------------
1ftjA           IATPK-GSSLGNAVNLAVLKLNEQLLDKLKNKWWYD
1pb7A           IGMRK-DSPWKQNVSLSILKSHENFMEDLDKTWV--
1h3dA1          IQRDESKQQLIDKLLTRIQGVIQA------------
1zbmA1          AIRRDLSVEVQEEFLRAXRESIAFAIEYAXKYSR--
1hq6.1          SLPIDSIPGGSILTPDKDMEIM---ENLTMPEWL--
3btaA2          ------------------------------------
1us4A           ------------------------------------
1o63A           VVNPVSYRTKREEVVSFLEKLQE-------------