[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tmar0:AAD35750.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1o61A.bssp"
#ERROR : Can't open dsspfile "2fn6A1.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "1mdoA.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "1ax4A.bssp"
#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "2hevF1.bssp"
#ERROR : Can't open dsspfile "1zb6A1.bssp"
#ERROR : Can't open dsspfile "1fc4A.bssp"
#ERROR : Can't open dsspfile "1c8nA.bssp"
#ERROR : Can't open dsspfile "1qz9A.bssp"
#ERROR : Can't open dsspfile "1lc5A.bssp"
#ERROR : Can't open dsspfile "1pmmA.bssp"
#ERROR : Can't open dsspfile "1c4kA2.bssp"
#ERROR : Can't open dsspfile "1m32A.bssp"
#ERROR : Can't open dsspfile "2bkwA1.bssp"
#ERROR : Can't open dsspfile "2e7iA1.bssp"
#ERROR : Can't open dsspfile "1wytB1.bssp"
#ERROR : Can't open dsspfile "1v8dA.bssp"
#ERROR : Can't open dsspfile "1v72A1.bssp"
#ERROR : Can't open dsspfile "1svvA.bssp"
#ERROR : Can't open dsspfile "1u08A.bssp"
#ERROR : Can't open dsspfile "2bwnA1.bssp"
#ERROR : Can't open dsspfile "3bc8A1.bssp"
#ERROR : Can't open dsspfile "1bj4A.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "1vefA1.bssp"
#ERROR : Can't open dsspfile "1xl7A1.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "1jg8A.bssp"
#ERROR : Can't open dsspfile "1gbnA.bssp"
#ERROR : Can't open dsspfile "1vk9A.bssp"
#ERROR : Can't open dsspfile "1s2bA.bssp"
#ERROR : Can't open dsspfile "1gr0A2.bssp"
#ERROR : Can't open dsspfile "1w9gA1.bssp"
#ERROR : Can't open dsspfile "1fg3A.bssp"
#ERROR : Can't open dsspfile "1bs0A.bssp"
#ERROR : Can't open dsspfile "1elqA.bssp"
#ERROR : Can't open dsspfile "1ei7A.bssp"
#ERROR : Can't open dsspfile "2z67A1.bssp"
#ERROR : Can't open dsspfile "2govA1.bssp"
#ERROR : Can't open dsspfile "1hskA2.bssp"
#ERROR : Can't open dsspfile "1kolA2.bssp"

## Summary of PDB Search
:377
    1e-86  24%  1o61A  [c.67.1.4] AMINOTRANSFERASE
    8e-43  25%  2fn6A1 [c.67.1.4] AMINOTRANSFERASE A:2 -- 372
    7e-34  23%  1b9hA  [c.67.1.4] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    5e-33  25%  1mdoA  [c.67.1.4] ARNB AMINOTRANSFERASE
    1e-23  11%  1cl1A  [c.67.1.3] CYSTATHIONINE BETA-LYASE
    3e-22  18%  1ax4A  [c.67.1.2] TRYPTOPHANASE
    2e-19  13%  1cs1A  [c.67.1.3] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    3e-19  14%  2hevF1 [b.22.1.1] TUMOR NECROSIS FACTOR LIGAND SUPERFAMILY MEMBER
    4e-19  13%  1zb6A1 [d.313.1.1] AROMATIC PRENYLTRANSFERASE A:3 -- 303
    3e-17  13%  1fc4A  [c.67.1.4] 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE
    4e-17  11%  1c8nA  [b.121.4.7] COAT PROTEIN
    1e-16  13%  1qz9A  [c.67.1.3] KYNURENINASE
    2e-16  11%  1lc5A  [c.67.1.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    3e-16  10%  1pmmA  [c.67.1.6] GLUTAMATE DECARBOXYLASE BETA
    2e-15  14%  1c4kA2 [c.67.1.5] PROTEIN (ORNITHINE DECARBOXYLASE) A:108 -- 569
    5e-15  15%  1m32A  [c.67.1.3] 2-AMINOETHYLPHOSPHONATE-PYRUVATE
    1e-14  18%  2bkwA1 [c.67.1.3] ALANINE-GLYOXYLATE AMINOTRANSFERASE 1 A:3 -- 384
    2e-14  15%  2e7iA1 [c.67.1.9] SEP-TRNA:CYS-TRNA SYNTHASE A:8 -- 371
    2e-14  15%  1wytB1 [c.67.1.7] GLYCINE DEHYDROGENASE SUBUNIT 2 (P-PROTEIN) B:2
    8e-14  16%  1v8dA  [c.140.1.1] HYPOTHETICAL PROTEIN (TT1679)
    3e-13  14%  1v72A1 [c.67.1.1] ALDOLASE A:6 -- 350
    8e-13  17%  1svvA  [c.67.1.1] THREONINE ALDOLASE
    9e-13  14%  1u08A  [c.67.1.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
    2e-12  13%  2bwnA1 [c.67.1.4] 5-AMINOLEVULINATE SYNTHASE A:2 -- 397
    2e-12   9%  3bc8A1 [c.67.1.9] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    3e-12  18%  1bj4A  [c.67.1.4] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    3e-11  13%  1c7nA  [c.67.1.3] CYSTALYSIN
    9e-11  12%  1vefA1 [c.67.1.4] ACETYLORNITHINE/ACETYL-LYSINE AMINOTRANSFERASE
    2e-10   9%  1xl7A1 [c.43.1.3] PEROXISOMAL CARNITINE O-OCTANOYLTRANSFERASE A:11
    2e-10  13%  1bw0A  [c.67.1.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    1e-09  15%  1agxA  [c.88.1.1] GLUTAMINASE-ASPARAGINASE
    2e-09  18%  1jg8A  [c.67.1.1] L-ALLO-THREONINE ALDOLASE
    4e-09  17%  1gbnA  [c.67.1.4] ORNITHINE AMINOTRANSFERASE
    2e-08  10%  1vk9A  [c.97.1.3] CONSERVED HYPOTHETICAL PROTEIN TM1506
    3e-08  12%  1s2bA  [b.29.1.20] SCYTALIDOPEPSIN B
    7e-08  15%  1gr0A2 [d.81.1.3] MYO-INOSITOL-1-PHOSPHATE SYNTHASE A:201 -- 311
    9e-08   8%  1w9gA1 [d.330.1.1] ENHANCER OF RUDIMENTARY HOMOLOG A:1 -- 103
    2e-07  23%  1fg3A  [c.67.1.1] HISTIDINOL PHOSPHATE AMINOTRANSFERASE
    6e-07  22%  1bs0A  [c.67.1.4] PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)
    1e-06  23%  1elqA  [c.67.1.3] L-CYSTEINE/L-CYSTINE C-S LYASE
    2e-06   7%  1ei7A  [a.24.5.1] COAT PROTEIN
    3e-06  20%  2z67A1 [c.67.1.9] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE A:1
    4e-05   8%  2govA1 [d.60.1.4] HEME-BINDING PROTEIN 1 A:7 -- 190
    5e-05   7%  1hskA2 [d.146.1.1] UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE REDUCTASE
    2e-04  19%  1kolA2 [c.2.1.1] FORMALDEHYDE DEHYDROGENASE A:161 -- 355
:377

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIPLFDLTRQYERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAM
1o61A           ---------------GNELKYIEEVFKSNYIALGEFVNRFEQSVKDYSKSENALALNSATAALHLALRVA
2fn6A1          ------------CLDKEDKKAVLEVLNSKQLTQGKRSLLFEEALCEFLGVKHALVFNSATSALLTLYRNF
1b9hA           -----------PQYDDAERNGLVRALEQGQWWRMGGVNSFEREFAAHHGAAHALAVTNGTHALELALQVM
1mdoA           ----------------EELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGXHIALXAL
1cl1A           ----------------------------------LTHFSLQQAMCELEGGAGCVLFPCGAAAV-ANSILA
1ax4A           ----------------------------------RNYYDLKDKAKELFNYDYIIPAHQGRGAENILFPVL
1cs1A           ---------------------------------NPTRDVVQRALAELEGGAGAVLTNTGMSAIHLVTTVF
2hevF1          -EKGFILTSQKEDEIMKVQDNSVIINCDGFYLISLKGYFSQEVDISLHYQKDEEPLFQLKKVRSVNSLMV
1zb6A1          ----------------------------------------------------------------------
1fc4A           ----------------------------------DSHKELEQKLAAFLGXEDAILYSSCFDANGGLFETL
1c8nA           -----------------------------------------------------TPIALAYTVQSLPLIAT
1qz9A           ----------------------------------DLSERLGNRLATLIGARDGEVVVTDTTSINLFKVLS
1lc5A           ----------------SVKRALIDNLDCIERYPDADYFHLHQALARHHQVPASWILAGNGETESIFT-VA
1pmmA           -----------ENVHKLMDLSINKNWIDKEEYSAAIDLRCVNMVADLWHAPAPKNGQAVSEACMLGGMAA
1c4kA2          ------------------------------------AVAAEKHAARVYNADKTYFVLGGSSNANNTVTSA
1m32A           ------------------------------------VEQIRQQLTALATASEGLLQGSGSYAVEAVLG-S
2bkwA1          -------------------------------IFQRVLKNTRAVFKSAAASKSQPGSGTLGWDIFASNFIL
2e7iA1          ---------------------------------PPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSL
1wytB1          ----------------KLHEEAARLFADLHPYQDRLMWELGEYLKALTGMDATLEPAAGAHGELTGILIG
1v8dA           ------------------------------------ALVVERETARAFGKEEVAVFPHPKAGGAKATAAF
1v72A1          ----------------EVAQALVKHSSGQAGPYGELTAQVKRKFCEIFERDVEVFLVPTGTAANALCLSA
1svvA           ----------------------------------SHCAKAARLIGELLERADVHFISGGTQTNLIACSLA
1u08A           -----------RYLQERLAHHVAQGANQYAPMTGVQIAQKTERLYGYQPDADSITVTAGATEALYAAITA
2bwnA1          ----------------------------------AYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTL
3bc8A1          ------------------------------------TNSLVLNVIKLAGVHSCFVVPMATGMSLTLTLRH
1bj4A           -------------------------------------RALQAYKLDPQCWGVNVQPYSGSPANFAVYTAL
1c7nA           -------------------------------------KWMKDRHQWDIQTDWIINTAGVVPAVFNAVREF
1vefA1          GYGVANLGHGNPEVVEAVKRQAETLMAMPQTLPTPMRGEFYRTLTAILPPELNFPVNSGTEANEAALKFA
1xl7A1          -----------------------------------ENLTLLEKIQTSLFVYSIEDSSPATPEEYSQVFEX
1bw0A           ----------------------------------RNSFVHKEELKSTIVKDN-VVLCSGGSHGILMAITA
1agxA           ---------------------------------------------------NIHTHAFVSQWGALGTLVE
1jg8A           ----------------------------GDDVYGEDINELERLAAETFGKEAALFVPSGTMGNQVSIMAH
1gbnA           -----------------LKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLK
1vk9A           ----------------------------------------------------------------------
1s2bA           ------------------------LIGSD----------FDTVSATANVSASGGSSAAGTAWVGIDCQTA
1gr0A2          ----------------------------GATITHRVLAKLFEDRGVQLDRTMQLNVGGNMDFLNMLEDVH
1w9gA1          ----------------------------------------------------------------------
1fg3A           -------------------------------------KAVIENYAQYAGVKEQVLVSRGADGIELLIRAF
1bs0A           ---------HHPQIIRAWQQGAEQFIGSGGSVSGYSVQALEEELAEWLGYSRALLFISGFAANQAVIAAM
1elqA           -------------------------------------------------------TDNVTTGCDIVLWGL
1ei7A           ----------------------------------------------------------------------
2z67A1          ---------------------------------------LESFFKQLGLNVHAIATPISTXSISLCLSAA
2govA1          --------------------------------------------------------------LQKKLKVW
1hskA2          ----------------------------------------------------------------------
1kolA2          -------------------------------------------------------LTCLSDILPTGYHGA


                         .         .         *         .         .         .         .:140
query           GVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDL
1o61A           GVKQDDIVLASSFTFIASVAPICYLKAKPVFIDCDE-TYNIDVDLLKLAIKEKKPKALILTHLYGNAAKM
2fn6A1          SEFSANEIITTPISFVATANMLLESGYTPVFAGIKN-DGNIDELALEKLINE-RTKAIVSVDYAGKSVEV
1b9hA           GVGPGTEVIVPAFTFISSSQAAQRLGAVTVPVDVDAATYNLDPEAVAAAV-TPRTKVIMPVHMAGLMADM
1mdoA           GIGEGDEVITPSXTWVSTLNXIVLLGANPVXVDVDRDTLXVTPEHIEAAITPQTK-AIIPVHYAGAPADL
1cl1A           FIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWF--DPLIGADIVKHLQPNTKIVFLPGSITMEVHDV
1ax4A           KQKEGKPVFISNFHFDTTAAHVELNGCKAINIVTEKAKGDFDIKKLKENIAQDNIVAITCNSAGGQPVSM
1cs1A           -LKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLFVDQ--GDEQALRAALAEKPKLVLVPSNPLLRVVDI
2hevF1          ALTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCV-----------------------------
1zb6A1          ------------------------CARDKIYPLLSTFQDT--LVEGGSVVVF---SMASGRHSTELDFSI
1fc4A           LGAEDAIISDALN-HASIIDGVRLCKAKRYRYANN------DXQELEARLKEARHVLIATDGVFSXDANL
1c8nA           Q---PAWLGTIADNYSKWRWVSLRIIYSPKCPTTTSGTVAMCLSYDRNDVAPGSRVQLSINFPPYAGYDG
1qz9A           ARSPERRVIVTETSNFPTDLYIAEGLADMLQQGYTLRLVDSPEELPQAI--DQDTAVVMLTHVNYKTHDM
1lc5A           SGLKPRRAMIVTPGFAEYGRALAQSGCEIRRWSLREADGWQLTDAILEAL-TPDLDCLFLCTPNNPTPLL
1pmmA           GKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEAC-DENTIGVVPTFGVTYTHDA
1c4kA2          LVSNGDLVL-FDRNNHKSVYNSALAGGRPVYLQTNRNPYGFIGGDPERAKWKRPFRLAVIQTYDGTIYNA
1m32A           ALGPQDKVLIVSNGAYGARXVEGLXGIAHHAYDCGE-VARPDVQAIDAILNADPTISHISETTTGXLNPI
2bkwA1          SKAPNKNVLVTGTFSDRFADCLRSYGAQVDVVRPLKIGESVPLELITEKLSQNSYGAVTVTHSTAVLSDL
2e7iA1          -AKKDAWVVMDENCHYSSYVAAERAGLNIALVPKDYPDYAITPENFAQTIEETKKRGEVVLALIGNLPDV
1wytB1          EGRTRRVVLVPDSAHGSNPATASMAGYQVREIPSGP-EGEVDLEALKRELGPHVAALMLPNTLGLFERRI
1v8dA           L-RFRDPVMVESLKAQAHGGMDILIGMHLRPVAVPLRLSVRKIGEAVLLAAKTRPKLVGARAVYTREEML
1v72A1          MTPPWGNIYCHPASHINNDECGAPEFFSNGAKTVDGPAAKLDIVRLRERTREKVTQPACEVGSIYTLDEI
1svvA           -LRPWEAVIATQLGHISTTGAIEATGHKVVTAPCPDGK--LRVADIESALHENRSEHXVIPKLVGTQYTK
1u08A           LVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQPPHFRVDWQEFAALLS-ERTRLVILNTPHNPSADF
2bwnA1          R-VLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDP-AAPKLIAVYSMDGDFGPI
3bc8A1          KRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEELRTDLKAVEAKIQELGPEHILCLFAPRVPDRL
1bj4A           V-EPHGRIMGLDFMTDKKKISATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKIIAGTSCYSRNLEY
1c7nA           TKPGDGVIIITPVYYPFFMAIKNQERKIIEELLEKDGYYTIDFQKLEKLS-KDKNNKALLFCSPHNPVEL
1vefA1          AHTGRKKFVAAMRGFSGRTMGSLSVTWEPKYREPFLPLVFIPYNDVEALKRAEETAAVILEPVQGEGEFL
1xl7A1          LLGGDPSVRWGDKSYNLISFANGIFGCCCDHAPYDAX-VXVNIAHYVDERVL-ETEGRWKGSEKVRDIPL
1bw0A           ICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPEDWEADLDEIRR-LKDDKTKLLIVTNPSNPCGHV
1agxA           GKPYWFRSSVKKHTNNSEFNIEKIQGDALPGVQIVYGSDNMMPDAYQAFAK-AGVKAIIHAGTSMANYLV
1jg8A           -TQRGDEVILDSHIFWYEVGAMAVLGVMPHP--VPGKNGAMDPDDVRKAIRPRRTSLIAIENTHNRSGNI
1gbnA           GIQKYKAKIVFAAGNFSSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGYL
1vk9A           -----------------------------------------LLRSALKIFE-KKDLSLLAYSGRSGLKPV
1s2bA           ILQTGFDWYGDGTYD---AWYEWEVSITISEGD--------SIQMSVTATSDTSGSATLEGQKVSKSFSN
1gr0A2          -IGPSDHVGWLDDRKWAYVRL---EGRAFGDVPLNLE-YKLEVW--------------------------
1w9gA1          ----------SH-TILLVQPTKRPEGRTYADYE----SVNECMEGVCKMYEE-HLKRMNPNSPSITYDIS
1fg3A           CEPGKDAILYCPPTYGXYSVSAETIGVECRTVPTLDN-WQLDLQGISDKL--DGVKVVYPNNPTGQLINP
1bs0A           -MAKEDRIASHASLLEAASLSPSQL---RRFA-------HNDVTHLARLLASPGQQMVVTEGVFGDSAPL
1elqA           DWHQGDEILLTDCEHPGIIAIVQRFGITYRFFPVAATLNQGDAAAVLANHLGPKTRLVILSHLTGQVLPL
1ei7A           --QQARTVVQRQFSEVPSPQVTVRFPDSDFKVYRYNAVLDPLVTALLGAFDTRNRIIEVETAETLDATRR
2z67A1          RKKYGSNVVIYPKSPI---KAVSFVGXNXRLVELDGDRVYVPVEDIENAIKKEIVLSTLTFFPPRNSDDI
2govA1          FRIPNQFQGSPPAPSDESVKI---EEREGITVYSTQF--GGYAKEADYVAHATQLRTTLYQGDVYYCAGY
1hskA2          ----------------------------------------------------------------------
1kolA2          GVGPGSTVYVAPVGLAAAASARLLGAAVVIVGDLNPA-------------RLAHAKAQGFEIADLSLDTH


                         +         .         .         .         .         *         .:210
query           EALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIA
1o61A           DEIVEICKENDIVLIEDAAEALGSFYK-----NKALGTFGEFGVYSYNGNKIITT-SGGGMLIGKNKEKI
2fn6A1          ESVQKLCKKHSLSFLSDSSHALGSEYQN-----KKVGGFALASVFSFHAIKPITT-AEGGAVVTNDSELH
1b9hA           DALAKISADTGVPLLQDAAHAHGARWQG-----KRVGELDSIATFSFQNGKLMTAGEGGAVVF-PDGETE
1mdoA           DAIYALGERYGIPVIEDAAHATGTSYK------GRHIGARGTAIFSFHAIKNITCAEGGIVVTDNPQFAD
1cl1A           PAIVAAVRSVVPDAIIMIDNTWAAGVLFKALDFGI-----DVSIQAATXYLVGHSDAMIGTAVCNARCWE
1ax4A           SNLKEVYEQHGIFVVMDSARFCENAYFIKARDIFDMYKYADALTMSA---KXDPLLNIGGLVAIR--DNE
1cs1A           AKICHLAREVGAVSVVDNTFLSPALQNPLALGA-------DLVLHSCTXYLNGHSDVVAGVVIAKDPDVV
2hevF1          ----------------------------------------------------------------------
1zb6A1          SVPTSHGDPYATVVFPATGHPVDDLLADTQFAIDGEVTGGFKKTYAFFPTDNMPGVAELSAIPSMPPAVA
1fc4A           KGVCDLADKYDALVXVDDSHAVGFVGENGRGSHEYCDVXGRVDIITGTLGKALGGASGGYTA--------
1c8nA           AAILNTDVTPTSAIYVDVDVTRFDKAWYSTIGTAAFAALTAFDQNQFCPCTVHIGSDGGPAVAVPPGDIF
1qz9A           QALTALSHECGALAIWDLAHSAGAVP------VDLHQAGADYAIGCT--YKYLNGGPGSQAFVWVSPQLC
1lc5A           QAIADRCKSLNINLILDEAFIDFI---PHETGFIPALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDD--
1pmmA           LDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFR-LPRVKSISASGHKFGLAPLGGWVIWRDEEALP
1c4kA2          HEVVKRIGHLCDYIEFDSAWQFIPMMRNSSPLIDDLGPEDPGIIVVQSVHKQQAGFSQTSQIHKKDSHIK
1m32A           DEVGALAHRYGKTYIVDAXSSFGGIPX--------DIAALHIDYLISSANKCIQGVPGFAFVIAREQKLA
2bkwA1          KAISQAIKQTSPFFVVDAVCSIGCEEF----EFDEWGV--DFALTA--SQXAIGAPAGLSISLCSXDYAL
2e7iA1          KKIAKVCSEYDVPLLVNGA--------YAIGRMPVSLKEIGADFIVGSGHKSMAASGPIGVMGMKEEWAE
1wytB1          LEISRLCKEAGVQLYYDGANLNAIMGWARPGDM-------GFDVVHLNLHKTFTVPHGGG----------
1v8dA           KKL-------------------------------------------------------------------
1v72A1          EAIGDVCKSSSLGLHMDGSRFANALVSLGCSPAEMTWKAG-VDALSFGATKNGV--LAAEAIVLFNTSLA
1svvA           QELEDISAEHGLYLFLDGARLAS---ALSSPDLTLADIARLTDXFYIGATKAGGXFG-EALIILNDALKP
1u08A           AALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPIS
2bwnA1          KEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAERDG--LMHRIDIFNGTLAXAYGVFGGYIAASARMVD
3bc8A1          EELAVICANYDIPHVVNNAYGLQSSKCMHLIQQGARVG--RIDAFVQSLDXNFMVPVGGAIIAGFNEP--
1bj4A           ARLRKIADENGAYLMADMAHISG-----------------------------------------------
1c7nA           QKIKDIVLKSDLMLWSDEIH---FDLIMPGYEHTVFQSIDDKTITFTAPSKTFNIAGMGMSNIIIKNPDI
1vefA1          RAAREITQEKGALLILDEIQTGMG---RTGK--RFAFEHFGIVPDILTLAKALGGGVPLGVAVMREEVA-
1xl7A1          PEELVFTVDEKILNDVSQAKA-------------------------------------------------
1bw0A           EDIVRLAEELRLPLFSDEIYAGMGKDPNATFTSVADFETTVPRVILGGTAXNLVVPGWRLGWLLYVDPHG
1agxA           PEVRKLHDEQGLQIVRSSRVAQG---FVLRNAEQPDDKYGWIAAHDLNPQKARLLMALALTKTNDAKEIQ
1jg8A           KEICTIAKEHGINVHIDGARIFNASIA-SGVPVKEYAGYADSVMFCLSXGLCAPV---GSVVVGDRDFIE
1gbnA           MGVRELCTRHQVLFIADEIQTG-----LARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIM
1vk9A           VELFKRFDNLEGSLVIDKXVGKAAASFL-----LKXKPDHIHAKVISKPALKLNEYGQSFSYDEKIPFVL
1s2bA           ESSGSLCRTNAEFIIEDFEECNSNGSDCEFVPFASSPAVEFTDCSVTSDGESVSLDDQITQVIINNQDVT
1gr0A2          ----------------------------------------------------------------------
1w9gA1          QLFDFIDDADLSCLVYRAD---------------------------------------------------
1fg3A           QDFRTLLERGKAIVVADEA---------------------------------------------------
1bs0A           AEIQQVTQQHNGWLMVDDAHGTG-----------------------------------------------
1elqA           AEIMAVQGNYPVRVLVDGAQSAGS----------------------------------------------
1ei7A           VDDTVAIRSAINNLIVE-----------------------------------------------------
2z67A1          VEIAKICENYDIPHIINGAYAIQNN--YYLEKLKKAFKYRVDAVVS-SSDKNLLTPIGGGLVYTDAEFIK
2govA1          DPPMKPYGRRNEVWLVK-----------------------------------------------------
1hskA2          ----------------------------------QGHRIGGVEVSTKHAGFMVNV---DNGTATDYENLI
1kolA2          EQIAALLGEPEVDCAVDAVGFEARGHGHEGAKHEAPATVLNSLMQVTRVAGKIGIPGLYVTEDPGAVDAA


                         .         .         .         +         .         .         .:280
query           EESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPR
1o61A           EKARFYSTQANCLHYEHLDYGYNYRLSNVLGAIGVAQMEVLEQRVLKKREIYEWYKEFLGESFLDLINFD
2fn6A1          EKMKLFRSHGDFFEGEVKSIGHNFRLNEIQSALGLSQLKKAPFLMQKREEAALTYDRIFKDPYFTPLHPL
1b9hA           KYETAFLRHSDDRRYFHKIAGSNMRLNEFSASVLRAQLARLDEQIAVRDERWTLLSRLLGDGVVPQGGDV
1mdoA           KLRSLKFHGLGVDQAEVLAPGYKYNLPDLNAAIALAQLQKLDALNARRAAIAAQYHQAXADLPFQPLSLP
1cl1A           QLRENAYMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPG--SKGHEFW
1ax4A           EIFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEGTE--EEYLHYRIGQVKYLGDRLREAGIPIQYP-
1cs1A           TELAWWANN------------IGVTGGAFDSYLLLRGLRTLVPRMELAQRNAQAIVKYLQTLVKKLYHPS
2hevF1          ----------------------------------------------------------------------
1zb6A1          ENAELFARYGLDTSMDYKKRQVNLYFSELSAQTLEAESVLALVR-----ELGLHVPNELGLKFCK-----
1fc4A           -ARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEXVEAGSELRDRLWANARQFREQXSAAGFTLAGAD
1c8nA           FK--------------------------------------------------------------------
1qz9A           DLVPQPLSGWNGIARYLCGTQPITSLAMVECGLDVFAQTDMASLRRKSLALTDLFIELVEQRCAAHELTL
1lc5A           --------AAMARMRRQQMPWSVNALAALAGEVALQDSAWQQATWHWLREEGARFYQALCQLPLLTVYP-
1pmmA           QELVFNVDYGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEI--AKLGPYEFI
1c4kA2          GQLRYCDHK-------------------------------------------------------------
1m32A           ----------------------------------------------------------------------
2bkwA1          NDSKNGHVHGIXENYEAGKGAYFATPPVQLINSLDVALKEIKRWDLHREXSDWFKDSLVNGLQLTSVSRY
2e7iA1          IVLRRSEKYKNKEVELL---GCTARGATIITLMFPHVRERIKRWDEEVEKARRFAAEM------------
1wytB1          ----------------------------------------------------------------------
1v8dA           ----------------------------------------------------------------------
1v72A1          TEMSYRRKRA------------------------------------------------------------
1svvA           NARHLIKQRGA-----------------------------------------------------------
1u08A           AEIRKVHQYLT--------FSVNTPAQLALADMLRAEPEHYLALPDFYRQKRDILVNALNESRLEIL---
2bwnA1          ------AVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHG
3bc8A1          --------FIQDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKEAHNERLLQ
1bj4A           ----------------------------------------------------------------------
1c7nA           RERFTKSRD------ATSGMPFTTLGYKACEICYKECGKWLDGCIKVIDKNQRIVKDFFEVNHPEIKAPL
1vefA1          ----------RSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPSPKIRE-
1xl7A1          ----------------------------------------------------------------------
1bw0A           NGPS--FLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYL--YNHIGECIGLAPT
1agxA           N---------------------------------------------------------------------
1jg8A           RARKARKMLG------------------------------------------------------------
1gbnA           L---------------------------------------------------------------------
1vk9A           GKDG------------------------------------------------------------------
1s2bA           DCSVSG----------------------------------------------------------------
1gr0A2          ----------------------------------------------------------------------
1w9gA1          ----------------------------------------------------------------------
1fg3A           ----------------------------------------------------------------------
1bs0A           ----------------------------------------------------------------------
1elqA           ----------------------------------------------------------------------
1ei7A           ----------------------------------------------------------------------
2z67A1          EISLSYRASATP----------------------------------------------------------
2govA1          ----------------------------------------------------------------------
1hskA2          HQKTVKEKFG------------------------------------------------------------
1kolA2          AKIGSLSIR-------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSK
1o61A           KNELNACQKDINISQKNITLHPKISKLIEDLKNKQIETRPLWK-AMHTQEVFK--GAKAYLNGNSELFFQ
2fn6A1          LKDK----SSNHLYLMHQKFFTCKKLILESLHKRGILAQVHYK-PIYQYQLYQQL-FNTAPLKSAEDFYH
1b9hA           RADRNSHYMAMFRIPGLTEERRNALVDRLVEAGLPAFFRAIYRTDAFWELGAPDESVDAIACPNTDAISS
1mdoA           SWEHIHAWHLFIIRVDEARCGITRDALXASLKTKGIGTGLHFRAAHTQKYYRE--RFPTLTLPDTEWNSE
1cl1A           KRDFTGSSGLFSFVLKKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPE--HIAAIRPQGEIDFSG
1ax4A           ----------------------------------------------------------------------
1cs1A           LPARQQKGFGAMLSFELDGDEQTLRRFLGGLSLFTLAESLGGVESLISHAATMTHAGMAPEARAAAGISE
2hevF1          ----------------------------------------------------------------------
1zb6A1          -----RSFSVYPTLNWETGKID--------------RLCFAVISPSSDEGDIEKFHNYATKAPYAYVGEK
1fc4A           ----------------------------------------------------------------------
1c8nA           ----------------------------------------------------------------------
1qz9A           VTPREHAKRGS-----------------------------------------------------------
1lc5A           ----------------------------------------------------------------------
1pmmA           CTGRPDEGIPAVCF--------------------------------------------------------
1c4kA2          ----------------------------------------------------------------------
1m32A           ----------------------------------------------------------------------
2bkwA1          PSN-------------------------------------------------------------------
2e7iA1          ----------------------------------------------------------------------
1wytB1          ----------------------------------------------------------------------
1v8dA           ----------------------------------------------------------------------
1v72A1          ----------------------------------------------------------------------
1svvA           ----------------------------------------------------------------------
1u08A           PCEGTYFLLVDY----------------------------------------------------------
2bwnA1          ----------------------------------------------------------------------
3bc8A1          TPHNPISLAMTLK-----TIDGHHDKAVTQLGSMLFTRQVSGARAVPLGNVQTVSGHTFGFMSHADNYPC
1bj4A           ----------------------------------------------------------------------
1c7nA           ----------------------------------------------------------------------
1vefA1          ----------------------------------------------------------------------
1xl7A1          ----------------------------------------------------------------------
1bw0A           MPRGAMYLMSRID---------------------------------------------------------
1agxA           ----------------------------------------------------------------------
1jg8A           ----------------------------------------------------------------------
1gbnA           ----------------------------------------------------------------------
1vk9A           ----------------------------------------------------------------------
1s2bA           ----------------------------------------------------------------------
1gr0A2          ----------------------------------------------------------------------
1w9gA1          ----------------------------------------------------------------------
1fg3A           ----------------------------------------------------------------------
1bs0A           ----------------------------------------------------------------------
1elqA           ----------------------------------------------------------------------
1ei7A           ----------------------------------------------------------------------
2z67A1          ----------------------------------------------------------------------
2govA1          ----------------------------------------------------------------------
1hskA2          ----------------------------------------------------------------------
1kolA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RSLALPMFPELRDDEIKEVVDTIALFL
1o61A           KGICLPSGTAMSKDDVYEISKLI----
2fn6A1          AEISLPCHANLNLESVQNIAHSVLKTF
1b9hA           DCVWLHHRVLLAGPELHATAEIIADAV
1mdoA           RICSLPLFPDXTESDFDRVITALH---
1cl1A           TLIRLHIGLEDVDDLIADLDAGFA---
1ax4A           ---------------------------
1cs1A           TLLRISTGIEDGEDLIADLENGFR---
2hevF1          ---------------------------
1zb6A1          RTLVYGL--------------------
1fc4A           ---------------------------
1c8nA           ---------------------------
1qz9A           ---------------------------
1lc5A           ---------------------------
1pmmA           ---------------------------
1c4kA2          ---------------------------
1m32A           ---------------------------
2bkwA1          ---------------------------
2e7iA1          ---------------------------
1wytB1          ---------------------------
1v8dA           ---------------------------
1v72A1          ---------------------------
1svvA           ---------------------------
1u08A           ---------------------------
2bwnA1          ---------------------------
3bc8A1          AYLNAAAAIGMKMQDVDLFIKRL----
1bj4A           ---------------------------
1c7nA           ---------------------------
1vefA1          ---------------------------
1xl7A1          ---------------------------
1bw0A           ---------------------------
1agxA           ---------------------------
1jg8A           ---------------------------
1gbnA           ---------------------------
1vk9A           ---------------------------
1s2bA           ---------------------------
1gr0A2          ---------------------------
1w9gA1          ---------------------------
1fg3A           ---------------------------
1bs0A           ---------------------------
1elqA           ---------------------------
1ei7A           ---------------------------
2z67A1          ---------------------------
2govA1          ---------------------------
1hskA2          ---------------------------
1kolA2          ---------------------------