[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tmar0:AAD35944.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1fxoA.bssp"
#ERROR : Can't open dsspfile "1fwyA2.bssp"
#ERROR : Can't open dsspfile "1yp2A2.bssp"
#ERROR : Can't open dsspfile "1qwjA.bssp"
#ERROR : Can't open dsspfile "1tzfA.bssp"
#ERROR : Can't open dsspfile "1jykA.bssp"
#ERROR : Can't open dsspfile "2cu2A2.bssp"
#ERROR : Can't open dsspfile "1w55A1.bssp"
#ERROR : Can't open dsspfile "1w77A1.bssp"
#ERROR : Can't open dsspfile "1e5kA.bssp"
#ERROR : Can't open dsspfile "1jv1A.bssp"
#ERROR : Can't open dsspfile "1h3mA.bssp"
#ERROR : Can't open dsspfile "1vpaA.bssp"
#ERROR : Can't open dsspfile "1gq9A.bssp"
#ERROR : Can't open dsspfile "2dpwA1.bssp"
#ERROR : Can't open dsspfile "1fwyA1.bssp"
#ERROR : Can't open dsspfile "2f9cA1.bssp"
#ERROR : Can't open dsspfile "1i19A1.bssp"
#ERROR : Can't open dsspfile "1qq0A.bssp"
#ERROR : Can't open dsspfile "1j2zA.bssp"

## Summary of PDB Search
:355
    1e-66  37%  1fxoA  [c.68.1.6] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    1e-46  24%  1fwyA2 [c.68.1.5] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE A:3 --
    9e-42  25%  1yp2A2 [c.68.1.6] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    1e-39  14%  1qwjA  [c.68.1.13] CYTIDINE MONOPHOSPHO-N-ACETYLNEURAMINIC ACID
    4e-38  19%  1tzfA  [c.68.1.13] GLUCOSE-1-PHOSPHATE CYTIDYLYLTRANSFERASE
    7e-37  27%  1jykA  [c.68.1.13] CTP:PHOSPHOCHOLINE CYTIDYLYTRANSFERASE
    6e-33  23%  2cu2A2 [c.68.1.20] PUTATIVE MANNOSE-1-PHOSPHATE GUANYLYL A:1 -- 268
    1e-32  18%  1w55A1 [c.68.1.13] ISPD/ISPF BIFUNCTIONAL ENZYME A:3 -- 207
    6e-32  16%  1w77A1 [c.68.1.13] 2C-METHYL-D-ERYTHRITOL 4-PHOSPHATE A:75 -- 300
    5e-30  12%  1e5kA  [c.68.1.8] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    2e-28  13%  1jv1A  [c.68.1.5] GLCNAC1P URIDYLTRANSFERASE ISOFORM 1: AGX1
    1e-26  17%  1h3mA  [c.68.1.13] 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE
    2e-20  24%  1vpaA  [c.68.1.13] 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE
    3e-08  22%  1gq9A  [c.68.1.13] 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE
    8e-07  31%  2dpwA1 [c.68.1.19] HYPOTHETICAL PROTEIN TTHA0179 A:1 -- 231
    1e-06  24%  1fwyA1 [b.81.1.4] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE A:252
    3e-05  19%  2f9cA1 [b.81.1.7] HYPOTHETICAL PROTEIN YDCK A:3 -- 322
    4e-05   6%  1i19A1 [d.58.32.3] CHOLESTEROL OXIDASE A:274 -- 613
    4e-04  18%  1qq0A  [b.81.1.5] CARBONIC ANHYDRASE
    7e-04  22%  1j2zA  [b.81.1.1] ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-
:355

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKAIVLCAGKGTRLRPLTFTTAKHLIPIANKPILFYSLENIARAGIEEVGIVVSPHNAEEFKSIVGTGE
1fxoA           -RKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGS
1fwyA2          AMSVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGAAHV-HLVYGHGGDLLKQALKDDN
1yp2A2          ---------GIILRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQ-FNSASLNRHLSRAY
1qwjA           --AALVLARGGSKGIPL------KNIKRLAGVPLIGWVLRAALDAGVFQS-VWVSTDHDEIENVAKQFGA
1tzfA           MAKAVILAGGLGVKPKPM--------VEIGGKPILWHIMKMYSVHGIKDFIICCGYKGYVIKEMEVHHKR
1jykA           --KAIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIVG-YLKEQFDYL---KE
2cu2A2          MKYALVMAGGRGERLWPLSREDPKPFLPLEGKTLLEATLERLAPLVPPERTLLAVRRDQEAVA------R
1w55A1          --SLIMLAAGNSTRFNTKV---KKQFLRLGNDPLWLYATKNLSSFYPFKKIVVTSSNITYMKKFT-----
1w77A1          --SVILLAGGSMP----------KQYIPLLGQPIALYSFFTFSRMPEVKEIVVVCDPFFRDIFEE----Y
1e5kA           MTTGVVLAGGKARRMGGV----DKGLLELNGKPLWQHVADALMTQLSHVVVNANRHQ---------EIYQ
1jv1A           KVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQAERILKLQQVAEKYYTSGRTMESTKEFFTKHK
1h3mA           LDCAVVPAACP------------KQYLSIGNQTILEHSVHALLAHPVKRVVIAISPGDSRFAQ------L
1vpaA           MNVAILLAAGKGERMSE---NVPKQFLEIEGRMLFEYPLSTFLKSAIDGVVIVTRREWFEVVE------K
1gq9A           -KAVIVIPARYGSRLP------GKPLLDIVGKPMIQHVYERALQAGVAEV-WVATDD--PRVEQAV---Q
2dpwA1          ---AIVLAGGKEAWAERFGVGS-KALVPYRGRPXVEWVLEALYAAGLSPVYVGENP--------------
1fwyA1          ----------------------------------------------------------------------
2f9cA1          ----------------------------------------------------------------------
1i19A1          ----------------------------------------------------------------------
1qq0A           ----------------------------------------------------------------------
1j2zA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NFGLRISYIIQEEPKGLAHAVWVSREFLGDEDFMMYLGDNLILEDLGKFVKDFENSDYAASILLSPVKDP
1fxoA           NWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYHDFHELLGSASQRQTGASVFAYHVLDP
1fwyA2          -----LNWVLQAEQLGTGHAMQQAAPFFADEDILMLYGDVLISVETLQRLRDAKP-QGGIGLLTVKLDDP
1yp2A2          AEGFVEVLAAQQSPEGTADAVRQYLWLFEELEYLILAGDHLYRMDYEKFIQAHRETDADITVAALPMKRA
1qwjA           QVH-RRSSETSKDSSTSLDAIVEFLNYHNEVDIVGNIQATSPCTDLQKVAEMIREEG-YDSVFSVVRRHQ
1tzfA           VEPWNVTLVDTGDSSMTGGRLKRVAEYVKDDEAFLFTYGDGVADLDIKATIDFHK-AHGKKATLTATFPP
1jykA           KYGVRLVFNDKYADYNNFYSLYLVKEELA-NSYVI-DADNYLFKN--XFRNDLTRSTYFSVY----REDC
2cu2A2          PYADGIRLLLEPLGRDTAGAVLLGVAKEGAERLLVLPADHYVGDDEAYRMLEAAEEGFVVALGLRPTRPE
1w55A1          -----KNYEFIEGGDTRAESLKKALELIDSEFVMVSDVARVLVSKNLFDRLIENLDKADCITPALKVADT
1w77A1          EESIDVDLRFAIPGKERQDSVYSGLQEIDVNSELVCIHDSARPLVNTEDVEKVLKDGSAVGAAVLGVPAK
1e5kA           ASGLKVIEDSLADYPGPLAGMLSVMQQEAGEWFLFCPCDTPYIPPDLAARLNHQRKDAPVVWVHDGERDH
1jv1A           YFGLKKENV-IFFQQGMLPAMSFDGKIILEEKAPDGNGGLYRALAAQNIVEDMEQRGIWSIHVLVKVADP
1h3mA           PLANHPQITVVDGGDERADSVLTGLKAAGDAQWVLVHDAACLHQDDLARLLALSETSRTGGILAAPVRDT
1vpaA           RVFHEKVLGIVEGGDTRSQSVRSALEFLEKFSPSYVLARPFLRKKHVSEVLRRAR-ETGAATLALKNSDA
1gq9A           AFGGKAIMTRNDHESGTDRLVEVM-HKVEADIYINLQGDEPMIRDVETLLQGMRDATLCHAISAAEAAEP
2dpwA1          ----------------------------------------------------------------------
1fwyA1          ----------------------------------------------------------------------
2f9cA1          ----------------------------------------------------------------------
1i19A1          ----------------------------------------------------------------------
1qq0A           ----------------------------------------------------------------------
1j2zA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TRFGVAVMEGDRVIKVVEKPKTPPSNLAIVGLYLFRNKIFEGIKNIKPSWRGELEITDAIEYLIEKGEKV
1fxoA           ERYGVVEFQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLS
1fwyA2          TGYGRITRENGKVTGIVEHKDATDEQRQITGILIANGADMKLAKLTNNNAQGEYYITDIIALAYQEGREI
1yp2A2          TAFGLMKIEEGRIIEFAEKPQGEQLQIASMGIYVISKDVMLNL--LRDKFPGANDFSEVIPGATSLGMRV
1qwjA           FRWSEIQKVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMG------------YLQGGKMA
1tzfA           GRFGALDIQAGQVRSFQEKPKGDG-AMINGGFFVLNPSVIDLIDNDATTWEQEPLMTLA------QQGEL
1jykA           TNEWFLVYDDYKVQDIIVDSK---AGRILSGVSFWDAPTAEKIVSFIDKAYVSGEFVD------------
2cu2A2          TEYGYIRLGPRRGEGFVEKPSYAEAYVWNGGVFAFAPATMELFRRHLPSHHEALERLLAGASVMEKAERV
1w55A1          TLFDNEALQREKIKLIQ-------------TPQISK------TKLLKKALDQNLEFTDDSTAIAAMGGKI
1w77A1          ATIKEVNSDSLVTLWEMQTPQVI--------------KPELLKKGFELVKSEGLEVTDVSIVEYL-KHPV
1e5kA           PTIALVNRAIELLLEYLQAGERRVMVFAGGHAVDFSDHKDAFVNVNTPEELARWQ---------------
1jv1A           RFIGFCIQKGAQVVEYSEISLATAQKRSSDGRLLFNAGNIANHFFTVPFLRDVVNVYEPQLQHHVAQKKI
1h3mA           MKRAEP--GKNAIAHTVDRNGLWHAL----TPQFFPRELLH--DCLTRALNEGATITDEASALEYCGFHP
1vpaA           ----LVRVENDRIEYIPRK-----GVYRILTPQAFSYEI------LKKAHENGGEWADDTEPVQKLGVKI
1gq9A           STVKVVVNTRQDALYFSRSPAEKARYLKHVGIYAYRRDVLQNYSQLPESM---PEQAESLEQLMNAGINI
2dpwA1          ----------------------------------------------------------------------
1fwyA1          ----------------------------------------------------------------------
2f9cA1          ----------------------------------------------------------------------
1i19A1          ------------------------------QSYTDIPWRELFAPKGADGRTFE----KFVAESGGAEAIW
1qq0A           ----------------------------------------------------------------------
1j2zA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RGYIVYGWWKDTGKPEDLLEANRKIXXXXXXXXXXXXDDKSSIQGPVRIGKASKIVNSVIRGPAVIGENC
1fxoA           VEIMGRGYWLDTGTHDSLLEAGQFI---------------------------------------------
1fwyA2          VAVHPQRLSEVEGNRLQLSRLER-----------------------------------------------
1yp2A2          QAYLYDGYWEDIGTIEAFYNANLGI---------------------------------------------
1qwjA           YYEMRAEHSVDIDVDIDWPIAEQ-----------------------------------------------
1tzfA           MAFEHPGFWQPMDTLRDKVYLEG-----------------------------------------------
1jykA           ----------------------------------------------------------------------
2cu2A2          RVVLGRFPWDDVGNWRALERVFSQ----------------------------------------------
1w55A1          WFVEGEENARKLTFKEDLKKLDL-----------------------------------------------
1w77A1          YVSQGSYTNIKVTTPDDLLLAER-----------------------------------------------
1e5kA           ----------------------------------------------------------------------
1jv1A           PYVDTQGQLIKEKFVFDIFQFAKKFVVYEVLREDEFSPLKNADSQNGKDNPTTARHALMLNAGGHFIDEN
1h3mA           QLVEGRADNIKVTRPEDLALAEF-----------------------------------------------
1vpaA           A--LVPLCFKVT-FKEDLELARI-----------------------------------------------
1gq9A           RTFEV-----------------------------------------------------------------
2dpwA1          ----------------------------------------------------------------------
1fwyA1          --------------------------------------------------------RFDLRGTLTHGRDV
2f9cA1          -------------------------------------TGNARITQPCTLYNNVRIGDNVWIDRADISDGA
1i19A1          YPFTEKPWMKVWTVSPS--LVGKPPQAREVSGPYNYIFSDNLPEPITDMIGAINAEITKLGLAATNANDW
1qq0A           -------------------------------------DEFSNIRENPVTPWNPEPSAPVIDPTAYIDPQA
1j2zA           -----------------------------------------------KIAK-----TAIISPKAEINKGV


                         .         *         .         .         .         .         +:350
query           FIKNSYVGPYSSIGNRVILEDCEVENSIVMDECSITGVEKRIDSSILGKGVSVKGSQxxxxxxxxxxxxx
1fxoA           ----------------------------------------------------------------------
1fwyA2          ----------------------------------------------------------------------
1yp2A2          ----------------------------------------------------------------------
1qwjA           ----------------------------------------------------------------------
1tzfA           ----------------------------------------------------------------------
1jykA           ----------------------------------------------------------------------
2cu2A2          ----------------------------------------------------------------------
1w55A1          ----------------------------------------------------------------------
1w77A1          ----------------------------------------------------------------------
1e5kA           ----------------------------------------------------------------------
1jv1A           GPAIPRLKDANDVPIQCEISPLGEGLESYVADKEFHAPL-IIDENGVHELV-------------------
1h3mA           ----------------------------------------------------------------------
1vpaA           ----------------------------------------------------------------------
1gq9A           ----------------------------------------------------------------------
2dpwA1          ----------------------------------------------------------------------
1fwyA1          EITNVIIEGNVTLGHRVIGTGCVIKNSVIGDDCEI-SPYTVVEDANLAAACTI-----------------
2f9cA1          RIDNVTIQSSSVREECAIYGDARVLNQILAIQGLTHEHAQILDRATVNHSRIVHQVQ-------------
1i19A1          GWSKDVQFYIKATTLRLTEGGGAVSRANIATVIND-----------------------------------
1qq0A           VIGEVTIGANVMVSPMASIRSDEGMPIFVGDRS-------------------------------------
1j2zA           EIEFCVIGDGVKLDEGVKLHNN------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxx
1fxoA           -----
1fwyA2          -----
1yp2A2          -----
1qwjA           -----
1tzfA           -----
1jykA           -----
2cu2A2          -----
1w55A1          -----
1w77A1          -----
1e5kA           -----
1jv1A           -----
1h3mA           -----
1vpaA           -----
1gq9A           -----
2dpwA1          -----
1fwyA1          -----
2f9cA1          -----
1i19A1          -----
1qq0A           -----
1j2zA           -----