[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tmar0:AAD36465.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vq0A1.bssp"
#ERROR : Can't open dsspfile "1vzyA1.bssp"
#ERROR : Can't open dsspfile "1hw7A.bssp"
#ERROR : Can't open dsspfile "1vq0A2.bssp"
#ERROR : Can't open dsspfile "1xjhA.bssp"

## Summary of PDB Search
:290
    2e-85 100%  1vq0A1 [d.193.1.1] 33 KDA CHAPERONIN A:1 -- 230
    1e-65  39%  1vzyA1 [d.193.1.1] 33 KDA CHAPERONIN A:1 -- 233
    9e-54  24%  1hw7A  [d.193.1.1] HEAT SHOCK PROTEIN HSP33
    7e-17  86%  1vq0A2 [g.81.1.1] 33 KDA CHAPERONIN A:231 -- 287
    3e-14  31%  1xjhA  [g.81.1.1] 33 KDA CHAPERONIN
:290

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIYYGTMFDHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAALVTPWLAEKERWTLDIEGNGPI
1vq0A1          MIYYGTMFDHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAALVTPWLAEKERWTLDIEGNGPI
1vzyA1          -LVKALAYDGKVRAYAARTTDMVNEGQRRHGTWPTASAALGRTMTASLMLGAMLKGDDKLTVKIEGGGPI
1hw7A           -LHRYLFENFAVRGELVTVSETLQQILENHDYPQPVKNVLAELLVATSLLTATLKFDGDITVQLQGDGPM
1vq0A2          ----------------------------------------------------------------------
1xjhA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIGQGVLRVVRDLGLKTPFVSQVPLVSGEIAEDL
1vq0A1          RRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIGQGVLRVVRDLGLKTPFVSQVPLVSGEIAEDL
1vzyA1          GAIVADANAKGEVRAYVSNPQVHFDLNAAGKLDVRRAVGNGTLSVVKDLGLREFFTGQVEIVSGELGDDF
1hw7A           NLAVINGNNNQQMRGVARVQ-GEIPENA----DLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL
1vq0A2          ----------------------------------------------------------------------
1xjhA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AYYFAVSEQIPSAFSIGVLVDSDGVKIAGGFAVQIIDRTLEQEKVEMIEKNIKNLPSISKLFQEAEPLDV
1vq0A1          AYYFAVSEQIPSAFSIGVLVDSDGVKIAGGFAVQIIDRTLEQEKVEMIEKNIKNLPSISKLFQEAEPLDV
1vzyA1          TYYLVSSEQVPSSVGVGVLVNPDNILAAGGFIIQLMPGT-DDETITKIEQRLSQVEPISKLIQKGTPEEI
1hw7A           EDYFMRSEQLPTRLFIRT-GDVDGKPAAGGMLLQVMAQNAQQDDFDHLATLTETIKTEELLTLPAN--EV
1vq0A2          ----------------------------------------------------------------------
1xjhA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LERIFGEKVGFVETAEIKYKCDCNREKAKNALLVLDKKELEDMRKEGKGEVVCKWCNTRYVFSXXXXXXX
1vq0A1          LERIFGEKVGFVETAEIKYK--------------------------------------------------
1vzyA1          LEEVLGEKPEILETMPVRF---------------------------------------------------
1hw7A           LWRLYHEEVTVYDPQDVEFKCTC-----------------------------------------------
1vq0A2          --------------------CDCNREKAKNALLVLDKKELEDMRKEGKGEVVCKWCNTRYVFSEEELEEL
1xjhA           ---------------DVEFKCTCSRERCADALKTLPDEEVDSILAEGEIDMHCDYCGNHYLFN-------


                         .         *         .         .         .         .         +:350
query           XKFKVDDxxx
1vq0A1          ----------
1vzyA1          ----------
1hw7A           ----------
1vq0A2          LKFKVDD---
1xjhA           ----------