[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tmar0:AAD36720.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1azyA2.bssp"
#ERROR : Can't open dsspfile "1kgzA2.bssp"
#ERROR : Can't open dsspfile "1gofA1.bssp"
#ERROR : Can't open dsspfile "1azyA1.bssp"
#ERROR : Can't open dsspfile "1gxbA1.bssp"
#ERROR : Can't open dsspfile "1azyA3.bssp"
#ERROR : Can't open dsspfile "1kgzA1.bssp"
#ERROR : Can't open dsspfile "1gxbA2.bssp"
#ERROR : Can't open dsspfile "1brwA3.bssp"

## Summary of PDB Search
:434
    4e-98  46%  1azyA2 [c.27.1.1] THYMIDINE PHOSPHORYLASE A:71 -- 335
    1e-21  22%  1kgzA2 [c.27.1.1] ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE A:81 --
    5e-16   5%  1gofA1 [b.1.18.2] GALACTOSE OXIDASE A:538 -- 639
    9e-14  35%  1azyA1 [a.46.2.1] THYMIDINE PHOSPHORYLASE A:1 -- 70
    2e-13  20%  1gxbA1 [a.46.2.1] ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE A:1 --
    3e-11  32%  1azyA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:336 -- 440
    1e-10  27%  1kgzA1 [a.46.2.1] ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE A:12 --
    7e-10  26%  1gxbA2 [c.27.1.1] ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE A:71 --
    3e-09  41%  1brwA3 [d.41.3.1] PROTEIN (PYRIMIDINE NUCLEOSIDE PHOSPHORYLASE)
:434

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRAYDVILKKRNGEKLSREEIEFMVGGYVKGEIPDYQMAAFLMAVYFRHLDXXXXXXXXXXMMRSGEVLD
1azyA2          ----------------------------------------------------------------------
1kgzA2          ----------------------------------------------------------------------
1gofA1          --------------------------LATRPKITRTSTQSVKVGGRITISTDSSISKASLIRYGTATHTV
1azyA1          FLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVL-
1gxbA1          MNINEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAMRELAIKID
1azyA3          ----------------------------------------------------------------------
1kgzA1          ----PILEKLFKSQSMTQEESHQLFAAIVRGELEDSQLAAALISMKMR----------------------
1gxbA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LSEIPGTKVDKHSTGGVGDKTTLVVAPLVASAGVPVAKMSGRALGHTGGTIDKLESIPGFRTELSLEEFI
1azyA2          ---LNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFR
1kgzA2          --------ADIVGTGGDGTNSSTASAFVAASCGAKVAKHGNRS----AGSCDLLQAF-GIRLDMSAEDSR
1gofA1          NTDQRRI-PLTLTNNGGNSYSDSGVALPGYWMLFVMNSAGVPSVA-------------------------
1azyA1          ----------------------------------------------------------------------
1gxbA1          ----------------------------------------------------------------------
1azyA3          ----------------------------------------------------------------------
1kgzA1          ----------------------------------------------------------------------
1gxbA2          ------------TAGGLGTVNVSTASAILLSLVNPVAKHGNRAVSGKSGSADVLEAL-GYNIIVPPERAK
1brwA3          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KNVKKYGIAIVGQTGNLVPADKKIYALRDATATVDEISLIASSIMSKKLAGGSDAFVLDVKFGTGAFMKG
1azyA2          EIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPT
1kgzA2          QALDDLNVCFLFAP-QYHTGFRHAMPVRQQLKTRTIFNVLG------PLINPARP---------PKALIG
1gofA1          ----------------------------------------------------------------------
1azyA1          ----------------------------------------------------------------------
1gxbA1          ----------------------------------------------------------------------
1azyA3          ----------------------------------------------------------------------
1kgzA1          ----------------------------------------------------------------------
1gxbA2          ELVNKTNFVFLFAQ-YYHPAMKNVANVRK-----------------------------------------
1brwA3          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FEDAKKLAFLMLRIAQQHGKKAVAVLSNMDQPLGKAVGNSLEVIEAIETLKGNGPEDLKELSLTLGALML
1azyA2          YELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGERNPRLFDVTMALCVEML
1kgzA2          VYS-PELVLPIAQALKVLGYKNAAVVGGMDYSLNALQGGTPEENRDIRLLQGKGDAAHARQVAANVALLL
1gofA1          ----------------------------------------------------------------------
1azyA1          ----------------------------------------------------------------------
1gxbA1          ----------------------------------------------------------------------
1azyA3          ----------------------------------------------------------------------
1kgzA1          ----------------------------------------------------------------------
1gxbA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ELAGVADFEEGKKILQEKLETGEALDKFRLLVKAQGGNERVVDDPWRVLPxAEQVVEFSAAREGFVSKID
1azyA2          ISGKLADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLP--------------------
1kgzA2          KLFGQDNLRHNAQLALETIRSGTAFERVTALA--------------------------------------
1gofA1          ----------------------------------------------------------------------
1azyA1          ----------------------------------------------------------------------
1gxbA1          ----------------------------------------------------------------------
1azyA3          ---------------------------------------------------AMLTKAVYADTEGFVSEMD
1kgzA1          ----------------------------------------------------------------------
1gxbA2          ----------------------------------------------------------------------
1brwA3          -----------------------------------------------------------AAADGYVAEMA


                         .         .         .         .         *         .         .:420
query           AEKVGIASMMLGAGRKKKEDRIDHSVGIIVEKKLGDSVKKGEAIARLFVSDRSDVESALKLLKEAYVISD
1azyA2          ----------------------------------------------------------------------
1kgzA2          ----------------------------------------------------------------------
1gofA1          ----------------------------------------------------------------------
1azyA1          ----------------------------------------------------------------------
1gxbA1          ----------------------------------------------------------------------
1azyA3          TRALGMAVVAMGGGRRQASDTIDYSVGFTDMARLGDQVDGQRPLAVIHAKDENNWQEAAKAVKAAIKLAD
1kgzA1          ----------------------------------------------------------------------
1gxbA2          ----------------------------------------------------------------------
1brwA3          ADDIGTAAMWLGAGRAKKEDVIDLAVGIVLHKKIGDRVQKGEALATIHSNRPDVLDVKEKIEAA-IRLSP


                         .         .         +         .         .         .         .:490
query           SPSEPPRVVEEVIK
1azyA2          --------------
1kgzA2          --------------
1gofA1          --------------
1azyA1          --------------
1gxbA1          --------------
1azyA3          KAPESTPTVYRRIS
1kgzA1          --------------
1gxbA2          --------------
1brwA3          QPVARPPLIYETI-