[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tmar0:AAD36835.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cr3A1.bssp"
#ERROR : Can't open dsspfile "1un8A1.bssp"
#ERROR : Can't open dsspfile "1pzxA.bssp"

## Summary of PDB Search
:497
    1e-32  20%  3cr3A1 [a.208.1.1] PTS-DEPENDENT DIHYDROXYACETONE KINASE, ADP- A:1
    4e-23  19%  1un8A1 [a.208.1.1] DIHYDROXYACETONE KINASE A:336 -- 550
    7e-04  13%  1pzxA  [c.119.1.1] HYPOTHETICAL PROTEIN APC36103
:497

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxPVPDGDTGSNMCSTMLEACKYIDNVKSDDLIEVWKAVKEGALMGARGNSGVILSQILRGMADASPREY
3cr3A1          --PIGDGDHGANXARGXSETXKALEVSNFGNVSEIFKKVAXTLXSKVGGASGPLYGSAFLAXSKT----A
1un8A1          ---VGDGDTGSTFAAAAREIASLLHRQQLNNLATLFALIGERLTVVMGGSSGVLMSIFFTAAGQKLE---
1pzxA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ITPADFVKMISNARKVAYSAVMRPVEGTMLTVVRVLDERLQGKNFETFEELFDWIVEIARDTVNRTPHML
3cr3A1          IETLDTSELIYAGLEAIQKGKAQVGEKTXVDIWSAFLNDLQTDSA---------SKDNLEKVVKASAGLL
1un8A1          -QGANVVEALNTGAQMKFYGGADEGDRTMIDALQPALTSLAQPKNLQAA--FD--AAQAGAERTCLSSKA
1pzxA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QKLREAGVVDAGAKGLYYIFEGMRDAVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cr3A1          ATKRSIGHIDPGTQSSAYLFETLLEVV-------------------------------------------
1un8A1          NAESLLGNMDPGAQRLAMVFKALAES--------------------------------------------
1pzxA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cr3A1          ----------------------------------------------------------------------
1un8A1          ----------------------------------------------------------------------
1pzxA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNVLLTAKQIAEAF
3cr3A1          ----------------------------------------------------------------------
1un8A1          ----------------------------------------------------------------------
1pzxA           ---------------------------------------------------------TAMAVRSELLDEY


                         .         .         .         .         *         .         .:420
query           DDRRVIVVPTSFVQECVAAMVEYDPDAEPEDLLKRFEEAISQCVPISVTRAVRDSRYGNRRIRKGEYLLF
3cr3A1          ----------------------------------------------------------------------
1un8A1          ----------------------------------------------------------------------
1pzxA           PEFRLTIIDSKCASLGQGLAVMKKQNTPYNLLCETIESYCRHMTVDNLDYLARGGRISNIKVEDGAL---


                         .         .         +         .         .         .         .:490
query           VRKELVSHGFSLVKVLKEALEKENAHEKEILTVFLGDNYRKPELEKIQKLIGEEFPNLDLEIYEGGxxxx
3cr3A1          ----------------------------------------------------------------------
1un8A1          ----------------------------------------------------------------------
1pzxA           ---IPLEKWRGRKKVLKRMVEGERGDDLQKQTIGISHADDEETALELKQMIEETHGCTRFFLSDIG----


                         *         .         .         .         .         +         .:560
query           xxxxxxx
3cr3A1          -------
1un8A1          -------
1pzxA           -------