[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tmar0:AAD36879.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1o13A.bssp"
#ERROR : Can't open dsspfile "1eo1A.bssp"

## Summary of PDB Search
:124
    5e-36  99%  1o13A  [c.55.5.1] PROBABLE NIFB PROTEIN
    2e-22  31%  1eo1A  [c.55.5.1] HYPOTHETICAL PROTEIN MTH1175
:124

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIV
1o13A           -IIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIV
1eo1A           MKIAIASSGT-DLGSEVSRFFGRAPYFMIVEMKKGNIESSEVIENPSASASGGARTAQIIANNGVKAVIA


                         .         .         *         .         .         .         .:140
query           RGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQLKDxxxxxxxxxxxxxx
1o13A           RGIGRRAIAAFEAXGVKVIKGASGTVEEVVNQYLSGQ-----------------
1eo1A           SSPGPNAFEVLNELGIKIYRATGTSVEENLKLFTEGNLEE--------------