[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS80359.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1eu8A.bssp"
#ERROR : Can't open dsspfile "2ghbB.bssp"
#ERROR : Can't open dsspfile "2ghbA.bssp"
#ERROR : Can't open dsspfile "2ghaB.bssp"
#ERROR : Can't open dsspfile "2ghaA.bssp"
#ERROR : Can't open dsspfile "2fncA.bssp"
#ERROR : Can't open dsspfile "1urgA.bssp"
#ERROR : Can't open dsspfile "1urdB.bssp"
#ERROR : Can't open dsspfile "1urdA.bssp"
#ERROR : Can't open dsspfile "1ursB.bssp"
#ERROR : Can't open dsspfile "1ursA.bssp"
#ERROR : Can't open dsspfile "2zyoA.bssp"
#ERROR : Can't open dsspfile "2zynA.bssp"
#ERROR : Can't open dsspfile "2zymA.bssp"
#ERROR : Can't open dsspfile "2gh9A.bssp"
#ERROR : Can't open dsspfile "1ziuA.bssp"
#ERROR : Can't open dsspfile "2zxtA.bssp"
#ERROR : Can't open dsspfile "1y4cA.bssp"
#ERROR : Can't open dsspfile "1nmuA.bssp"
#ERROR : Can't open dsspfile "3a3cA.bssp"
#ERROR : Can't open dsspfile "1n3wA.bssp"
#ERROR : Can't open dsspfile "1ytvA.bssp"
#ERROR : Can't open dsspfile "2vgqA.bssp"
#ERROR : Can't open dsspfile "2v93A.bssp"
#ERROR : Can't open dsspfile "1t0kA.bssp"
#ERROR : Can't open dsspfile "1svxB.bssp"
#ERROR : Can't open dsspfile "1r6zZ.bssp"
#ERROR : Can't open dsspfile "1r6zA.bssp"
#ERROR : Can't open dsspfile "1r6zP.bssp"
#ERROR : Can't open dsspfile "2ok2A.bssp"
#ERROR : Can't open dsspfile "2obgA.bssp"
#ERROR : Can't open dsspfile "1laxA.bssp"
#ERROR : Can't open dsspfile "3h3gA.bssp"
#ERROR : Can't open dsspfile "1fqaA.bssp"
#ERROR : Can't open dsspfile "1ezoA.bssp"
#ERROR : Can't open dsspfile "3ehtA.bssp"
#ERROR : Can't open dsspfile "3ehsA.bssp"
#ERROR : Can't open dsspfile "3csgA.bssp"
#ERROR : Can't open dsspfile "3csbA.bssp"
#ERROR : Can't open dsspfile "3c4mB.bssp"
#ERROR : Can't open dsspfile "3c4mA.bssp"
#ERROR : Can't open dsspfile "1anfA.bssp"
#ERROR : Can't open dsspfile "1nl5A.bssp"
#ERROR : Can't open dsspfile "1a7lC.bssp"
#ERROR : Can't open dsspfile "1a7lB.bssp"
#ERROR : Can't open dsspfile "1a7lA.bssp"
#ERROR : Can't open dsspfile "1mpbA.bssp"
#ERROR : Can't open dsspfile "1mdqA.bssp"
#ERROR : Can't open dsspfile "1mh4A.bssp"
#ERROR : Can't open dsspfile "1mh3A.bssp"
#ERROR : Can't open dsspfile "1mg1A.bssp"
#ERROR : Can't open dsspfile "3iowC.bssp"
#ERROR : Can't open dsspfile "3iowB.bssp"
#ERROR : Can't open dsspfile "3iowA.bssp"
#ERROR : Can't open dsspfile "3iovC.bssp"
#ERROR : Can't open dsspfile "3iovB.bssp"
#ERROR : Can't open dsspfile "3iovA.bssp"
#ERROR : Can't open dsspfile "3iouB.bssp"
#ERROR : Can't open dsspfile "3iouA.bssp"
#ERROR : Can't open dsspfile "3iotC.bssp"
#ERROR : Can't open dsspfile "3iotB.bssp"
#ERROR : Can't open dsspfile "3iotA.bssp"
#ERROR : Can't open dsspfile "3iorC.bssp"
#ERROR : Can't open dsspfile "3iorB.bssp"
#ERROR : Can't open dsspfile "3iorA.bssp"
#ERROR : Can't open dsspfile "1hsjA.bssp"
#ERROR : Can't open dsspfile "3g7wA.bssp"
#ERROR : Can't open dsspfile "3g7vC.bssp"
#ERROR : Can't open dsspfile "3g7vA.bssp"
#ERROR : Can't open dsspfile "3ef7A.bssp"
#ERROR : Can't open dsspfile "3d4gE.bssp"
#ERROR : Can't open dsspfile "3d4gD.bssp"
#ERROR : Can't open dsspfile "3d4gA.bssp"
#ERROR : Can't open dsspfile "3d4cA.bssp"
#ERROR : Can't open dsspfile "3dm0A.bssp"
#ERROR : Can't open dsspfile "1jvxA.bssp"
#ERROR : Can't open dsspfile "1mdp1.bssp"
#ERROR : Can't open dsspfile "3iouC.bssp"
#ERROR : Can't open dsspfile "2w7yA.bssp"
#ERROR : Can't open dsspfile "3f5fA.bssp"
#ERROR : Can't open dsspfile "2i58A.bssp"
#ERROR : Can't open dsspfile "2hq0A.bssp"
#ERROR : Can't open dsspfile "2heuB.bssp"
#ERROR : Can't open dsspfile "2heuA.bssp"
#ERROR : Can't open dsspfile "3ehuA.bssp"
#ERROR : Can't open dsspfile "2hfbB.bssp"
#ERROR : Can't open dsspfile "2hfbA.bssp"
#ERROR : Can't open dsspfile "1iudA.bssp"
#ERROR : Can't open dsspfile "1jvyA.bssp"
#ERROR : Can't open dsspfile "1eljA.bssp"
#ERROR : Can't open dsspfile "2nvuB.bssp"
#ERROR : Can't open dsspfile "2z8dB.bssp"
#ERROR : Can't open dsspfile "2z8dA.bssp"
#ERROR : Can't open dsspfile "2vozB.bssp"
#ERROR : Can't open dsspfile "2vozA.bssp"

## Summary of PDB Search
:417
    1e-17  32%  1eu8A  [c.94.1] TREHALOSE/MALTOSE BINDING PROTEIN
    6e-13  30%  2ghbB  [x.x.x] MALTOSE ABC TRANSPORTER, PERIPLASMIC MALTOSE-
    6e-13  30%  2ghbA  [x.x.x] MALTOSE ABC TRANSPORTER, PERIPLASMIC MALTOSE-
    6e-13  30%  2ghaB  [x.x.x] MALTOSE ABC TRANSPORTER, PERIPLASMIC MALTOSE-
    6e-13  30%  2ghaA  [x.x.x] MALTOSE ABC TRANSPORTER, PERIPLASMIC MALTOSE-
    8e-13  27%  2fncA  [x.x.x] MALTOSE ABC TRANSPORTER, PERIPLASMIC MALTOSE-
    7e-12  26%  1urgA  [c.94.1] MALTOSE-BINDING PROTEIN
    7e-12  26%  1urdB  [c.94.1] MALTOSE-BINDING PROTEIN
    7e-12  26%  1urdA  [c.94.1] MALTOSE-BINDING PROTEIN
    9e-12  27%  1ursB  [c.94.1] MALTOSE-BINDING PROTEIN
    9e-12  27%  1ursA  [c.94.1] MALTOSE-BINDING PROTEIN
    3e-11  27%  2zyoA  [x.x.x] SOLUTE-BINDING PROTEIN
    3e-11  27%  2zynA  [x.x.x] SOLUTE-BINDING PROTEIN
    3e-11  27%  2zymA  [x.x.x] SOLUTE-BINDING PROTEIN
    3e-10  32%  2gh9A  [x.x.x] MALTOSE/MALTODEXTRIN-BINDING PROTEIN
    1e-09  31%  1ziuA  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN
    2e-09  31%  2zxtA  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER,
    2e-09  31%  1y4cA  [x.x.x] MALTOSE BINDING PROTEIN FUSED WITH DESIGNED
    2e-09  31%  1nmuA  [c.94.1] MALTOSE-BINDING PERIPLASMIC PROTEIN
    2e-09  31%  3a3cA  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER,
    2e-09  32%  1n3wA  [c.94.1] MALTOSE-BINDING PERIPLASMIC PROTEIN
    3e-09  31%  1ytvA  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN
    3e-09  31%  2vgqA  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN,
    3e-09  31%  2v93A  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN
    3e-09  31%  1t0kA  [c.94.1] MALTOSE-BINDING PERIPLASMIC PROTEIN
    3e-09  31%  1svxB  [c.94.1] MALTOSE-BINDING PERIPLASMIC PROTEIN
    3e-09  31%  1r6zZ  [c.94.1 - b.34.14] CHIMERA OF MALTOSE-BINDING PERIPLASMIC
    3e-09  31%  1r6zA  [c.94.1 - b.34.14] CHIMERA OF MALTOSE-BINDING PERIPLASMIC
    3e-09  31%  1r6zP  [c.94.1 - b.34.14] CHIMERA OF MALTOSE-BINDING PERIPLASMIC
    3e-09  31%  2ok2A  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, DNA
    3e-09  31%  2obgA  [x.x.x] MALTOSE BINDING PERIPLASMIC PROTEIN AND MONOBODY
    3e-09  31%  1laxA  [c.94.1] MALTOSE-BINDING PROTEIN MUTANT MALE31
    3e-09  31%  3h3gA  [x.x.x] FUSION PROTEIN OF MALTOSE-BINDING PERIPLASMIC
    3e-09  31%  1fqaA  [c.94.1] MALTODEXTRIN-BINDING PROTEIN
    3e-09  31%  1ezoA  [c.94.1] MALTOSE-BINDING PERIPLASMIC PROTEIN
    3e-09  31%  3ehtA  [x.x.x] FUSION PROTEIN OF CRFR1 EXTRACELLULAR DOMAIN AND
    3e-09  31%  3ehsA  [x.x.x] FUSION PROTEIN OF CRFR1 EXTRACELLULAR DOMAIN AND
    3e-09  31%  3csgA  [x.x.x] MALTOSE-BINDING PROTEIN MONOBODY YS1 FUSION
    3e-09  31%  3csbA  [x.x.x] MALTOSE-BINDING PROTEIN MONOBODY YSX1 FUSION
    3e-09  31%  3c4mB  [x.x.x] FUSION PROTEIN OF MALTOSE-BINDING PERIPLASMIC
    3e-09  31%  3c4mA  [x.x.x] FUSION PROTEIN OF MALTOSE-BINDING PERIPLASMIC
    3e-09  31%  1anfA  [c.94.1 (1ez9A)] MALTODEXTRIN-BINDING PROTEIN
    5e-09  32%  1nl5A  [c.94.1] MALTOSE-BINDING PERIPLASMIC PROTEIN
    5e-09  31%  1a7lC  [c.94.1] MALE-B363
    5e-09  31%  1a7lB  [c.94.1] MALE-B363
    5e-09  31%  1a7lA  [c.94.1] MALE-B363
    9e-09  31%  1mpbA  [x.x.x] MALTODEXTRIN-BINDING PROTEIN
    9e-09  31%  1mdqA  [x.x.x] MALTODEXTRIN BINDING PROTEIN
    3e-08  31%  1mh4A  [c.94.1 - a.4.1] MALTOSE BINDING-A1 HOMEODOMAIN PROTEIN
    3e-08  31%  1mh3A  [c.94.1 - a.4.1] MALTOSE BINDING-A1 HOMEODOMAIN PROTEIN
    3e-08  31%  1mg1A  [c.94.1 - h.3.2] PROTEIN (HTLV-1 GP21
    3e-08  31%  3iowC  [x.x.x] MALTOSE-BINDING PROTEIN, HUNTINGTIN FUSION
    3e-08  31%  3iowB  [x.x.x] MALTOSE-BINDING PROTEIN, HUNTINGTIN FUSION
    3e-08  31%  3iowA  [x.x.x] MALTOSE-BINDING PROTEIN, HUNTINGTIN FUSION
    3e-08  31%  3iovC  [x.x.x] MALTOSE-BINDING PROTEIN, HUNTINGTIN FUSION
    3e-08  31%  3iovB  [x.x.x] MALTOSE-BINDING PROTEIN, HUNTINGTIN FUSION
    3e-08  31%  3iovA  [x.x.x] MALTOSE-BINDING PROTEIN, HUNTINGTIN FUSION
    3e-08  31%  3iouB  [x.x.x] MALTOSE-BINDING PROTEIN, HUNTINGTIN FUSION
    3e-08  31%  3iouA  [x.x.x] MALTOSE-BINDING PROTEIN, HUNTINGTIN FUSION
    3e-08  31%  3iotC  [x.x.x] MALTOSE-BINDING PROTEIN, HUNTINGTIN FUSION
    3e-08  31%  3iotB  [x.x.x] MALTOSE-BINDING PROTEIN, HUNTINGTIN FUSION
    3e-08  31%  3iotA  [x.x.x] MALTOSE-BINDING PROTEIN, HUNTINGTIN FUSION
    3e-08  31%  3iorC  [x.x.x] MALTOSE-BINDING PROTEIN, HUNTINGTIN FUSION
    3e-08  31%  3iorB  [x.x.x] MALTOSE-BINDING PROTEIN, HUNTINGTIN FUSION
    3e-08  31%  3iorA  [x.x.x] MALTOSE-BINDING PROTEIN, HUNTINGTIN FUSION
    3e-08  31%  1hsjA  [c.94.1 - a.4.5] FUSION PROTEIN CONSISTING OF STAPHYLOCOCCUS
    3e-08  31%  3g7wA  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, ISLET
    3e-08  31%  3g7vC  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, ISLET
    3e-08  31%  3g7vA  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, ISLET
    3e-08  31%  3ef7A  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER, ZONA
    3e-08  31%  3d4gE  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER, ZONA
    3e-08  31%  3d4gD  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER, ZONA
    3e-08  31%  3d4gA  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER, ZONA
    3e-08  31%  3d4cA  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER, ZONA
    5e-08  31%  3dm0A  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN FUSED WITH
    8e-08  31%  1jvxA  [c.94.1] MALTODEXTRIN-BINDING PROTEIN
    1e-07  31%  1mdp1  [c.94.1] MALTODEXTRIN BINDING PROTEIN
    1e-07  32%  3iouC  [x.x.x] MALTOSE-BINDING PROTEIN, HUNTINGTIN FUSION
    1e-07  28%  2w7yA  [x.x.x] PROBABLE SUGAR ABC TRANSPORTER, SUGAR-BINDING
    2e-07  31%  3f5fA  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, HEPARAN
    2e-07  28%  2i58A  [x.x.x] SUGAR ABC TRANSPORTER, SUGAR-BINDING PROTEIN
    2e-07  28%  2hq0A  [x.x.x] SUGAR ABC TRANSPORTER, SUGAR-BINDING PROTEIN
    2e-07  28%  2heuB  [x.x.x] SUGAR ABC TRANSPORTER, SUGAR-BINDING PROTEIN
    2e-07  28%  2heuA  [x.x.x] SUGAR ABC TRANSPORTER, SUGAR-BINDING PROTEIN
    3e-07  32%  3ehuA  [x.x.x] FUSION PROTEIN OF CRFR1 EXTRACELLULAR DOMAIN AND
    1e-06  32%  2hfbB  [x.x.x] SUGAR ABC TRANSPORTER, SUGAR-BINDING PROTEIN
    1e-06  32%  2hfbA  [x.x.x] SUGAR ABC TRANSPORTER, SUGAR-BINDING PROTEIN
    1e-06  30%  1iudA  [x.x.x] MALTODEXTRIN-BINDING PROTEIN MALE-B133
    2e-06  26%  1jvyA  [c.94.1] MALTODEXTRIN-BINDING PROTEIN
    2e-06  25%  1eljA  [c.94.1] MALTODEXTRIN-BINDING PROTEIN
    3e-06  35%  2nvuB  [x.x.x] MALTOSE BINDING PROTEIN/NEDD8-ACTIVATING ENZYME
    7e-04  21%  2z8dB  [x.x.x] GALACTO-N-BIOSE/LACTO-N-BIOSE I TRANSPORTER
    7e-04  21%  2z8dA  [x.x.x] GALACTO-N-BIOSE/LACTO-N-BIOSE I TRANSPORTER
    7e-04  34%  2vozB  [x.x.x] PERIPLASMIC IRON-BINDING PROTEIN
    7e-04  34%  2vozA  [x.x.x] PERIPLASMIC IRON-BINDING PROTEIN
:417

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVAEFWHGFTGGAPKAALENLVVEFNKAQQGRCVRPV
1eu8A           ----------------------------------------------------------------------
2ghbB           ----------------------------------------------------------------------
2ghbA           ----------------------------------------------------------------------
2ghaB           ----------------------------------------------------------------------
2ghaA           ----------------------------------------------------------------------
2fncA           ----------------------------------------------------------------------
1urgA           ----------------------------------------------------------------------
1urdB           ----------------------------------------------------------------------
1urdA           ----------------------------------------------------------------------
1ursB           ----------------------------------------------------------------------
1ursA           ----------------------------------------------------------------------
2zyoA           ----------------------------------------------------------------------
2zynA           ----------------------------------------------------------------------
2zymA           ----------------------------------------------------------------------
2gh9A           ----------------------------------------------------------------------
1ziuA           ----------------------------------------------------------------------
2zxtA           ----------------------------------------------------------------------
1y4cA           ----------------------------------------------------------------------
1nmuA           ----------------------------------------------------------------------
3a3cA           ----------------------------------------------------------------------
1n3wA           ----------------------------------------------------------------------
1ytvA           ----------------------------------------------------------------------
2vgqA           ----------------------------------------------------------------------
2v93A           ----------------------------------------------------------------------
1t0kA           ----------------------------------------------------------------------
1svxB           ----------------------------------------------------------------------
1r6zZ           ----------------------------------------------------------------------
1r6zA           ----------------------------------------------------------------------
1r6zP           ----------------------------------------------------------------------
2ok2A           ----------------------------------------------------------------------
2obgA           ----------------------------------------------------------------------
1laxA           ----------------------------------------------------------------------
3h3gA           ----------------------------------------------------------------------
1fqaA           ----------------------------------------------------------------------
1ezoA           ----------------------------------------------------------------------
3ehtA           ----------------------------------------------------------------------
3ehsA           ----------------------------------------------------------------------
3csgA           ----------------------------------------------------------------------
3csbA           ----------------------------------------------------------------------
3c4mB           ----------------------------------------------------------------------
3c4mA           ----------------------------------------------------------------------
1anfA           ----------------------------------------------------------------------
1nl5A           ----------------------------------------------------------------------
1a7lC           ----------------------------------------------------------------------
1a7lB           ----------------------------------------------------------------------
1a7lA           ----------------------------------------------------------------------
1mpbA           ----------------------------------------------------------------------
1mdqA           ----------------------------------------------------------------------
1mh4A           ----------------------------------------------------------------------
1mh3A           ----------------------------------------------------------------------
1mg1A           ----------------------------------------------------------------------
3iowC           ----------------------------------------------------------------------
3iowB           ----------------------------------------------------------------------
3iowA           ----------------------------------------------------------------------
3iovC           ----------------------------------------------------------------------
3iovB           ----------------------------------------------------------------------
3iovA           ----------------------------------------------------------------------
3iouB           ----------------------------------------------------------------------
3iouA           ----------------------------------------------------------------------
3iotC           ----------------------------------------------------------------------
3iotB           ----------------------------------------------------------------------
3iotA           ----------------------------------------------------------------------
3iorC           ----------------------------------------------------------------------
3iorB           ----------------------------------------------------------------------
3iorA           ----------------------------------------------------------------------
1hsjA           ----------------------------------------------------------------------
3g7wA           ----------------------------------------------------------------------
3g7vC           ----------------------------------------------------------------------
3g7vA           ----------------------------------------------------------------------
3ef7A           ----------------------------------------------------------------------
3d4gE           ----------------------------------------------------------------------
3d4gD           ----------------------------------------------------------------------
3d4gA           ----------------------------------------------------------------------
3d4cA           ----------------------------------------------------------------------
3dm0A           ----------------------------------------------------------------------
1jvxA           ----------------------------------------------------------------------
1mdp1           ----------------------------------------------------------------------
3iouC           ----------------------------------------------------------------------
2w7yA           ----------------------------------VLEFYHGYHHSEPVAKTRDLYDKFAEEHSGVEFKPT
3f5fA           ----------------------------------------------------------------------
2i58A           ----------------------------------------------------------------------
2hq0A           ----------------------------------------------------------------------
2heuB           ----------------------------------------------------------------------
2heuA           ----------------------------------------------------------------------
3ehuA           ----------------------------------------------------------------------
2hfbB           ----------------------------------------------------------------------
2hfbA           ----------------------------------------------------------------------
1iudA           ----------------------------------------------------------------------
1jvyA           ----------------------------------------------------------------------
1eljA           ----------------------------------------------------------------------
2nvuB           ----------------------------------------------------------------------
2z8dB           -------------------------------------YMHRLPDSEGMTLVNDIVAKWNKQHPDIQVKAT
2z8dA           -------------------------------------YMHRLPDSEGMTLVNDIVAKWNKQHPDIQVKAT
2vozB           ----------------------------------------------------------------------
2vozA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PQGGYRDLSTKIKAAFAAGKVPAMAQAFENNIALYLEAKALLPIESLGVRLQGVNLTFLNAVRFGGVVYG
1eu8A           ----------------------------------------------------------------GGKLYA
2ghbB           --------------------------------------------------------TALNAFSYGGKLYG
2ghbA           --------------------------------------------------------TALNAFSYGGKLYG
2ghaB           --------------------------------------------------------TALNAFSYGGKLYG
2ghaA           --------------------------------------------------------TALNAFSYGGKLYG
2fncA           --------------------------------------------------------TALKAFSYGGKLYG
1urgA           -----------------------------DNNGVFAEEGLMAPVPS-GVLNTGLYANTIDAIKVNGTMYS
1urdB           -----------------------------DNNGVFAEEGLMAPVPS-GVLNTGLYANTIDAIKVNGTMYS
1urdA           -----------------------------DNNGVFAEEGLMAPVPS-GVLNTGLYANTIDAIKVNGTMYS
1ursB           -----------------------------DNNGVFAEEGLMAPVPS-GVLNTGLYANTIDAIKVNGTMYS
1ursA           -----------------------------DNNGVFAEEGLMAPVPS-GVLNTGLYANTIDAIKVNGTMYS
2zyoA           ----------------------------------------------------------MKALTYGGKLYG
2zynA           ----------------------------------------------------------MKALTYGGKLYG
2zymA           ----------------------------------------------------------MKALTYGGKLYG
2gh9A           --------------------------------------------------LQGVAV---EAFTFGGRLMG
1ziuA           -----------------------------------------------------------DAVRYNGKLIA
2zxtA           -----------------------------------------------------------DAVRYNGKLIA
1y4cA           -----------------------------------------------------------DAVRYNGKLIA
1nmuA           -----------------------------------------------------------DAVRYNGKLIA
3a3cA           -----------------------------------------------------------DAVRYNGKLIA
1n3wA           -----------------------------------------------------------DAVRYNGKLIA
1ytvA           -----------------------------------------------------------DAVRYNGKLIA
2vgqA           -----------------------------------------------------------DAVRYNGKLIA
2v93A           -----------------------------------------------------------DAVRYNGKLIA
1t0kA           -----------------------------------------------------------DAVRYNGKLIA
1svxB           -----------------------------------------------------------DAVRYNGKLIA
1r6zZ           -----------------------------------------------------------DAVRYNGKLIA
1r6zA           -----------------------------------------------------------DAVRYNGKLIA
1r6zP           -----------------------------------------------------------DAVRYNGKLIA
2ok2A           -----------------------------------------------------------DAVRYNGKLIA
2obgA           -----------------------------------------------------------DAVRYNGKLIA
1laxA           -----------------------------------------------------------DAVRYNGKLIA
3h3gA           -----------------------------------------------------------DAVRYNGKLIA
1fqaA           -----------------------------------------------------------DAVRYNGKLIA
1ezoA           -----------------------------------------------------------DAVRYNGKLIA
3ehtA           -----------------------------------------------------------DAVRYNGKLIA
3ehsA           -----------------------------------------------------------DAVRYNGKLIA
3csgA           -----------------------------------------------------------DAVRYNGKLIA
3csbA           -----------------------------------------------------------DAVRYNGKLIA
3c4mB           -----------------------------------------------------------DAVRYNGKLIA
3c4mA           -----------------------------------------------------------DAVRYNGKLIA
1anfA           -----------------------------------------------------------DAVRYNGKLIA
1nl5A           -----------------------------------------------------------DAVRYNGKLIA
1a7lC           -----------------------------------------------------------DAVRYNGKLIA
1a7lB           -----------------------------------------------------------DAVRYNGKLIA
1a7lA           -----------------------------------------------------------DAVRYNGKLIA
1mpbA           -----------------------------------------------------------DAVRYNGKLIA
1mdqA           -----------------------------------------------------------DAVRYNGKLIA
1mh4A           -----------------------------------------------------------DAVRYNGKLIA
1mh3A           -----------------------------------------------------------DAVRYNGKLIA
1mg1A           -----------------------------------------------------------DAVRYNGKLIA
3iowC           -----------------------------------------------------------DAVRYNGKLIA
3iowB           -----------------------------------------------------------DAVRYNGKLIA
3iowA           -----------------------------------------------------------DAVRYNGKLIA
3iovC           -----------------------------------------------------------DAVRYNGKLIA
3iovB           -----------------------------------------------------------DAVRYNGKLIA
3iovA           -----------------------------------------------------------DAVRYNGKLIA
3iouB           -----------------------------------------------------------DAVRYNGKLIA
3iouA           -----------------------------------------------------------DAVRYNGKLIA
3iotC           -----------------------------------------------------------DAVRYNGKLIA
3iotB           -----------------------------------------------------------DAVRYNGKLIA
3iotA           -----------------------------------------------------------DAVRYNGKLIA
3iorC           -----------------------------------------------------------DAVRYNGKLIA
3iorB           -----------------------------------------------------------DAVRYNGKLIA
3iorA           -----------------------------------------------------------DAVRYNGKLIA
1hsjA           -----------------------------------------------------------DAVRYNGKLIA
3g7wA           -----------------------------------------------------------DAVRYNGKLIA
3g7vC           -----------------------------------------------------------DAVRYNGKLIA
3g7vA           -----------------------------------------------------------DAVRYNGKLIA
3ef7A           -----------------------------------------------------------DAVRYNGKLIA
3d4gE           -----------------------------------------------------------DAVRYNGKLIA
3d4gD           -----------------------------------------------------------DAVRYNGKLIA
3d4gA           -----------------------------------------------------------DAVRYNGKLIA
3d4cA           -----------------------------------------------------------DAVRYNGKLIA
3dm0A           -----------------------------------------------------------DAVRYNGKLIA
1jvxA           -----------------------------------------------------------DAVRYNGKLIA
1mdp1           -----------------------------------------------------------DAVRYNGKLIA
3iouC           -----------------------------------------------------------DAVRYNGKLIA
2w7yA           PNGDLKDINNKV----ASGEFPDVIDLAGNAVSLAIEQKLVLPYIDSNKLEKNVGLNYKQNQK-DGKIYT
3f5fA           -----------------------------------------------------------DAVRYNGKLIA
2i58A           -----------LKTRVLAGDVPDVVNIYPQSIELQEWAKAGV-FEDLSNKLKRVKNGYAEKYAVNEKVYN
2hq0A           -----------LKTRVLAGDVPDVVNIYPQSIELQEWAKAGV-FEDLSNKLKRVKNGYAEKYAVNEKVYN
2heuB           -----------LKTRVLAGDVPDVVNIYPQSIELQEWAKAGV-FEDLSNKLKRVKNGYAEKYAVNEKVYN
2heuA           -----------LKTRVLAGDVPDVVNIYPQSIELQEWAKAGV-FEDLSNKLKRVKNGYAEKYAVNEKVYN
3ehuA           -----------------------------------------------------------DAVRYNGKLIA
2hfbB           -----------LKTRVLAGDVPDVVNIYPQSIELQEWAKAGV-FEDLSNKLKRVKNGYAEKYAVNEKVYN
2hfbA           -----------LKTRVLAGDVPDVVNIYPQSIELQEWAKAGV-FEDLSNKLKRVKNGYAEKYAVNEKVYN
1iudA           -----------------------------------------------------------DAVRYNGKLIA
1jvyA           -----------------------------------------------------------DAVRYNGKLIA
1eljA           ------NLEDALKAAIPTGQGPDLFIWAHDWIGKFAEAGLLEPIDEYVTELNEFAPMAQDAMQYKGHYYA
2nvuB           -----------------------------------------------------------DAVRYNGKLIA
2z8dB           KDGKASDMIKKLETDVKSGEAPDLAQVGYAELPEVFTKGLLQDVTQYAEQYKNDFASGYSLVQVGGKAYG
2z8dA           KDGKASDMIKKLETDVKSGEAPDLAQVGYAELPEVFTKGLLQDVTQYAEQYKNDFASGYSLVQVGGKAYG
2vozB           ----------------------------------------------------------------------
2vozA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VPFNKSIQVLYYNKDLLKKHGVPVPATLEEFVAAAKKLSRAEGGPVYWFQPDASTFAYFFFNLGGSYLKD
1eu8A           LPVYIDAGLLYYRKDLLEKYGYKPPETWQELVEMAQKIGERETNPNFWYEGLVCDFVEYVYSNGGSLFKD
2ghbB           IPYAMEAIALIYNKDYVPE----PPKTMDELIEIAKQIDEEFGGEVRGFITSAAEFYYFIFGYGGYVFKQ
2ghbA           IPYAMEAIALIYNKDYVPE----PPKTMDELIEIAKQIDEEFGGEVRGFITSAAEFYYFIFGYGGYVFKQ
2ghaB           IPYAMEAIALIYNKDYVPE----PPKTMDELIEIAKQIDEEFGGEVRGFITSAAEFYYFIFGYGGYVFKQ
2ghaA           IPYAMEAIALIYNKDYVPE----PPKTMDELIEIAKQIDEEFGGEVRGFITSAAEFYYFIFGYGGYVFKQ
2fncA           VPYAMEAVALIYNKDYVDS----VPKTMDELIEKAKQIDEEYGGEVRGFIYDVANFAPFILGYGGYVFKE
1urgA           VPVSVQVAAIYYNKKLVPQ----PPQTWAEFVKDANAHGMYDQANLYFDYAIIGGYGGYVFKDNNGTLDP
1urdB           VPVSVQVAAIYYNKKLVPQ----PPQTWAEFVKDANAHGMYDQANLYFDYAIIGGYGGYVFKDNNGTLDP
1urdA           VPVSVQVAAIYYNKKLVPQ----PPQTWAEFVKDANAHGMYDQANLYFDYAIIGGYGGYVFKDNNGTLDP
1ursB           VPVSVQVAAIYYNKKLVPQ----PPQTWAEFVKDANAHGMYDQANLYFDYAIIGGYGGYVFKDNNGTLDP
1ursA           VPVSVQVAAIYYNKKLVPQ----PPQTWAEFVKDANAHGMYDQANLYFDYAIIGGYGGYVFKDNNGTLDP
2zyoA           LPKAIESVALIYNKKLMGQ----VPATYDELFQYAKANNKPDEQKYVLFEANNFYYTYFLFAAKGAAVQD
2zynA           LPKAIESVALIYNKKLMGQ----VPATYDELFQYAKANNKPDEQKYVLFEANNFYYTYFLFAAKGAAVQD
2zymA           LPKAIESVALIYNKKLMGQ----VPATYDELFQYAKANNKPDEQKYVLFEANNFYYTYFLFAAKGAAVQD
2gh9A           LPAFAESVALIYNKKYVKE----PPRTWEEFLALAQKLTTATFGFLYNIGDPYFNFGFFAFGAENVFAKD
1ziuA           YPIAVMALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPEFTWPLIAADGGYYEN
2zxtA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1y4cA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1nmuA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3a3cA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1n3wA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYIKD
1ytvA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
2vgqA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
2v93A           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1t0kA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1svxB           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1r6zZ           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1r6zA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1r6zP           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
2ok2A           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
2obgA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1laxA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3h3gA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1fqaA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1ezoA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3ehtA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3ehsA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3csgA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3csbA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3c4mB           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3c4mA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1anfA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1nl5A           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYIKD
1a7lC           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1a7lB           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1a7lA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1mpbA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1mdqA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1mh4A           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1mh3A           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1mg1A           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3iowC           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3iowB           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3iowA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3iovC           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3iovB           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3iovA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3iouB           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3iouA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3iotC           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3iotB           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3iotA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3iorC           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3iorB           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3iorA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1hsjA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3g7wA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3g7vC           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3g7vA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3ef7A           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3d4gE           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3d4gD           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3d4gA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3d4cA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
3dm0A           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1jvxA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1mdp1           YPIAVEALSLIYNKDLLPN----PPKTWEEIPDPGKSALMFNLQEPYFTWPIAADGGYAFKYENGKYIKD
3iouC           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
2w7yA           V-HEQLFTGLWYNKDIFAKAGAKTPNTWDDFTQAA-SIRKQDG--VYAFGAGEPSIRLFNTVLGGRKLLD
3f5fA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
2i58A           VPFTANAYGIYYNKDKFEELGLKVPETWDEFEQLVKDIV-AKGGADAWTLNGYNQLAFATATGGGKYSQP
2hq0A           VPFTANAYGIYYNKDKFEELGLKVPETWDEFEQLVKDIV-AKGGADAWTLNGYNQLAFATATGGGKYSQP
2heuB           VPFTANAYGIYYNKDKFEELGLKVPETWDEFEQLVKDIV-AKGGADAWTLNGYNQLAFATATGGGKYSQP
2heuA           VPFTANAYGIYYNKDKFEELGLKVPETWDEFEQLVKDIV-AKGGADAWTLNGYNQLAFATATGGGKYSQP
3ehuA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
2hfbB           VPFTANAYGIYYNKDKFEELGLKVPETWDEFEQLVKDI--------------------------------
2hfbA           VPFTANAYGIYYNKDKFEELGLKVPETWDEFEQLVKDI--------------------------------
1iudA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPDPQDPRVRGLYKSALMFNLQEPYFTWPLIAADGGYYEN
1jvyA           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
1eljA           LPFAAETVAIIYNKEMVSEP----PKTFDEMKAIMEKYYDPANEKYGIAWPINAYFISAIAQAFGGYYFD
2nvuB           YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
2z8dB           LPQDTGPLVYFYNKAEFEKLGIEIPQTADEFI--------------------------------------
2z8dA           LPQDTGPLVYFYNKAEFEKLGIEIPQTADEFI--------------------------------------
2vozB           ----------------------------------------------------------------------
2vozA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GKLVLNSKEAVEALTLLQNGVKEGWAKPITSGYINQNLGSGPYAFSVDTSAGYTYYLRAAKFDLGVATLP
1eu8A           GKWVLNKPENVEALQFMVDLIHKYKISPMTEEPVRLMFQQGNAAF--ERNWPYAWGLHNAKGKVGVAPLP
2ghbB           NDIGLANEGAIKGVKLLKRLVDEGILDPSDNYQIMDSMFREGQAAMIINGPWAIKAYKDAGIDYGVAPIP
2ghbA           NDIGLANEGAIKGVKLLKRLVDEGILDPSDNYQIMDSMFREGQAAMIINGPWAIKAYKDAGIDYGVAPIP
2ghaB           NDIGLANEGAIKGVKLLKRLVDEGILDPSDNYQIMDSMFREGQAAMIINGPWAIKAYKDAGIDYGVAPIP
2ghaA           NDIGLANEGAIKGVKLLKRLVDEGILDPSDNYQIMDSMFREGQAAMIINGPWAIKAYKDAGIDYGVAPIP
2fncA           TDIGLANEGAVKGAKLIKRMIDEGVLTPGDNGTMDSMFKEGLAAMIINGLWAIKSY-KDAGINYGVAPIP
1urgA           NNIGLDTPGAVQAYTLMRDMVKYHWMTPSTNGFLAGKIGSGPW----DTAD-----IEKAKIDFGVTTLP
1urdB           NNIGLDTPGAVQAYTLMRDMVKYHWMTPSTNGFLAGKIGSGPW----DTAD-----IEKAKIDFGVTTLP
1urdA           NNIGLDTPGAVQAYTLMRDMVKYHWMTPSTNGFLAGKIGSGPW----DTAD-----IEKAKIDFGVTTLP
1ursB           NNIGLDTPGAVQAYTLMRDMVKYHWMTPSTNGFLAGKIGSGPW----DTAD-----IEKAKIDFGVTTLP
1ursA           NNIGLDTPGAVQAYTLMRDMVKYHWMTPSTNGFLAGKIGSGPW----DTAD-----IEKAKIDFGVTTLP
2zyoA           GEIGLNSPEAVQGMNEVQKWFTEALPQSLKADTVNGLFKSGKVAAVINGPWAIKDY-QAAGINVGVAPLP
2zynA           GEIGLNSPEAVQGMNEVQKWFTEALPQSLKADTVNGLFKSGKVAAVINGPWAIKDY-QAAGINVGVAPLP
2zymA           GEIGLNSPEAVQGMNEVQKWFTEALPQSLKADTVNGLFKSGKVAAVINGPWAIKDY-QAAGINVGVAPLP
2gh9A           AKLLIGGEVGEKALQFIKNLVPEGVDYGVADGAFKDGILNGPWALG---------DYKKAKVDFGIAPFP
1ziuA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
2zxtA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1y4cA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1nmuA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3a3cA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1n3wA           --VGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1ytvA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
2vgqA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
2v93A           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYCIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1t0kA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1svxB           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1r6zZ           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1r6zA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1r6zP           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
2ok2A           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
2obgA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1laxA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3h3gA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1fqaA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1ezoA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3ehtA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3ehsA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3csgA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3csbA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3c4mB           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3c4mA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1anfA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1nl5A           --VGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1a7lC           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1a7lB           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1a7lA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1mpbA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPRAWSIDTS----------KVNYGVTVLP
1mdqA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1mh4A           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1mh3A           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1mg1A           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3iowC           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3iowB           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3iowA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3iovC           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3iovB           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3iovA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3iouB           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3iouA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3iotC           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3iotB           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3iotA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3iorC           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3iorB           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3iorA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1hsjA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3g7wA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3g7vC           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3g7vA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3ef7A           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3d4gE           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3d4gD           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3d4gA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3d4cA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3dm0A           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTSA----------VNYGVTVLP
1jvxA           GKVGVDNAGAKAGLTFLVDLIKNKHMNACTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1mdp1           --VGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
3iouC           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
2w7yA           KPLTIESKEFADALK-----VKEIQANG------SKNAGGDANAYSKDFQEGKSAVFFNGVWASGESKNP
3f5fA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
2i58A           NAIKLSDKDDIKVMDILRNGSKQNWE---GAGYVIGAFARGDVLMTPNGSWAITINEQKPNFKIGTFMIP
2hq0A           NAIKLSDKDDIKVMDILRNGSKQNWE---GAGYVIGAFARGDVLMTPNGSWAITINEQKPNFKIGTFMIP
2heuB           NAIKLSDKDDIKVMDILRNGSKQNWE---GAGYVIGAFARGDVLMTPNGSWAITINEQKPNFKIGTFMIP
2heuA           NAIKLSDKDDIKVMDILRNGSKQNWE---GAGYVIGAFARGDVLMTPNGSWAITINEQKPNFKIGTFMIP
3ehuA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
2hfbB           ----------------------------------------------------------------------
2hfbA           ----------------------------------------------------------------------
1iudA           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
1jvyA           GKVGVDNAGAKAGLTFLVDLIKNKHMNATDYSIAEAAFNKGETAMTINGPWAWS-NIDTSKVNYGVTVLP
1eljA           DKTEQPGLDKPETIEGFKFFFTEIWPYMAPTGDYNTQMVNGPWSINDVKKAGINF---------GVVPLP
2nvuB           GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
2z8dB           ----------------------------------------------------------------------
2z8dA           ----------------------------------------------------------------------
2vozB           ----------------------------------------------------------------------
2vozA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GRTKGQPGYGLVQGTNLVVFRQASKEEQAVAKDFLEFVLSPRAQAVFATATGYVPVTEGALKDPVYQAYA
1eu8A           -HFPGHKSAATLGGWHIGISKYS--DNKALAWEFVKFVESYSVQKGFAMNLGWNPGRVDVYDDP---AVV
2ghbB           DLEPGVPARPFVGVQGFMV--NAKSPNKLLAIEFL-----------------------------------
2ghbA           DLEPGVPARPFVGVQGFMV--NAKSPNKLLAIEFL-----------------------------------
2ghaB           DLEPGVPARPFVGVQGFMV--NAKSPNKLLAIEFL-----------------------------------
2ghaA           DLEPGVPARPFVGVQGFMV--NAKSPNKLLAIEFL-----------------------------------
2fncA           ELEPGVPAKPFVGVQGFMI--NAKSPNKVIAMEFLNFIARKETMYKIYLADPRLPARKDVLE------LV
1urgA           NGKHATPFLGVI-----TAFVNKESKTQAADWSLVQALTSAQAQQMYFRDSQQIPALLSVQRSSAVQS--
1urdB           NGKHATPFLGVI-----TAFVNKESKTQAADWSLVQALTSAQAQQMYFRDSQQIPALLSVQRSSAVQS--
1urdA           NGKHATPFLGVI-----TAFVNKESKTQAADWSLVQALTSAQAQQMYFRDSQQIPALLSVQRSSAVQS--
1ursB           NGKHATPFLGVI-----TAFVNKESKTQAADWSLVQALTSAQAQQMYFRDSQQIPALLSVQRSSAVQS--
1ursA           NGKHATPFLGVI-----TAFVNKESKTQAADWSLVQALTSAQAQQMYFRDSQQIPALLSVQRSSAVQS--
2zyoA           -KIDGKDAQTFVKGWYLSAYSKYPK----YATELMQFLTSKEALASRFKETGEIPPQKELLNDPMIK---
2zynA           -KIDGKDAQTFVKGWYLSAYSKYPK----YATELMQFLTSKEALASRFKETGEIPPQKELLNDPMIK---
2zymA           -KIDGKDAQTFVKGWYLSAYSKYPK----YATELMQFLTSKEALASRFKETGEIPPQKELLNDPMIK---
2gh9A           VPPGAKNPWGPFLGVQGVVVNAYSK-NKTQAVNFAKTLVTGRNLVAFNQAGGRIPVSKSAVKDPVVAGFS
1ziuA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
2zxtA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1y4cA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1nmuA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3a3cA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1n3wA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1ytvA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
2vgqA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
2v93A           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1t0kA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1svxB           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1r6zZ           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1r6zA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1r6zP           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
2ok2A           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
2obgA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1laxA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3h3gA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1fqaA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1ezoA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3ehtA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3ehsA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3csgA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3csbA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3c4mB           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3c4mA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1anfA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1nl5A           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1a7lC           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1a7lB           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1a7lA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1mpbA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1mdqA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGSVALKSYEEEL
1mh4A           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1mh3A           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1mg1A           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3iowC           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3iowB           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3iowA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3iovC           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3iovB           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3iovA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3iouB           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3iouA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3iotC           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3iotB           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3iotA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3iorC           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3iorB           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3iorA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1hsjA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3g7wA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3g7vC           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3g7vA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3ef7A           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3d4gE           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3d4gD           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3d4gA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3d4cA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3dm0A           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1jvxA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGSVALKSYEEEL
1mdp1           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
3iouC           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKAALKS--YEEEL
2w7yA           SLAPGPAGVAXXXXXXXXXXXXXXEAKQKLALEFLKYT-SDDVQKVIFEKVGANPSNENVVKELSEKSSE
3f5fA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
2i58A           GKEKGQ---SLTVGADLAWSISATTKHPKEANAFVEYMTRPEVMQKYYDVDGSPTAIEG-----------
2hq0A           GKEKGQ---SLTVGADLAWSISATTKHPKEANAFVEYMTRPEVMQKYYDVDGSPTAIEG-----------
2heuB           GKEKGQ---SLTVGADLAWSISATTKHPKEANAFVEYMTRPEVMQKYYDVDGSPTAIEG-----------
2heuA           GKEKGQ---SLTVGADLAWSISATTKHPKEANAFVEYMTRPEVMQKYYDVDGSPTAIEG-----------
3ehuA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEG----LEAVNKDKPLGAVA
2hfbB           ----------------------------------------------------------------------
2hfbA           ----------------------------------------------------------------------
1iudA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
1jvyA           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGSVALKSYEEEL
1eljA           GKEYWPRPYG---GVKLIYFAAGIKNKDAAWKFAKWLTTSEESIKTLALELGYIPVLTKVLDDP------
2nvuB           -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLE----------------------------------
2z8dB           ----------------------------------------------------------------------
2z8dA           ----------------------------------------------------------------------
2vozB           ------------------VLKNAPNRDAAIA--FLEYLASDDAQRYFAEGNNEYPVIPGVPIDPVLAAHG
2vozA           ------------------VLKNAPNRDAAIA--FLEYLASDDAQRYFAEGNNEYPVIPGVPIDPVLAAHG


                         .         .         .         .         *         .         .:420
query           AENPDYATIVRQSRYAKFEPALAEWEQIRFDILGQAIKEAILNKADPKAALDRAQKLAEDLLSSxxx
1eu8A           SKSPHLKELRAVFENAVPRPIVPYYPQLS-EIIQKYVNSALAGKISPQEALDKAQKEAEELV-----
2ghbB           -------------------------------------------------------------------
2ghbA           -------------------------------------------------------------------
2ghaB           -------------------------------------------------------------------
2ghaA           -------------------------------------------------------------------
2fncA           KDNPDVVAFTQSASMGTPMPNVPEMAPV-WSAMGDALSIIINGQASVEDALKEA-------------
1urgA           --SPTFKAFVEQLRYAVPMPNIPQMQAVWQAM--SILQNIIAGKVSPQGAKDFVQNIQKGIMA----
1urdB           --SPTFKAFVEQLRYAVPMPNIPQMQAVWQAM--SILQNIIAGKVSPQGAKDFVQNIQKGIMA----
1urdA           --SPTFKAFVEQLRYAVPMPNIPQMQAVWQAM--SILQNIIAGKVSPQGAKDFVQNIQKGIMA----
1ursB           --SPTFKAFVEQLRYAVPMPNIPQMQAV---------------------------------------
1ursA           --SPTFKAFVEQLRYAVPMPNIPQMQAV---------------------------------------
2zyoA           -NNPVVNGFAKQASKGVPMPSIPEMGVV-WEPINNAHTFVAQGKQTPEQALNDAVKIMKEKIQT---
2zynA           -NNPVVNGFAKQASKGVPMPSIPEMGVV-WEPINNAHTFVAQGKQTPEQALNDAVKIMKEKIQT---
2zymA           -NNPVVNGFAKQASKGVPMPSIPEMGVV-WEPINNAHTFVAQGKQTPEQALNDAVKIMKEKIQT---
2gh9A           KVFP---------------------------------------------------------------
1ziuA           AKDPRIAATMENAQKGEIMPNIPQMSAFEY-----AVRTAVINAASGRQTVDEALKDAQ--------
2zxtA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQTNSSS---
1y4cA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQTNSSS---
1nmuA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQTNSSS---
3a3cA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQTNSSS---
1n3wA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
1ytvA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
2vgqA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
2v93A           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
1t0kA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
1svxB           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
1r6zZ           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
1r6zA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
1r6zP           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
2ok2A           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
2obgA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
1laxA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
3h3gA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
1fqaA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
1ezoA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
3ehtA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
3ehsA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
3csgA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
3csbA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
3c4mB           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
3c4mA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
1anfA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
1nl5A           AKDPRIAATAENAAKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
1a7lC           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALK-----------
1a7lB           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALK-----------
1a7lA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALK-----------
1mpbA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
1mdqA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
1mh4A           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
1mh3A           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
1mg1A           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3iowC           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3iowB           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3iowA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3iovC           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3iovB           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3iovA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3iouB           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3iouA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3iotC           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3iotB           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3iotA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3iorC           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3iorB           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3iorA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
1hsjA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3g7wA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3g7vC           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3g7vA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3ef7A           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3d4gE           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3d4gD           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3d4gA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3d4cA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
3dm0A           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
1jvxA           AKDCRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
1mdp1           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
3iouC           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVD---------------
2w7yA           ATTKILGQAITQVKNAKVVPTVS-------DVWGGDVHTAIINALTESAAVDQKVKSTQDVLKS---
3f5fA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAA----------------------
2i58A           -------------------------------------------------------------------
2hq0A           -------------------------------------------------------------------
2heuB           -------------------------------------------------------------------
2heuA           -------------------------------------------------------------------
3ehuA           LKSYE-EELAKDPRIGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
2hfbB           -------------------------------------------------------------------
2hfbA           -------------------------------------------------------------------
1iudA           AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
1jvyA           AKDRIAAT-MENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
1eljA           -------------------------------------------------------------------
2nvuB           -------------------------------------------------------------------
2z8dB           -------------------------------------------------------------------
2z8dA           -------------------------------------------------------------------
2vozB           QLKGDPLNVSNLGRY----------------------------------------------------
2vozA           QLKGDPLNVSNLGRY----------------------------------------------------