[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS80391.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2zyjA.bssp"
#ERROR : Can't open dsspfile "2egyC.bssp"
#ERROR : Can't open dsspfile "2egyB.bssp"
#ERROR : Can't open dsspfile "2z1yB.bssp"
#ERROR : Can't open dsspfile "2egyD.bssp"
#ERROR : Can't open dsspfile "3cbfA.bssp"
#ERROR : Can't open dsspfile "2zg5A.bssp"
#ERROR : Can't open dsspfile "2z1yA.bssp"
#ERROR : Can't open dsspfile "1wstA.bssp"
#ERROR : Can't open dsspfile "1x0mA.bssp"
#ERROR : Can't open dsspfile "1vp4B.bssp"
#ERROR : Can't open dsspfile "1vp4A.bssp"
#ERROR : Can't open dsspfile "2zc0A.bssp"
#ERROR : Can't open dsspfile "2r2nA.bssp"
#ERROR : Can't open dsspfile "2vgzA.bssp"
#ERROR : Can't open dsspfile "2qlrA.bssp"
#ERROR : Can't open dsspfile "3dc1B.bssp"
#ERROR : Can't open dsspfile "3dc1D.bssp"
#ERROR : Can't open dsspfile "3dc1A.bssp"
#ERROR : Can't open dsspfile "1gd9A.bssp"
#ERROR : Can't open dsspfile "1djuB.bssp"
#ERROR : Can't open dsspfile "1djuA.bssp"
#ERROR : Can't open dsspfile "1v2dA.bssp"
#ERROR : Can't open dsspfile "1v2eB.bssp"
#ERROR : Can't open dsspfile "1v2eA.bssp"
#ERROR : Can't open dsspfile "1o4sB.bssp"
#ERROR : Can't open dsspfile "1o4sA.bssp"
#ERROR : Can't open dsspfile "1gc3A.bssp"
#ERROR : Can't open dsspfile "1bkgA.bssp"
#ERROR : Can't open dsspfile "5bj4A.bssp"
#ERROR : Can't open dsspfile "5bj3A.bssp"
#ERROR : Can't open dsspfile "1b5pA.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "1bjwA.bssp"
#ERROR : Can't open dsspfile "2o1bA.bssp"
#ERROR : Can't open dsspfile "1ijiA.bssp"
#ERROR : Can't open dsspfile "1geyA.bssp"
#ERROR : Can't open dsspfile "1gexA.bssp"
#ERROR : Can't open dsspfile "1gewA.bssp"
#ERROR : Can't open dsspfile "1fg7A.bssp"
#ERROR : Can't open dsspfile "2gb3F.bssp"
#ERROR : Can't open dsspfile "2gb3E.bssp"
#ERROR : Can't open dsspfile "2gb3D.bssp"
#ERROR : Can't open dsspfile "2gb3C.bssp"
#ERROR : Can't open dsspfile "2gb3B.bssp"
#ERROR : Can't open dsspfile "2gb3A.bssp"
#ERROR : Can't open dsspfile "3jtxA.bssp"
#ERROR : Can't open dsspfile "2douB.bssp"
#ERROR : Can't open dsspfile "2douA.bssp"
#ERROR : Can't open dsspfile "3jtxB.bssp"
#ERROR : Can't open dsspfile "2o0rB.bssp"
#ERROR : Can't open dsspfile "2o0rA.bssp"
#ERROR : Can't open dsspfile "2z61A.bssp"
#ERROR : Can't open dsspfile "3dydB.bssp"
#ERROR : Can't open dsspfile "3dydA.bssp"
#ERROR : Can't open dsspfile "1xi9C.bssp"
#ERROR : Can't open dsspfile "1xi9B.bssp"
#ERROR : Can't open dsspfile "1xi9A.bssp"
#ERROR : Can't open dsspfile "3h14A.bssp"
#ERROR : Can't open dsspfile "3ffhA.bssp"
#ERROR : Can't open dsspfile "1w7nA.bssp"
#ERROR : Can't open dsspfile "1w7lA.bssp"
#ERROR : Can't open dsspfile "1yiyA.bssp"
#ERROR : Can't open dsspfile "2r5cB.bssp"
#ERROR : Can't open dsspfile "3fvsA.bssp"
#ERROR : Can't open dsspfile "3ffhB.bssp"
#ERROR : Can't open dsspfile "3d6kD.bssp"
#ERROR : Can't open dsspfile "3d6kC.bssp"
#ERROR : Can't open dsspfile "3d6kB.bssp"
#ERROR : Can't open dsspfile "3d6kA.bssp"
#ERROR : Can't open dsspfile "3ezsB.bssp"
#ERROR : Can't open dsspfile "3ezsA.bssp"
#ERROR : Can't open dsspfile "1yizA.bssp"
#ERROR : Can't open dsspfile "2r5cA.bssp"
#ERROR : Can't open dsspfile "3b46B.bssp"
#ERROR : Can't open dsspfile "3b46A.bssp"
#ERROR : Can't open dsspfile "1u08B.bssp"
#ERROR : Can't open dsspfile "1u08A.bssp"
#ERROR : Can't open dsspfile "1d2fB.bssp"
#ERROR : Can't open dsspfile "1d2fA.bssp"
#ERROR : Can't open dsspfile "2z1zA.bssp"
#ERROR : Can't open dsspfile "3ei7B.bssp"
#ERROR : Can't open dsspfile "3ei7A.bssp"
#ERROR : Can't open dsspfile "3ei6B.bssp"
#ERROR : Can't open dsspfile "3ei6A.bssp"
#ERROR : Can't open dsspfile "3eiaB.bssp"
#ERROR : Can't open dsspfile "3eiaA.bssp"
#ERROR : Can't open dsspfile "3ei9B.bssp"
#ERROR : Can't open dsspfile "3ei9A.bssp"
#ERROR : Can't open dsspfile "3ei8A.bssp"
#ERROR : Can't open dsspfile "3hdoB.bssp"
#ERROR : Can't open dsspfile "3hdoA.bssp"
#ERROR : Can't open dsspfile "1ynuA.bssp"
#ERROR : Can't open dsspfile "1m7yA.bssp"
#ERROR : Can't open dsspfile "1m4nA.bssp"
#ERROR : Can't open dsspfile "1b8gB.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"

## Summary of PDB Search
:397
      0.0 100%  2zyjA  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
      0.0 100%  2egyC  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
      0.0 100%  2egyB  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
      0.0 100%  2z1yB  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
      0.0 100%  2egyD  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
      0.0 100%  3cbfA  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
      0.0 100%  2zg5A  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
      0.0 100%  2z1yA  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    1e-72  39%  1wstA  [x.x.x] MULTIPLE SUBSTRATE AMINOTRANSFERASE
    4e-71  39%  1x0mA  [x.x.x] AMINOTRANSFERASE II HOMOLOGUE
    5e-51  39%  1vp4B  [c.67.1] AMINOTRANSFERASE, PUTATIVE
    5e-51  39%  1vp4A  [c.67.1] AMINOTRANSFERASE, PUTATIVE
    2e-46  34%  2zc0A  [x.x.x] ALANINE GLYOXYLATE TRANSAMINASE
    8e-37  30%  2r2nA  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    2e-35  30%  2vgzA  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    7e-35  30%  2qlrA  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    9e-35  30%  3dc1B  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    1e-34  30%  3dc1D  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    2e-34  30%  3dc1A  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    7e-17  27%  1gd9A  [c.67.1] ASPARTATE AMINOTRANSFERASE
    7e-17  27%  1djuB  [c.67.1] AROMATIC AMINOTRANSFERASE
    7e-17  27%  1djuA  [c.67.1] AROMATIC AMINOTRANSFERASE
    1e-16  32%  1v2dA  [c.67.1] GLUTAMINE AMINOTRANSFERASE
    6e-16  32%  1v2eB  [c.67.1] GLUTAMINE AMINOTRANSFERASE
    6e-16  32%  1v2eA  [c.67.1] GLUTAMINE AMINOTRANSFERASE
    2e-15  26%  1o4sB  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-15  26%  1o4sA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-15  28%  1gc3A  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-15  28%  1bkgA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-15  28%  5bj4A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    4e-15  28%  5bj3A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    4e-15  28%  1b5pA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    5e-15  28%  1b5oA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    2e-14  28%  1bjwA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    6e-12  27%  2o1bA  [x.x.x] AMINOTRANSFERASE, CLASS I
    2e-11  30%  1ijiA  [c.67.1] HISTIDINOL PHOSPHATE AMINOTRANSFERASE
    2e-11  30%  1geyA  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-11  30%  1gexA  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-11  30%  1gewA  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    3e-11  31%  1fg7A  [c.67.1] HISTIDINOL PHOSPHATE AMINOTRANSFERASE
    7e-11  28%  2gb3F  [x.x.x] ASPARTATE AMINOTRANSFERASE
    7e-11  28%  2gb3E  [x.x.x] ASPARTATE AMINOTRANSFERASE
    7e-11  28%  2gb3D  [x.x.x] ASPARTATE AMINOTRANSFERASE
    7e-11  28%  2gb3C  [x.x.x] ASPARTATE AMINOTRANSFERASE
    7e-11  28%  2gb3B  [x.x.x] ASPARTATE AMINOTRANSFERASE
    7e-11  28%  2gb3A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-10  29%  3jtxA  [x.x.x] AMINOTRANSFERASE
    2e-10  31%  2douB  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    2e-10  31%  2douA  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    1e-09  30%  3jtxB  [x.x.x] AMINOTRANSFERASE
    2e-09  32%  2o0rB  [x.x.x] RV0858C (N-SUCCINYLDIAMINOPIMELATE
    2e-09  32%  2o0rA  [x.x.x] RV0858C (N-SUCCINYLDIAMINOPIMELATE
    1e-08  23%  2z61A  [x.x.x] PROBABLE ASPARTATE AMINOTRANSFERASE 2
    7e-08  22%  3dydB  [x.x.x] TYROSINE AMINOTRANSFERASE
    7e-08  22%  3dydA  [x.x.x] TYROSINE AMINOTRANSFERASE
    3e-07  26%  1xi9C  [c.67.1] PUTATIVE TRANSAMINASE
    3e-07  26%  1xi9B  [c.67.1] PUTATIVE TRANSAMINASE
    3e-07  26%  1xi9A  [c.67.1] PUTATIVE TRANSAMINASE
    4e-07  31%  3h14A  [x.x.x] AMINOTRANSFERASE, CLASSES I AND II
    6e-07  27%  3ffhA  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    8e-07  25%  1w7nA  [c.67.1] KYNURENINE--OXOGLUTARATE TRANSAMINASE I
    8e-07  25%  1w7lA  [c.67.1] KYNURENINE--OXOGLUTARATE TRANSAMINASE I
    1e-06  28%  1yiyA  [x.x.x] KYNURENINE AMINOTRANSFERASE GLUTAMINE
    1e-06  28%  2r5cB  [x.x.x] KYNURENINE AMINOTRANSFERASE
    1e-06  25%  3fvsA  [x.x.x] KYNURENINE--OXOGLUTARATE TRANSAMINASE 1
    2e-06  26%  3ffhB  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-06  29%  3d6kD  [x.x.x] PUTATIVE AMINOTRANSFERASE
    2e-06  29%  3d6kC  [x.x.x] PUTATIVE AMINOTRANSFERASE
    2e-06  29%  3d6kB  [x.x.x] PUTATIVE AMINOTRANSFERASE
    2e-06  29%  3d6kA  [x.x.x] PUTATIVE AMINOTRANSFERASE
    2e-06  28%  3ezsB  [x.x.x] AMINOTRANSFERASE ASPB
    2e-06  28%  3ezsA  [x.x.x] AMINOTRANSFERASE ASPB
    3e-06  27%  1yizA  [x.x.x] KYNURENINE AMINOTRANSFERASE GLUTAMINE
    3e-06  27%  2r5cA  [x.x.x] KYNURENINE AMINOTRANSFERASE
    2e-05  25%  3b46B  [x.x.x] AMINOTRANSFERASE BNA3
    2e-05  25%  3b46A  [x.x.x] AMINOTRANSFERASE BNA3
    4e-05  25%  1u08B  [c.67.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
    4e-05  25%  1u08A  [c.67.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
    4e-05  23%  1d2fB  [c.67.1] MALY PROTEIN
    4e-05  23%  1d2fA  [c.67.1] MALY PROTEIN
    6e-05  24%  2z1zA  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    6e-05  24%  3ei7B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    6e-05  24%  3ei7A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    6e-05  24%  3ei6B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    6e-05  24%  3ei6A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    8e-05  22%  3eiaB  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    8e-05  22%  3eiaA  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    8e-05  22%  3ei9B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    8e-05  22%  3ei9A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    8e-05  22%  3ei8A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    1e-04  30%  3hdoB  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-04  30%  3hdoA  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-04  27%  1ynuA  [x.x.x] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE
    8e-04  27%  1m7yA  [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE
    8e-04  27%  1m4nA  [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE
    8e-04  27%  1b8gB  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    8e-04  27%  1b8gA  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
:397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKPLSWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKXXXXXXXXRILREKGEVALQY
2zyjA           MKPLSWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKXXXXXXXXRILREKGEVALQY
2egyC           -KPLSWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKXXXXXXXXRILREKGEVALQY
2egyB           -KPLSWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKXXXXXXXXRILREKGEVALQY
2z1yB           ---LSWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKXXXXXXXXRILREKGEVALQY
2egyD           ----SWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKXXXXXXXXRILREKGEVALQY
3cbfA           ----SWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKXXXXXXXXRILREKGEVALQY
2zg5A           ----SWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKXXXXXXXXRILREKGEVALQY
2z1yA           ---LSWSEAFGKGAGRIQASTIRELLK-----GILSFAGGLPAPELFPKXXXXXXXXRILREKGEVALQY
1wstA           ---INFDSFFSEKAMLMKASEVRELLKLVETSDVISLAGGLPAPETFPVETIKKIAVEVLEEHADKALQY
1x0mA           ---------FSKKALEMRASEVRELLKLVETSDIISLAGGLPNPKTFPKEIIRDILVEIMEKYADKALQY
1vp4B           --------------GQNKSSIIREILKFAADKDAISFGGGVPDPETFPRXXXXXXXXXXXXXXYHYTLQY
1vp4A           --------------GQNKSSIIREILKFAADKDAISFGGGVPDPETFPRXXXXXXXXXXXXXXYHYTLQY
2zc0A           -------------ANWIKGSALADVMKKAQKKGVISLAAGDPDPELIPRAVLGEIAKEVL-EKEPKSVMY
2r2nA           -------------------SPIRTMTDILSRKSMISLAGGLPNPNMFPFKTAVITVEQFGEEMMKRALQY
2vgzA           -------------------------------PSMISLAGGLPNPNMFPFKTAVITVEQFGEEMMKRALQY
2qlrA           -------------------SPIRTMTDILSRKSMISLAGGLPNPNMFPFKTAVITVEQFGEEMMKRALQY
3dc1B           ------------------ASAARNPSPIRGPKSMISLAGGLPNPNMFPFKTAVITVEQFGEEMMKRALQY
3dc1D           ------------------ASAARNPSPIRRGPSMISLAGGLPNPNMFPFKTAVITVEQFGEEMMKRALQY
3dc1A           ---------------------------------MISLAGGLPNPNMFPFKTAVITVEQFGEEMMKRALQY
1gd9A           ---------------------------------------------------------------------Y
1djuB           ---------------------------------------------------------------------Y
1djuA           ---------------------------------------------------------------------Y
1v2dA           ---------------RTEAAIFPRMSGLAQRLGAVNLGQGFPSNP--PPPFLLEAVRRALGRQD----QY
1v2eB           ---------------------------LAQRLGAVNLGQGFPSNP--PPPFLLEAVRRALGRQD----QY
1v2eA           ---------------------------LAQRLGAVNLGQGFPSNP--PPPFLLEAVRRALGRQD----QY
1o4sB           -------------------------------------------------------------QKGEV--KY
1o4sA           -------------------------------------------------------------QKGEV--KY
1gc3A           --------------------------------------------------------------------KY
1bkgA           --------------------------------------------------------------------KY
5bj4A           --------------------------------------------------------------------KY
5bj3A           --------------------------------------------------------------------KY
1b5pA           --------------------------------------------------------------------KY
1b5oA           --------------------------------------------------------------------KY
1bjwA           --------------------------------------------------------------------KY
2o1bA           ----------------------------------------------------------------------
1ijiA           ----------------------------------------------------------------------
1geyA           ----------------------------------------------------------------------
1gexA           ----------------------------------------------------------------------
1gewA           ----------------------------------------------------------------------
1fg7A           ----------------------------------------------------------------------
2gb3F           ----------------------------------------LKTPEVF--------FERIYENKPEV-VYY
2gb3E           ----------------------------------------LKTPEVF--------FERIYENKPEV-VYY
2gb3D           ----------------------------------------LKTPEVF--------FERIYENKPEV-VYY
2gb3C           ----------------------------------------LKTPEVF--------FERIYENKPEV-VYY
2gb3B           ----------------------------------------LKTPEVF--------FERIYENKPEV-VYY
2gb3A           ----------------------------------------LKTPEVF--------FERIYENKPEV-VYY
3jtxA           --------------------------------------------------------------------KY
2douB           ----------------------------------------------------------------------
2douA           ----------------------------------------------------------------------
3jtxB           --------------------------------------------------------------------KY
2o0rB           --------------------------------------------------------------------QY
2o0rA           --------------------------------------------------------------------QY
2z61A           ---------------------------------------------------------------------Y
3dydB           ---------------------------------------------------------------------Y
3dydA           ---------------------------------------------------------------------Y
1xi9C           ---------------------------------------------------------------------Y
1xi9B           ---------------------------------------------------------------------Y
1xi9A           ---------------------------------------------------------------------Y
3h14A           --------------------------------------------------------------RGAVEALA
3ffhA           ----------------------------------------------------------------------
1w7nA           --------------------------------------------------------------------QY
1w7lA           --------------------------------------------------------------------QY
1yiyA           ----------------------------------------------------------------------
2r5cB           ----------------------------------------------------------------------
3fvsA           --------------------------------------------------------------------QY
3ffhB           ----------------------------------------------------------------------
3d6kD           ----------------------------------------------------------------------
3d6kC           ----------------------------------------------------------------------
3d6kB           ----------------------------------------------------------------------
3d6kA           ----------------------------------------------------------------------
3ezsB           ----------------------------------------------------------------------
3ezsA           ----------------------------------------------------------------------
1yizA           ----------------------------------------------------------------------
2r5cA           ----------------------------------------------------------------------
3b46B           --------------------------------------------------------------------QY
3b46A           --------------------------------------------------------------------QY
1u08B           ---------------------------------------------------------RLAHHVAQGANQY
1u08A           ---------------------------------------------------------RLAHHVAQGANQY
1d2fB           ----------------------------------------------------------------------
1d2fA           ----------------------------------------------------------------------
2z1zA           ---------------------------------------------------------------------Y
3ei7B           ---------------------------------------------------------------------Y
3ei7A           ---------------------------------------------------------------------Y
3ei6B           ---------------------------------------------------------------------Y
3ei6A           ---------------------------------------------------------------------Y
3eiaB           ---------------------------------------------------------------------Y
3eiaA           ---------------------------------------------------------------------Y
3ei9B           ---------------------------------------------------------------------Y
3ei9A           ---------------------------------------------------------------------Y
3ei8A           ---------------------------------------------------------------------Y
3hdoB           ----------------------------------------------------------ILEELGPAALRI
3hdoA           ----------------------------------------------------------ILEELGPAALRI
1ynuA           ----------------------------------------------------------------------
1m7yA           ----------------------------------------------------------------------
1m4nA           ----------------------------------------------------------------------
1b8gB           ----------------------------------------------------------------------
1b8gA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
2zyjA           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
2egyC           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
2egyB           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
2z1yB           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
2egyD           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
3cbfA           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
2zg5A           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
2z1yA           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
1wstA           GTTKGFTPLRLALARWMEKRYDEIMTVAGSQQALDLIGRVFLNPGDPIVVEAPTYLAAIQAFKYYDPEFI
1x0mA           GTTKGFTPLRETLMKWLGKRDNDIMITSGSQQALDLIGRVFLNPGDIVVVEAPTYLAALQAFNFYEPQYI
1vp4B           STTEGDPVLKQQILKLLGLDEDNLIFTVGSQQALDLIGKLFLDDESYCVLDDPAYLGAINAFRQYLANFV
1vp4A           STTEGDPVLKQQILKLLGLDEDNLIFTVGSQQALDLIGKLFLDDESYCVLDDPAYLGAINAFRQYLANFV
2zc0A           TPANGIPELRAFLKKYLEVSPENIVITIGGTGALDLLGRVLIDPGDVVITENPSYINTLLAFEQLGAKIE
2r2nA           SPSAGIPELLSWLKQLIHYPPSQLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNII
2vgzA           SPSAGIPELLSWLKQLIHYPPSQLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNII
2qlrA           SPSAGIPELLSWLKQLIHYPPSQLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNII
3dc1B           SPSAGIPELLSWLKQLIHYPPSQLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNII
3dc1D           SPSAGIPELLSWLKQLIHYPPSQLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNII
3dc1A           SPSAGIPELLSWLKQLIHYPPSQLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNII
1gd9A           GPNIGLLELREAIAEKLGIEADEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPV
1djuB           GPNIGLLELREAIAEKLGIEADEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPV
1djuA           GPNIGLLELREAIAEKLGIEADEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPV
1v2dA           APPAGLPALREALAEEFAVEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGARLV
1v2eB           APPAGLPALREALAEEFAVEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGARLV
1v2eA           APPAGLPALREALAEEFAVEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGARLV
1o4sB           TDPRGIYELREGIAKRIGERPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVN
1o4sA           TDPRGIYELREGIAKRIGERPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVN
1gc3A           APPAGIPELREALAEGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVV
1bkgA           APPAGIPELREALAEGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVV
5bj4A           APPAGIPELREALAEGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVV
5bj3A           APPAGIPELREALAEGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVV
1b5pA           APPAGIPELREALAEGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVV
1b5oA           APPAGIPELREALAEGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVV
1bjwA           APPAGIPELREALAEGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVV
2o1bA           -------------------KEDEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADPVPL
1ijiA           -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
1geyA           -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
1gexA           -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
1gewA           -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
1fg7A           -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGYSVSAETIGVECR
2gb3F           SHSAGIWELREAFASYVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLI
2gb3E           SHSAGIWELREAFASYVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLI
2gb3D           SHSAGIWELREAFASYVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLI
2gb3C           SHSAGIWELREAFASYVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLI
2gb3B           SHSAGIWELREAFASYVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLI
2gb3A           SHSAGIWELREAFASYVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLI
3jtxA           PLTAGLPELRQACANWLKRRYDEILPVLGSREALFSFVQTVLNPGKPAIVSPNPFYQIYEGATLLGGHFA
2douB           ----------------------------------------------------PSYFGAARVASL---RTF
2douA           ----------------------------------------------------PSYFGAARVASL---RTF
3jtxB           PLTAGLPELRQACANWLKRRYDEILPVLGSREALSFVQTVLNPVGKPAIVSPNPFYQIYEGATLLGGHFA
2o0rB           PPGPGSAPLRRAIAAQVDYDPEEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRV
2o0rA           PPGPGSAPLRRAIAAQVDYDPEEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRV
2z61A           TDSRGILELREKISELYDIIPDNIIITXXXXXXXXXXXXXIIDDGDEVLIQNPCYPCYKNFIRFLGPVFC
3dydB           APSIGFLSSREEIASYYHLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGYKTLAESMGIEVKLYN
3dydA           APSIGFLSSREEIASYYHLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGYKTLAESMGIEVKLYN
1xi9C           GDSEGLPELRKAIVEGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYTGLVKFYGGKPVEYR
1xi9B           GDSEGLPELRKAIVEGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYTGLVKFYGGKPVEYR
1xi9A           GDSEGLPELRKAIVEGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYTGLVKFYGGKPVEYR
3h14A           KSLEGLPALRQRIAEWYGVDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGNRLQ
3ffhA           --TEIYASLRKEVADFYQLEEEELIFTAGVDELIELLTRVLLD-XXXXXXXXXXFVQYRQNALIEGAEVR
1w7nA           TKTFGYPPLTKILASFFGIDPRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGPVFV
1w7lA           TKTFGYPPLTKILASFFGIDPRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGPVFV
1yiyA           ----------------------EVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGPRFI
2r5cB           ----------------------EVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGPRFI
3fvsA           TKTFGYPPLTKILASFFGIDPRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGPVFV
3ffhB           --------LRKEVADFYQLEEEELIFTAGVDELIELLTRVLLD-XXXXXXXXXXFVQYRQNALIEGAEVR
3d6kD           ---------------------------------------------------------------------I
3d6kC           ---------------------------------------------------------------------I
3d6kB           ---------------------------------------------------------------------I
3d6kA           ---------------------------------------------------------------------I
3ezsB           ----------------IELKENELISTLGSREVLNFPSFVLFDYQNPTIAYPNPYEGAAKFIKAKS----
3ezsA           ----------------IELKENELISTLGSREVLNFPSFVLFDYQNPTIAYPNPYEGAAKFIKAKS----
1yizA           ----------------------EVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGPRFI
2r5cA           ----------------------EVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGPRFI
3b46B           SPTRGRPSLINSLIKLYSLKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVV
3b46A           SPTRGRPSLINSLIKLYSLKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVV
1u08B           APMTGVQALREAIAQLYGYQPDDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVK
1u08A           APMTGVQALREAIAQLYGYQPDDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVK
1d2fB           ------------------------------------------ETGEGVVIHTPAYDAFYKA--IEGNQRT
1d2fA           ------------------------------------------ETGEGVVIHTPAYDAFYKA--IEGNQRT
2z1zA           GAEQGAKPLRAAIAKTLGIGDDDVFVSDGAKCDISRLQVMFQDPSYPAYVDSSVIMGQTGQFNTDVQKYG
3ei7B           GAEQGAKPLRAAIAKTLGIGDDDVFVSDGAKCDISRLQVMFQDPSYPAYVDSSVIMGQTGQFNTDVQKYG
3ei7A           GAEQGAKPLRAAIAKTLGIGDDDVFVSDGAKCDISRLQVMFQDPSYPAYVDSSVIMGQTGQFNTDVQKYG
3ei6B           GAEQGAKPLRAAIAKTLGIGDDDVFVSDGAKCDISRLQVMFQDPSYPAYVDSSVIMGQTGQFNTDVQKYG
3ei6A           GAEQGAKPLRAAIAKTLGIGDDDVFVSDGAKCDISRLQVMFQDPSYPAYVDSSVIMGQTGQFNTDVQKYG
3eiaB           GAEQGAKPLRAAIAKTLGIGDDDVFVSDGAKCDISRLQVMFQDPSYPAYVDSSVIMGQTGQFNTDVQKYG
3eiaA           GAEQGAKPLRAAIAKTLGIGDDDVFVSDGAKCDISRLQVMFQDPSYPAYVDSSVIMGQTGQFNTDVQKYG
3ei9B           GAEQGAKPLRAAIAKTLGIGDDDVFVSDGAKCDISRLQVMFQDPSYPAYVDSSVIMGQTGQFNTDVQKYG
3ei9A           GAEQGAKPLRAAIAKTLGIGDDDVFVSDGAKCDISRLQVMFQDPSYPAYVDSSVIMGQTGQFNTDVQKYG
3ei8A           GAEQGAKPLRAAIAKTLGIGDDDVFVSDGAKCDISRLQVMFQDPSYPAYVDSSVIMGQTGQFNTDVQKYG
3hdoB           YPSASSQKLREVAGELYGFDPSWI-IANGSDEVLNNLIRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVR
3hdoA           YPSASSQKLREVAGELYGFDPSWI-IANGSDEVLNNLIRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVR
1ynuA           --------------------PNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTPIHC
1m7yA           --------------------PNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTPIHC
1m4nA           --------------------PNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTPIHC
1b8gB           --------------------PNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTPIHC
1b8gA           --------------------PNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTPIHC


                         +         .         .         .         .         *         .:210
query           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
2zyjA           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
2egyC           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
2egyB           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
2z1yB           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
2egyD           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
3cbfA           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
2zg5A           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
2z1yA           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
1wstA           SIPLDDKGMRVDXXXXXXQGKRVKIVYTVSTFQNPAGVTMSVDRRKKLLELANEYDFLIVEDGPYSELYS
1x0mA           QIPLDDEGXXXXXXXXXXXXXXXXXVYTVPTFQNPAGVTMNEDRRKYLLELASEYDFIVVEDDPYGELRY
1vp4B           VVPLEDDG-DLNVLERKLKIKQVKFIYVVSNFHNPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRY
1vp4A           VVPLEDDG-DLNVLERKLKIKQVKFIYVVSNFHNPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRY
2zc0A           GVPVDNDGMRVDXXXXXAKGQKVKLIYTIPTGQNPMGVTMSMERRKALLEIASKYDLLIIEDTAYNFMRY
2r2nA           NVASDESGIVPDSLRDILSRNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQF
2vgzA           NVASDESGIVPDSLRDILSRNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQF
2qlrA           NVASDESGIVPDSLRDILSRNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQF
3dc1B           NVASDESGIVPDSLRDILSRNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQF
3dc1D           NVASDESGIVPDSLRDILSRNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQF
3dc1A           NVASDESGIVPDSLRDILSRNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQF
1gd9A           EVPTYEEDEFRLNVDELKKTDKTRAL-IINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIY
1djuB           EVPTYEEDEFRLNVDELKKTDKTRAL-IINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIY
1djuA           EVPTYEEDEFRLNVDELKKTDKTRAL-IINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIY
1v2dA           RLDLTPEGLDLSALEKAL-TPRTRAL-LLNTPMNPTGLVFGXXXXXXXXXXXXXHDLFLISDEVYDELYY
1v2eB           RLDLTPEGLDLSALEKAL-TPRTRAL-LLNTPMNPTGLVFGXXXXXXXXXXXXXHDLFLISDEVYDELYY
1v2eA           RLDLTPEGLDLSALEKAL-TPRTRAL-LLNTPMNPTGLVFGXXXXXXXXXXXXXHDLFLISDEVYDELYY
1o4sB           VVESKNFQPSLEEVEGLLVGKTK--AVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVY
1o4sA           VVESKNFQPSLEEVEGLLVGKTK--AVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVY
1gc3A           EVETLPEEGFVPDPERVRRAITPRTKALVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLYE
1bkgA           EVETLPEEGFVPDPERVRRAITPRTKALVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLYE
5bj4A           EVETLPEEGFVPDPERVRRAITPRTKALVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLYE
5bj3A           EVETLPEEGFVPDPERVRRAITPRTKALVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLYE
1b5pA           EVETLPEEGFVPDPERVRRAITPRTKALVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLYE
1b5oA           EVETLPEEGFVPDPERVRRAITPRTKALVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLYE
1bjwA           EVETLPEEGFVPDPERVRRAITPRTKALVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLYE
2o1bA           NLEPPHYLPDWSKVDSQII-DKTKLIYLTYP-NNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGF
1ijiA           TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
1geyA           TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
1gexA           TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
1gewA           TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
1fg7A           TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
2gb3F           PVTRREEGFAIPQNLESFINERTKGI-VLSNPCNPTGVVYGKDER-YLVEIAERHGLFLIVDEVYSEIVF
2gb3E           PVTRREEGFAIPQNLESFINERTKGI-VLSNPCNPTGVVYGKDER-YLVEIAERHGLFLIVDEVYSEIVF
2gb3D           PVTRREEGFAIPQNLESFINERTKGI-VLSNPCNPTGVVYGKDER-YLVEIAERHGLFLIVDEVYSEIVF
2gb3C           PVTRREEGFAIPQNLESFINERTKGI-VLSNPCNPTGVVYGKDER-YLVEIAERHGLFLIVDEVYSEIVF
2gb3B           PVTRREEGFAIPQNLESFINERTKGI-VLSNPCNPTGVVYGKDER-YLVEIAERHGLFLIVDEVYSEIVF
2gb3A           PVTRREEGFAIPQNLESFINERTKGI-VLSNPCNPTGVVYGKDER-YLVEIAERHGLFLIVDEVYSEIVF
3jtxA           NCPAPSFNPDWRSIEEVWKRTK---LVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYF
2douB           LIPLREDGADLKAVPEGVWREAKVLLLNYPN--NPTGAVADWGYFEEALGLARKHGLWLIHDNPYDQVYE
2douA           LIPLREDGADLKAVPEGVWREAKVLLLNYPN--NPTGAVADWGYFEEALGLARKHGLWLIHDNPYDQVYE
3jtxB           NCPAPSFNPDWRSIEEVWKRTK---LVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYF
2o0rB           TVPLVPDGRDADALRRAV-TPRTRAL-IINSPHNPTGAVLSXXXXXXXXXXXXXXXXXXXTDEVYEHLVF
2o0rA           TVPLVPDGRDADALRRAV-TPRTRAL-IINSPHNPTGAVLSXXXXXXXXXXXXXXXXXXXTDEVYEHLVF
2z61A           DF-------TVESLEEALSDKTKAIIINSPS--NPLGEVID----REIYEFAYENIPYIISDEIYNGLVY
3dydB           LLPEKSWEIDLKQLEYLIDEKTACLIVNNPS--NPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVF
3dydA           LLPEKSWEIDLKQLEYLIDEKTACLIVNNPS--NPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVF
1xi9C           TIEEEDWQPXXXXXXXXXXXXXXAIAVINPN--NPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMYE
1xi9B           TIEEEDWQPXXXXXXXXXXXXXXAIAVINPN--NPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMYE
1xi9A           TIEEEDWQPXXXXXXXXXXXXXXAIAVINPN--NPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMYE
3h14A           PVPADFAGLDLAG--------------LVASPANPTGTLDHXXXXXXXXXXXXXXSF--ISDEIYHGIEY
3ffhA           EIPLLQDGEDLEGLNAI---DEKTTIVWICNPNNPTGNYIELADIQAFLDRVPSDVLVVL-DEAYIEYVT
1w7nA           SLKPGSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMHI
1w7lA           SLKPGSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMHI
1yiyA           PLKPNKTGGTISSADWVLDNNELEALFIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVF
2r5cB           PLKPNKTGGTISSADWVLDNNELEALFIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVF
3fvsA           SIQNGELGSQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMHI
3ffhB           EIPLLQDGEDLEGLNAI---DEKTTIVWICNPNNPTGNYIELADIQAFLDRVPSDVLVVL-DEAYIEYVT
3d6kD           NVPT-DEGPD-GVVRELVKDPQVKG-WTVPVFGNPTGVTFSEQTCRELAESTAAPDFRIVWDNAYA-LHT
3d6kC           NVPT-DEGPD-GVVRELVKDPQVKG-WTVPVFGNPTGVTFSEQTCRELAESTAAPDFRIVWDNAYA-LHT
3d6kB           NVPT-DEGPD-GVVRELVKDPQVKG-WTVPVFGNPTGVTFSEQTCRELAESTAAPDFRIVWDNAYA-LHT
3d6kA           NVPT-DEGPD-GVVRELVKDPQVKG-WTVPVFGNPTGVTFSEQTCRELAESTAAPDFRIVWDNAYA-LHT
3ezsB           LLPLTKENDFTPSLNE--KELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIY-
3ezsA           LLPLTKENDFTPSLNE--KELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIY-
1yizA           PLKPNKTGGTISSADWVLDNNELEALFIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVF
2r5cA           PLKPNKTGGTISSADWVLDNNELEALFIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVF
3b46B           YVPIGEEWTDFEQFEKAITSKTKAVIINTP--HNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYF
3b46A           YVPIGEEWTDFEQFEKAITSKTKAVIINTP--HNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYF
1u08B           RMALQPPHFRVDWQEAALLSERTR-LVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINF
1u08A           RMALQPPHFRVDWQEAALLSERTR-LVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINF
1d2fB           VMPVALEKQDMGKLEAVLAKPECKIM-LLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVW
1d2fA           VMPVALEKQDMGKLEAVLAKPECKIM-LLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVW
2z1zA           NIEYMRCTPENGFFPDLSTVGRTDIIFFC-SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAY-AMYM
3ei7B           NIEYMRCTPENGFFPDLSTVGRTDIIFFC-SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAY-AMYM
3ei7A           NIEYMRCTPENGFFPDLSTVGRTDIIFFC-SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAY-AMYM
3ei6B           NIEYMRCTPENGFFPDLSTVGRTDIIFFC-SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAY-AMYM
3ei6A           NIEYMRCTPENGFFPDLSTVGRTDIIFFC-SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAY-AMYM
3eiaB           NIEYMRCTPENGFFPDLSTVGRTDIIFFC-SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAY-AMYM
3eiaA           NIEYMRCTPENGFFPDLSTVGRTDIIFFC-SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAY-AMYM
3ei9B           NIEYMRCTPENGFFPDLSTVGRTDIIFFC-SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAY-AMYM
3ei9A           NIEYMRCTPENGFFPDLSTVGRTDIIFFC-SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAY-AMYM
3ei8A           NIEYMRCTPENGFFPDLSTVGRTDIIFFC-SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAY-AMYM
3hdoB           TF--GLTG-DFRIAGFPERYEGKVFFLTTPN--APLGPSFPL----EYIDELARRCAGLVLDETYAE--F
3hdoA           TF--GLTG-DFRIAGFPERYEGKVFFLTTPN--APLGPSFPL----EYIDELARRCAGLVLDETYAE--F
1ynuA           TSSNGFQITE-TALEEAYQEAEKRNLVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAF
1m7yA           TSSNGFQITE-TALEEAYQEAEKRNLVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAF
1m4nA           TSSNGFQITE-TALEEAYQEAEKRNLVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAF
1b8gB           TSSNGFQITE-TALEEAYQEAEKRNLVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAF
1b8gA           TSSNGFQITE-TALEEAYQEAEKRNLVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAF


                         .         .         .         +         .         .         .:280
query           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
2zyjA           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
2egyC           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
2egyB           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
2z1yB           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
2egyD           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
3cbfA           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
2zg5A           GEARLPSLFELAREAGYPGVIYLGSFS-VLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
2z1yA           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
1wstA           GEPTPP----IKHFDDYGRVIYLGTFSKILAPGFRIGWVAAHPHLIRKMEIAKQSIDLCTNTFGQAIAWK
1x0mA           SEKKIKALDNEGR------VIYLGTFSKILAPGFRIGWMVGDPGIIRKMEIAKQSTDLCTNVFGQVVAWR
1vp4B           EGETVDPIFKI---GGPERVVLLNTFSKVLAPGLRIGVA-GSKEFIRKIVQAKQSADLCSPAITHRLAAR
1vp4A           EGETVDPIFKI---GGPERVVLLNTFSKVLAPGLRIGVA-GSKEFIRKIVQAKQSADLCSPAITHRLAAR
2zc0A           EGGDIVPLKALDNEG---RVIVAGTLSKVLGTGFRIGWIIAEGEILKKVLMQKQPIDFCAPAISQYIALE
2r2nA           NKFRVPTFLSMDVDG---RVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQ
2vgzA           NKFRVPTFLSMDVDG---RVIRADSFS-IISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQ
2qlrA           NKFRVPTFLSMDVDG---RVIRADSFS-IISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQ
3dc1B           NKFRVPTFLSMDVDG---RVIRADSFS-IISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQ
3dc1D           NKFRVPTFLSMDVDG---RVIRADSFS-IISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQ
3dc1A           NKFRVPTFLSMDVDG---RVIRADSFS-IISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQ
1gd9A           DDARHYSIASL--DGMFERTITVNGFSKTFATGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAK
1djuB           DDARHYSIASL--DGMFERTITVNGFSKTFATGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAK
1djuA           DDARHYSIASL--DGMFERTITVNGFSKTFATGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAK
1v2dA           GE-RPRRLREFAPERTFT----VGSAGKRLATGYRVGWIVGPKEFMPRLAGMRQWTSFSAPTPLQAGVAE
1v2eB           GE-RPRRLREFAPERTFT----VGSAGKRLATGYRVGWIVGPKEFMPRLAGMRQWTSFSAPTPLQAGVAE
1v2eA           GE-RPRRLREFAPERTFT----VGSAGKRLATGYRVGWIVGPKEFMPRLAGMRQWTSFSAPTPLQAGVAE
1o4sB           TD-EFTSILDVSE--GFDRIVYINGFSKSHSTGWRVGYLISS----EKVATAVSKIQSHTTSCINTVAQY
1o4sA           TD-EFTSILDVSE--GFDRIVYINGFSKSHSTGWRVGYLISS----EKVATAVSKIQSHTTSCINTVAQY
1gc3A           GEH-----FSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTSPDTIAQWATLE
1bkgA           GEH-----FSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLE
5bj4A           GEH-----FSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTSPDTIAQWATLE
5bj3A           GEH-----FSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTSPDTIAQWATLE
1b5pA           GEH-----FSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTSPDTIAQWATLE
1b5oA           GEH-----FSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLE
1bjwA           GEH-----FSPGRVAPEHTLTVNGAAAFAMT-GWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLE
2o1bA           -DAKNPSI--LASENGKDVAIEIYSLSKGYNSGFRVGFAVGNKD-IQALKKYQTHTNAGFGALQDAAIYA
1ijiA           PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
1geyA           PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
1gexA           PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
1gewA           PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
1fg7A           PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLL---------------------
2gb3F           GE------FASALXXXXXXXXXXXXXXXFSACGARVGCLITRNEELISHAKLAQGR-LAPPLLEQIGSVG
2gb3E           GE------FASALXXXXXXXXXXXXXXXFSACGARVGCLITRNEELISHAKLAQGR-LAPPLLEQIGSVG
2gb3D           GE------FASALXXXXXXXXXXXXXXXFSACGARVGCLITRNEELISHAKLAQGR-LAPPLLEQIGSVG
2gb3C           GE------FASALXXXXXXXXXXXXXXXFSACGARVGCLITRNEELISHAKLAQGR-LAPPLLEQIGSVG
2gb3B           GE------FASALXXXXXXXXXXXXXXXFSACGARVGCLITRNEELISHAKLAQGR-LAPPLLEQIGSVG
2gb3A           GE------FASALXXXXXXXXXXXXXXXFSACGARVGCLITRNEELISHAKLAQGR-LAPPLLEQIGSVG
3jtxA           GNKPLGCLQAAAQLGRSRQKLLFTSLSRSNVPGLRSGFVAGDAELLKNFL--------------------
2douB           GEAPSPLALPGAKER----VVELFSLSKSYNAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVE
2douA           GEAPSPLALPGAKER----VVELFSLSKSYNAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVE
3jtxB           GNKPLGCLQAAAQLGRSRQKLLFTSLSRSNVPGLRSGFVAGDAELLKNFL--------------------
2o0rB           DHARHLPL------AGFDGMITISSAAMFNCTGWKIGWACGPAELIAGVRAAKQ----------------
2o0rA           DHARHLPL------AGFDGMITISSAAMFNCTGWKIGWACGPAELIAGVRAAKQ----------------
2z61A           -EGKCYSAIEF--DENLEKTILINGFSLYAMTGWRIGYVISNDEIIEAILKLQQNLFISAPTISQYAALK
3dydB           SDCKYEPLATLSTDV--PILSCGGLAKRWLVPGWRLGWILIH----------------------------
3dydA           SDCKYEPLATLSTDV--PILSCGGLAKRWLVPGWRLGWILIH----------------------------
1xi9C           GEHISPG--SLTKDV---PVIVMNGLSKVFATGWRLGYMFVDPE--NKLSEVREAID-------------
1xi9B           GEHISPG--SLTKDV---PVIVMNGLSKVFATGWRLGYMFVDPE--NKLSEVREAID-------------
1xi9A           GEHISPG--SLTKDV---PVIVMNGLSKVFATGWRLGYMFVDPE--NKLSEVREAID-------------
3h14A           -EAKAVTALELTDEC-----YVINSFSKYFSTGWRVGWVV--PEDQVRVVERIAQNFICAPHASQVXXXX
3ffhA           PQPEKHE--KLVRT--YKNLIITRTFSKIYGASARVGYGIADKEIIRQLNIVR--PPFNTTSIGQKLAIE
1w7nA           SIASLPGMWE--------RTLTIGSAGKTFSTGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAE
1w7lA           SIASLPGMWE--------RTLTIGSAGTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAE
1yiyA           ------EPFEHIRICTLPGMITIGSAGKTFSTGWKIGWAYG-PEALLKNLQ-------------------
2r5cB           ------EPFEHIRICTLPGMITIGSAGKTFSTGWKIGWAYG-PEALLKNLQ-------------------
3fvsA           SIASLPGMWE--------RTLTIGSAGTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAE
3ffhB           PQPEKHE--KLVRT--YKNLIITRTFSKIYGASARVGYGIADKEIIRQLNIVR--PPFNTTSIGQKLAIE
3d6kD           LSDEFPNVIEFAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVRGIGPNKLNQLAHAQ
3d6kC           LSDEFPNVIEFAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVRGIGPNKLNQLAHAQ
3d6kB           LSDEFPNVIEFAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVRGIGPNKLNQLAHAQ
3d6kA           LSDEFPNVIEFAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVRGIGPNKLNQLAHAQ
3ezsB           ENTPPPSLLELAGNEAFKNVLVIHSLSKRSSPGLRSGFIAGDSRLLEK----------------------
3ezsA           ENTPPPSLLELAGNEAFKNVLVIHSLSKRSSPGLRSGFIAGDSRLLEK----------------------
1yizA           ------EPFEHIRICTLPGMITIGSAGTFSLTGWKIGWAYG-PEALLKNLQ-------------------
2r5cA           ------EPFEHIRICTLPGMITIGSAGTFSLTGWKIGWAYG-PEALLKNLQ-------------------
3b46B           TDS-FTRIATLSPEIGQL-TLTVGSAGSFAATGWRIGWVLS-----------------------------
3b46A           TDS-FTRIATLSPEIGQL-TLTVGSAGSFAATGWRIGWVLS-----------------------------
1u08B           SQQGHASV--LAHPQLRERAVAVSSFGKTYMTGWKVGYCVA-----------------------------
1u08A           SQQGHASV--LAHPQLRERAVAVSSFGKTYMTGWKVGYCVA-----------------------------
1d2fB           GEQPHIPWSNVAR--GDWALLTSGSKSFNI-PALTGAYGIENSSSRDAYLSALKGRDLSSPSVLALTAHI
1d2fA           GEQPHIPWSNVAR--GDWALLTSGSKSFNI-PALTGAYGIENSSSRDAYLSALKGRDLSSPSVLALTAHI
2z1zA           SDDNPRSIFEIAEEV----AMETASFSKYAGTGVRLGWTV------------------------------
3ei7B           SDDNPRSIFEIAEEV----AMETASFSKYAGTGVRLGWTV------------------------------
3ei7A           SDDNPRSIFEIAEEV----AMETASFSKYAGTGVRLGWTV------------------------------
3ei6B           SDDNPRSIFEIAEEV----AMETASFSKYAGTGVRLGWTV------------------------------
3ei6A           SDDNPRSIFEIAEEV----AMETASFSKYAGTGVRLGWTV------------------------------
3eiaB           SDDNPRSIFEI-----------------------------------------------------------
3eiaA           SDDNPRSIFEI-----------------------------------------------------------
3ei9B           SDDNPRSIFEI-----------------------------------------------------------
3ei9A           SDDNPRSIFEI-----------------------------------------------------------
3ei8A           SDDNPRSIFEI-----------------------------------------------------------
3hdoB           AES---NALELVRR--HENVVVTRTLSKSYSLAGRIGLAIARPEVIAAL---------------------
3hdoA           AES---NALELVRR--HENVVVTRTLSKSYSLAGRIGLAIARPEVIAAL---------------------
1ynuA           SSPSFISVMEVLKDSEWQRVHVVYSLSKDLGPGFRV----------------------------------
1m7yA           SSPSFISVMEVLKDRNWQRVHVVYSLSKDLGPGFRV----------------------------------
1m4nA           SSPSFISVMEVLKDRNWQRVHVVYSLSKDLGPGFRV----------------------------------
1b8gB           SSPSFISVMEVLKDRNWQRVHVVYSLSKDLGPGFRV----------------------------------
1b8gA           SSPSFISVMEVLKDRNWQRVHVVYSLSKDLGPGFRV----------------------------------


                         .         *         .         .         .         .         +:350
query           LLKEGFSXXXXXXXXXXXXKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
2zyjA           LLKEGFSXXXXXXXXXXXXKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
2egyC           LLKEGFSXXXXXXXXXXXXKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
2egyB           LLKEGFSXXXXXXXXXXXXKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
2z1yB           LLKEGFSXXXXXXXXXXXXKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
2egyD           LLKEGFSXXXXXXXXXXXXKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
3cbfA           LLKEGFSXXXXXXXXXXXXKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
2zg5A           LLKEGFSXXXXXXXXXXXXKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
2z1yA           LLKEGFSXXXXXXXXXXXXKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
1wstA           YVENGYDEHIPKIIEFYKPRRDAMLEALEEYMPEGVEWTKPEGGMFVRVTLPEGIDTKLMMERAVAKGVA
1x0mA           YVDGGYEKHIPEIRKFYKPRRDAMLEALEEFMPEGVKWTKPEGGMFIWVTLPDGIDSKKMLERAIKKGVA
1vp4B           YLERYDLLEQLKPTIELYRRKRTVLNALEEDIP-GVKWVKSEGGLFIWLTLPEGFDT-WEFEYAKRKKVF
1vp4A           YLERYDLLEQLKPTIELYRRKRTVLNALEEDIP-GVKWVKSEGGLFIWLTLPEGFDT-WEFEYAKRKKVF
2zc0A           YLKRGYKYHLEGALLGYKEKRDIMLKALENHLP-NAEFTKPIAGMFVMFFLPEGADGISFANELMEEGVV
2r2nA           LLEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV-KGINKELIEEKAVKMGVL
2vgzA           LLEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV-KGINKELIEEKAVKMGVL
2qlrA           LLEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV-KGINKELIEEKAVKMGVL
3dc1B           LLEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV-KGINKELIEEKAVKMGVL
3dc1D           LLEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV-KGINKELIEEKAVKMGVL
3dc1A           LLEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV-KGINKELIEEKAVKMGVL
1gd9A           ALKDERSWKAVEEMRKEYDRRRKLVWKRLNEM--GLPTVKPKGAFYIFPRIDTGLTSKKFSELMLKERVA
1djuB           ALKDERSWKAVEEMRKEYDRRRKLVWKRLNEM--GLPTVKPKGAFYIFPRIDTGLTSKKFSELMLKERVA
1djuA           ALKDERSWKAVEEMRKEYDRRRKLVWKRLNEM--GLPTVKPKGAFYIFPRIDTGLTSKKFSELMLKERVA
1v2dA           ALKEGFYEALREXXXXXXXXXXXXXXXXXXXV-----YV-PEGTYFLMAELP-GWDA---FRLVEEARVA
1v2eB           ALKEGFYEALREXXXXXXXXXXXXXXXXXXXV-----YV-PEGTYFLMAELP-GWDA---FRLVEEARVA
1v2eA           ALKEGFYEALREXXXXXXXXXXXXXXXXXXXV-----YV-PEGTYFLMAELP-GWDA---FRLVEEARVA
1o4sB           AALKALEVDNSYMVQTFKERKNFVVERLKK---MGVKFVEPEGAFYLFFKV-RGDDVKFCERLLEEKKVA
1o4sA           AALKALEVDNSYMVQTFKERKNFVVERLKK---MGVKFVEPEGAFYLFFKV-RGDDVKFCERLLEEKKVA
1gc3A           ALQEASRAFVEMAREAYRRRRDXXXXXXXXXXXKAV---RPSGAFYVLMDTPIAPDEVRAAERLLEAGVA
1bkgA           ALQEASRAFVEMAREAYRRRRDXXXXXXXXXXXKAV---RPSGAFYVLMDTPIAPDEVRAAERLLEAGVA
5bj4A           ALQEASRAFVEMAREAYRRRRDXXXXXXXXXXXKAV---RPSGAFYVLMDTPIAPDEVRAAERLLEAGVA
5bj3A           ALQEASRAFVEMAREAYRRRRDXXXXXXXXXXXKAV---RPSGAFYVLMDTPIAPDEVRAAERLLEAGVA
1b5pA           ALQEASRAFVEMAREAYRRRRDXXXXXXXXXXXKAV---RPSGAFYVLMDTPIAPDEVRAAERLLEAGVA
1b5oA           ALQEASRAFVEMAREAYRRRRDXXXXXXXXXXXKAV---RPSGAFYVLMDTPIAPDEVRAAERLLEAGVA
1bjwA           ALQEASRAFVEMAREAYRRRRDXXXXXXXXXXXKAV---RPSGAFYVLMDTPIAPDEVRAAERLLEAGVA
2o1bA           LNHDDFLEEQSNVFKTRRDRFEALAKA-------DLPFVHAKGGIYVWLETPPGYDSE-QFEQFLEKSIL
1ijiA           ----------------------------------------------------------------------
1geyA           ----------------------------------------------------------------------
1gexA           ----------------------------------------------------------------------
1gewA           ----------------------------------------------------------------------
1fg7A           ----------------------------------------------------------------------
2gb3F           LLNLDDS-FFDFVRETYRERVETVLKKLEEHGLK--RFTKPSGAFYITAELP------------------
2gb3E           LLNLDDS-FFDFVRETYRERVETVLKKLEEHGLK--RFTKPSGAFYITAELP------------------
2gb3D           LLNLDDS-FFDFVRETYRERVETVLKKLEEHGLK--RFTKPSGAFYITAELP------------------
2gb3C           LLNLDDS-FFDFVRETYRERVETVLKKLEEHGLK--RFTKPSGAFYITAELP------------------
2gb3B           LLNLDDS-FFDFVRETYRERVETVLKKLEEHGLK--RFTKPSGAFYITAELP------------------
2gb3A           LLNLDDS-FFDFVRETYRERVETVLKKLEEHGLK--RFTKPSGAFYITAELP------------------
3jtxA           ----------------------------------------------------------------------
2douB           ALKTP-KEVVRGYARVYRERALGMAEALKGVLS----LLPPRATMYLWGRLPEGVDDLEFGLRLVERGVA
2douA           ALKTP-KEVVRGYARVYRERALGMAEALKGVLS----LLPPRATMYLWGRLPEGVDDLEFGLRLVERGVA
3jtxB           ----------------------------------------------------------------------
2o0rB           ----------------------------------------------------------------------
2o0rA           ----------------------------------------------------------------------
2z61A           AFEK-----------ETEREINSMIKEFDRRRRLVLKYVKPIGAYYVFPNIGED-GREFAYKLLKEKFVA
3dydB           ----------------------------------------------------------------------
3dydA           ----------------------------------------------------------------------
1xi9C           ----------------------------------------------------------------------
1xi9B           ----------------------------------------------------------------------
1xi9A           ----------------------------------------------------------------------
3h14A           XXXXXXXXXXNLDVYKANRK-------LLERLPKATRIAPPDGAFYVYADVSDLTDDSRAFAAEILEGVA
3ffhA           AIKD------------------------------------------------------------------
1w7nA           ----------------------------------------------------------------------
1w7lA           ----------------------------------------------------------------------
1yiyA           ----------------------------------------------------------------------
2r5cB           ----------------------------------------------------------------------
3fvsA           ----------------------------------------------------------------------
3ffhB           AIKD------------------------------------------------------------------
3d6kD           FFGDXXXXXXXXXXXXXXXXFERVLEILDSRLSEVAKWTSPTGGYFISVDVVPG-TASRVVELAKEAGIA
3d6kC           FFGDXXXXXXXXXXXXXXXXFERVLEILDSRLSEVAKWTSPTGGYFISVDVVPG-TASRVVELAKEAGIA
3d6kB           FFGDXXXXXXXXXXXXXXXXFERVLEILDSRLSEVAKWTSPTGGYFISVDVVPG-TASRVVELAKEAGIA
3d6kA           FFGDXXXXXXXXXXXXXXXXFERVLEILDSRLSEVAKWTSPTGGYFISVDVVPG-TASRVVELAKEAGIA
3ezsB           ----------------------------------------------------------------------
3ezsA           ----------------------------------------------------------------------
1yizA           ----------------------------------------------------------------------
2r5cA           ----------------------------------------------------------------------
3b46B           ----------------------------------------------------------------------
3b46A           ----------------------------------------------------------------------
1u08B           ----------------------------------------------------------------------
1u08A           ----------------------------------------------------------------------
1d2fB           AAYQQGAPWLDALRIYLKDNLTYIADKMNAAFP-ELNWQIPQSTYLAWLDLPLNIDDNALQKALIEEKVA
1d2fA           AAYQQGAPWLDALRIYLKDNLTYIADKMNAAFP-ELNWQIPQSTYLAWLDLPLNIDDNALQKALIEEKVA
2z1zA           ----------------------------------------------------------------------
3ei7B           ----------------------------------------------------------------------
3ei7A           ----------------------------------------------------------------------
3ei6B           ----------------------------------------------------------------------
3ei6A           ----------------------------------------------------------------------
3eiaB           ----------------------------------------------------------------------
3eiaA           ----------------------------------------------------------------------
3ei9B           ----------------------------------------------------------------------
3ei9A           ----------------------------------------------------------------------
3ei8A           ----------------------------------------------------------------------
3hdoB           ----------------------------------------------------------------------
3hdoA           ----------------------------------------------------------------------
1ynuA           ----------------------------------------------------------------------
1m7yA           ----------------------------------------------------------------------
1m4nA           ----------------------------------------------------------------------
1b8gB           ----------------------------------------------------------------------
1b8gA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FVPGGPFFANGGGENTLRLSYATLDREGIAExxxxxxxxxxxxxxxx
2zyjA           FVPGGPFFANGGGENTLRLSYATLDREGIAE----------------
2egyC           FVPGGPFFANGGGENTLRLSYATLDREGIAE----------------
2egyB           FVPGGPFFANGGGENTLRLSYATLDREGIAE----------------
2z1yB           FVPGGPFFANGGGENTLRLSYATLDREGIAE----------------
2egyD           FVPGGPFFANGGGENTLRLSYATLDREGIAE----------------
3cbfA           FVPGGPFFANGGGENTLRLSYATLDREGIAE----------------
2zg5A           FVPGGPFFANGGGENTLRLSYATLDREGIAE----------------
2z1yA           FVPGGPFFANGGGENTLRLSYATLDREGIAE----------------
1wstA           YVPGEAFFVHRDKKNTMRLNFTYVPEETIRE----------------
1x0mA           YVPGEAFYAHRDVKNTMRLNFTYVDEDKIME----------------
1vp4B           YVPGRVF----------------------------------------
1vp4A           YVPGRVF----------------------------------------
2zc0A           VVPGKPFYTDESGKNAIRLNFSRPSKEEI------------------
2r2nA           MLPGNAFYVDSSAPSPLRASFSSASPE--------------------
2vgzA           MLPGNAFYVDSSAPSPLRASFSSASPE--------------------
2qlrA           MLPGNAFYVDSSAPSPLRASFSSASPE--------------------
3dc1B           MLPGNAFYVDSSAPSPLRASFSSASPE--------------------
3dc1D           MLPGNAFYVDSSAPSPLRASFSSASPE--------------------
3dc1A           MLPGNAFYVDSSAPSPLRASFSSASPE--------------------
1gd9A           VVPGSAF--GKAGEGYVRISYAT------------------------
1djuB           VVPGSAF--GKAGEGYVRISYAT------------------------
1djuA           VVPGSAF--GKAGEGYVRISYAT------------------------
1v2dA           LIPASAFYLEDPPKDLFRFAFCKTEEE--------------------
1v2eB           LIPASAFYLEDPPKDLFRFAFCKTEEE--------------------
1v2eA           LIPASAFYLEDPPKDLFRFAFCKTEEE--------------------
1o4sB           LVPGSAFLKPG----FVRLSFAT------------------------
1o4sA           LVPGSAFLKPG----FVRLSFAT------------------------
1gc3A           VVPGTDFAAFG----HVRLSYAT------------------------
1bkgA           VVPGTDFAAFG----HVRLSYAT------------------------
5bj4A           VVPGTDFAAFG----HVRLSYAT------------------------
5bj3A           VVPGTDFAAFG----HVRLSYAT------------------------
1b5pA           VVPGTDFAAFG----HVRLSYAT------------------------
1b5oA           VVPGTDFAAFG----HVRLSYAT------------------------
1bjwA           VVPGTDFAAFG----HVRLSYAT------------------------
2o1bA           VAPGKPFGEN--GNRYVRISLALDDQK--------------------
1ijiA           -----------------------------------------------
1geyA           -----------------------------------------------
1gexA           -----------------------------------------------
1gewA           -----------------------------------------------
1fg7A           -----------------------------------------------
2gb3F           -----------------------------------------------
2gb3E           -----------------------------------------------
2gb3D           -----------------------------------------------
2gb3C           -----------------------------------------------
2gb3B           -----------------------------------------------
2gb3A           -----------------------------------------------
3jtxA           -----------------------------------------------
2douB           -----------------------------------------------
2douA           -----------------------------------------------
3jtxB           -----------------------------------------------
2o0rB           -----------------------------------------------
2o0rA           -----------------------------------------------
2z61A           LTPGIGF--GSKGKNYIRISYA-------------------------
3dydB           -----------------------------------------------
3dydA           -----------------------------------------------
1xi9C           -----------------------------------------------
1xi9B           -----------------------------------------------
1xi9A           -----------------------------------------------
3h14A           VTPGLDFDPERGA-GTLRFSYA-------------------------
3ffhA           -----------------------------------------------
1w7nA           -----------------------------------------------
1w7lA           -----------------------------------------------
1yiyA           -----------------------------------------------
2r5cB           -----------------------------------------------
3fvsA           -----------------------------------------------
3ffhB           -----------------------------------------------
3d6kD           LTGAGSSFPNDPNNENIRLA---------------------------
3d6kC           LTGAGSSFPNDPNNENIRLA---------------------------
3d6kB           LTGAGSSFPNDPNNENIRLA---------------------------
3d6kA           LTGAGSSFPNDPNNENIRLA---------------------------
3ezsB           -----------------------------------------------
3ezsA           -----------------------------------------------
1yizA           -----------------------------------------------
2r5cA           -----------------------------------------------
3b46B           -----------------------------------------------
3b46A           -----------------------------------------------
1u08B           -----------------------------------------------
1u08A           -----------------------------------------------
1d2fB           IMPGYTYGEEGRG----------------------------------
1d2fA           IMPGYTYGEEGRG----------------------------------
2z1zA           -----------------------------------------------
3ei7B           -----------------------------------------------
3ei7A           -----------------------------------------------
3ei6B           -----------------------------------------------
3ei6A           -----------------------------------------------
3eiaB           -----------------------------------------------
3eiaA           -----------------------------------------------
3ei9B           -----------------------------------------------
3ei9A           -----------------------------------------------
3ei8A           -----------------------------------------------
3hdoB           -----------------------------------------------
3hdoA           -----------------------------------------------
1ynuA           -----------------------------------------------
1m7yA           -----------------------------------------------
1m4nA           -----------------------------------------------
1b8gB           -----------------------------------------------
1b8gA           -----------------------------------------------