[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS80551.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3glaB.bssp"
#ERROR : Can't open dsspfile "3glaA.bssp"
#ERROR : Can't open dsspfile "1shsA.bssp"

## Summary of PDB Search
:136
    2e-11  35%  3glaB  [x.x.x] LOW MOLECULAR WEIGHT HEAT SHOCK PROTEIN
    2e-10  34%  3glaA  [x.x.x] LOW MOLECULAR WEIGHT HEAT SHOCK PROTEIN
    9e-06  30%  1shsA  [b.15.1] SMALL HEAT SHOCK PROTEIN
:136

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAAWTPRVDLLETEEHYVLLVDLPGVRPEDLELLEEGQ
3glaB           -----------------------------------WVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDKG
3glaA           ---------------------------------AQWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDKG
1shsA           ---------------------------------------ISIIEGDQHIKVIAWLPGVNKEDIILNAVGD


                         .         .         *         .         .         .         .:140
query           RVTLAGVRHPLPGTYLLEERPMGTFRRTLDLPGPIEEGTAQATLRNGVLEVRFRKRPAxxxxxxxx
3glaB           ILSIRGXXXXXXXXXXXXXXXYGSFHRRFALPDSADADGITAAGRNGVLEIRIPKRPA--------
3glaA           ILSIRGXXXXXXXXXXXXXXXYGSFHRRFALPDSADADGITAAGRNGVLEIRIPKR----------
1shsA           TLEIRAKRSPLMITXXXXXXXXXXXXXTIKLPATVKEENASAKFENGVLSV---------------