[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:thiS

[Show Plain Result]

#ERROR : Can't open dsspfile "2cu3B.bssp"
#ERROR : Can't open dsspfile "2cu3A.bssp"

## Summary of PDB Search
:64
    9e-17  70%  2cu3B  [x.x.x] UNKNOWN FUNCTION PROTEIN
    4e-16  69%  2cu3A  [x.x.x] UNKNOWN FUNCTION PROTEIN
:64

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xVWLNGEPRPLEGKTLKEVLEEMGVELKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVALMQGG
2cu3B           -VWLNGEPRPLEGKTXXXXXXXXXXXXXXXXXX-NEEAFLGLEVPDRPLRDGDVVEVVAL-QGG
2cu3A           -VWLNGEPRPLEGKTXXXXXXXXXXXXXXXXXX-NEEAFLGLEVPDRPLRDGDVVEVVAL----