[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS80675.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2r6gG.bssp"
#ERROR : Can't open dsspfile "3fh6G.bssp"
#ERROR : Can't open dsspfile "2zd2A.bssp"
#ERROR : Can't open dsspfile "2r31A.bssp"
#ERROR : Can't open dsspfile "2p4xA.bssp"
#ERROR : Can't open dsspfile "3d31C.bssp"

## Summary of PDB Search
:369
    1e-06  42%  2r6gG  [x.x.x] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
    1e-06  42%  3fh6G  [x.x.x] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
    2e-04  45%  2zd2A  [x.x.x] ATP12 ATPASE
    2e-04  45%  2r31A  [x.x.x] ATP12 ATPASE
    2e-04  45%  2p4xA  [x.x.x] ATP12 ATPASE
    3e-04  28%  3d31C  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, PERMEASE
:369

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2r6gG           ----------------------------------------------------------------------
3fh6G           ----------------------------------------------------------------------
2zd2A           ----------------------------------------------------------------------
2r31A           ----------------------------------------------------------------------
2p4xA           ----------------------------------------------------------------------
3d31C           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2r6gG           ----------------------------------------------------------------------
3fh6G           ----------------------------------------------------------------------
2zd2A           ----------------------------------------------------------------------
2r31A           ----------------------------------------------------------------------
2p4xA           ----------------------------------------------------------------------
3d31C           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAGVLLL
2r6gG           ----------------------------------------------------------------------
3fh6G           ----------------------------------------------------------------------
2zd2A           ----------------------------------------------------------------------
2r31A           ----------------------------------------------------------------------
2p4xA           ----------------------------------------------------------------------
3d31C           ----------------------------------------------------------------AGIALL


                         .         .         .         +         .         .         .:280
query           WAFAFGQGLRLLPYPEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFR
2r6gG           ------------------GVIFAYLGGIALHVWTIKGY--------FETIDSSLEEAAALDGATPWQAFR
3fh6G           ------------------GVIFAYLGGIALHVWTIKGY--------FETIDSSLEEAAALDGATPWQAFR
2zd2A           -------------------------------------------------LPTEALALAI---AEEWQAVQ
2r31A           -------------------------------------------------LPTEALALAI---AEEWQAVQ
2p4xA           -------------------------------------------------LPTEALALAI---AEEWQAVQ
3d31C           TVFG-SRGLIGEPLESYIQFRDALPGIVVAMLFVSMPYLANSAREGFKSVDPRLENAARSLGAPLWKAFF


                         .         *         .         .         .         .         +:350
query           RVIFPMLAPITLSAMIVLGHIALKIFDLVFAMAGLDYAPTDVxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2r6gG           LVLLPLSVPI-LAVVFILSFIA------------------------------------------------
3fh6G           LVLLPLSVPI-LAVVFILSFIA------------------------------------------------
2zd2A           EVIDPNAMPLTRSANSAIEKVAPQ-FDAVAAMLG-DYGGTDL----------------------------
2r31A           EVIDPNAMPLTRSANSAIEKVAPQ-FDAVAAMLG-DYGGTDL----------------------------
2p4xA           EVIDPNAMPLTRSANSAIEKVAPQ-FDAVAAMLG-DYGGTDL----------------------------
3d31C           FVTLPLSARYLLIGSVMTWARAISEFGAVVILA-------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxx
2r6gG           -------------------
3fh6G           -------------------
2zd2A           -------------------
2r31A           -------------------
2p4xA           -------------------
3d31C           -------------------